Basic Information | |
---|---|
Family ID | F013223 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 273 |
Average Sequence Length | 46 residues |
Representative Sequence | PRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV |
Number of Associated Samples | 235 |
Number of Associated Scaffolds | 273 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.73 % |
% of genes near scaffold ends (potentially truncated) | 99.27 % |
% of genes from short scaffolds (< 2000 bps) | 92.67 % |
Associated GOLD sequencing projects | 218 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.37 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (84.615 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen (7.326 % of family members) |
Environment Ontology (ENVO) | Unclassified (39.560 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (45.421 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.67% β-sheet: 0.00% Coil/Unstructured: 53.33% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 273 Family Scaffolds |
---|---|---|
PF00892 | EamA | 21.61 |
PF04226 | Transgly_assoc | 15.75 |
PF00171 | Aldedh | 15.02 |
PF00291 | PALP | 8.06 |
PF06764 | DUF1223 | 6.23 |
PF01035 | DNA_binding_1 | 4.03 |
PF02803 | Thiolase_C | 3.66 |
PF01717 | Meth_synt_2 | 2.93 |
PF13458 | Peripla_BP_6 | 2.56 |
PF12833 | HTH_18 | 2.20 |
PF05787 | DUF839 | 1.47 |
PF00072 | Response_reg | 1.10 |
PF00528 | BPD_transp_1 | 1.10 |
PF00486 | Trans_reg_C | 0.73 |
PF08521 | 2CSK_N | 0.73 |
PF00582 | Usp | 0.37 |
PF04392 | ABC_sub_bind | 0.37 |
PF00775 | Dioxygenase_C | 0.37 |
PF12399 | BCA_ABC_TP_C | 0.37 |
PF08770 | SoxZ | 0.37 |
PF05137 | PilN | 0.37 |
PF01326 | PPDK_N | 0.37 |
PF13620 | CarboxypepD_reg | 0.37 |
PF01494 | FAD_binding_3 | 0.37 |
PF00005 | ABC_tran | 0.37 |
PF10881 | DUF2726 | 0.37 |
PF01594 | AI-2E_transport | 0.37 |
PF00691 | OmpA | 0.37 |
PF00884 | Sulfatase | 0.37 |
PF00083 | Sugar_tr | 0.37 |
PF03009 | GDPD | 0.37 |
COG ID | Name | Functional Category | % Frequency in 273 Family Scaffolds |
---|---|---|---|
COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 15.75 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 15.02 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 15.02 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 15.02 |
COG5429 | Uncharacterized conserved protein, DUF1223 domain | Function unknown [S] | 6.23 |
COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 4.03 |
COG3695 | Alkylated DNA nucleotide flippase Atl1, participates in nucleotide excision repair, Ada-like DNA-binding domain | Transcription [K] | 4.03 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 3.66 |
COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 2.93 |
COG3211 | Secreted phosphatase, PhoX family | General function prediction only [R] | 1.47 |
COG0642 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.73 |
COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.73 |
COG3166 | Type IV pilus assembly protein PilN | Cell motility [N] | 0.73 |
COG0574 | Phosphoenolpyruvate synthase/pyruvate phosphate dikinase | Carbohydrate transport and metabolism [G] | 0.37 |
COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.37 |
COG0584 | Glycerophosphoryl diester phosphodiesterase | Lipid transport and metabolism [I] | 0.37 |
COG0628 | Predicted PurR-regulated permease PerM | General function prediction only [R] | 0.37 |
COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.37 |
COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.37 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.37 |
COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.37 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 84.62 % |
Unclassified | root | N/A | 15.38 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001213|JGIcombinedJ13530_101624478 | Not Available | 988 | Open in IMG/M |
3300001213|JGIcombinedJ13530_105755446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 500 | Open in IMG/M |
3300004051|Ga0055492_10004811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1836 | Open in IMG/M |
3300004067|Ga0055485_10211045 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300004082|Ga0062384_101280603 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 536 | Open in IMG/M |
3300004152|Ga0062386_100448652 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300004156|Ga0062589_100170398 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1526 | Open in IMG/M |
3300004156|Ga0062589_100846378 | Not Available | 835 | Open in IMG/M |
3300004643|Ga0062591_100753636 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 890 | Open in IMG/M |
3300004778|Ga0062383_10373161 | Not Available | 698 | Open in IMG/M |
3300004781|Ga0062379_10086038 | Not Available | 706 | Open in IMG/M |
3300005187|Ga0066675_10116083 | All Organisms → cellular organisms → Bacteria | 1792 | Open in IMG/M |
3300005328|Ga0070676_10086019 | All Organisms → cellular organisms → Bacteria | 1917 | Open in IMG/M |
3300005330|Ga0070690_100026959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3549 | Open in IMG/M |
3300005330|Ga0070690_101231067 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300005334|Ga0068869_100189704 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1616 | Open in IMG/M |
3300005338|Ga0068868_101943959 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 558 | Open in IMG/M |
3300005339|Ga0070660_101943450 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300005340|Ga0070689_100645702 | Not Available | 920 | Open in IMG/M |
3300005343|Ga0070687_100071342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1866 | Open in IMG/M |
3300005344|Ga0070661_100001963 | All Organisms → cellular organisms → Bacteria | 14208 | Open in IMG/M |
3300005345|Ga0070692_11086298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Variovorax → unclassified Variovorax → Variovorax sp. | 564 | Open in IMG/M |
3300005347|Ga0070668_100411886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1156 | Open in IMG/M |
3300005354|Ga0070675_100504081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 1091 | Open in IMG/M |
3300005355|Ga0070671_101487569 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300005356|Ga0070674_100195193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1559 | Open in IMG/M |
3300005364|Ga0070673_102260167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 517 | Open in IMG/M |
3300005366|Ga0070659_100869538 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 787 | Open in IMG/M |
3300005435|Ga0070714_100143806 | All Organisms → cellular organisms → Bacteria | 2143 | Open in IMG/M |
3300005456|Ga0070678_100254792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1473 | Open in IMG/M |
3300005457|Ga0070662_100128813 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1949 | Open in IMG/M |
3300005457|Ga0070662_100150105 | All Organisms → cellular organisms → Bacteria | 1813 | Open in IMG/M |
3300005459|Ga0068867_100445135 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1102 | Open in IMG/M |
3300005530|Ga0070679_100733437 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
3300005536|Ga0070697_100605776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 963 | Open in IMG/M |
3300005543|Ga0070672_100751317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 856 | Open in IMG/M |
3300005543|Ga0070672_101218099 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 671 | Open in IMG/M |
3300005548|Ga0070665_100466044 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1274 | Open in IMG/M |
3300005553|Ga0066695_10366021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 901 | Open in IMG/M |
3300005554|Ga0066661_10656741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 618 | Open in IMG/M |
3300005555|Ga0066692_10764393 | Not Available | 596 | Open in IMG/M |
3300005563|Ga0068855_100001032 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 34674 | Open in IMG/M |
3300005563|Ga0068855_100377847 | All Organisms → cellular organisms → Bacteria | 1556 | Open in IMG/M |
3300005563|Ga0068855_101918973 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
3300005564|Ga0070664_101600791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella caseinilytica | 617 | Open in IMG/M |
3300005577|Ga0068857_100980685 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
3300005578|Ga0068854_101265029 | Not Available | 663 | Open in IMG/M |
3300005578|Ga0068854_101614344 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
3300005578|Ga0068854_101875167 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300005598|Ga0066706_10708333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 800 | Open in IMG/M |
3300005598|Ga0066706_10964494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 659 | Open in IMG/M |
3300005719|Ga0068861_100256923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1494 | Open in IMG/M |
3300005719|Ga0068861_100432962 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1174 | Open in IMG/M |
3300005719|Ga0068861_101755609 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005830|Ga0074473_10221767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1212 | Open in IMG/M |
3300005841|Ga0068863_102726603 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300005885|Ga0075284_1069046 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300005995|Ga0066790_10241835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 770 | Open in IMG/M |
3300006031|Ga0066651_10169709 | All Organisms → cellular organisms → Bacteria | 1149 | Open in IMG/M |
3300006049|Ga0075417_10366296 | All Organisms → cellular organisms → Bacteria | 708 | Open in IMG/M |
3300006050|Ga0075028_100594402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 656 | Open in IMG/M |
3300006056|Ga0075163_10674880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1104 | Open in IMG/M |
3300006172|Ga0075018_10241616 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 871 | Open in IMG/M |
3300006173|Ga0070716_100047711 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
3300006173|Ga0070716_101535890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 545 | Open in IMG/M |
3300006237|Ga0097621_100775907 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 887 | Open in IMG/M |
3300006358|Ga0068871_101515097 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum chlorophenolicum | 634 | Open in IMG/M |
3300006358|Ga0068871_102211756 | Not Available | 524 | Open in IMG/M |
3300006796|Ga0066665_10118569 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
3300006797|Ga0066659_10180077 | All Organisms → cellular organisms → Bacteria | 1530 | Open in IMG/M |
3300006806|Ga0079220_11992904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 517 | Open in IMG/M |
3300006844|Ga0075428_100976091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 897 | Open in IMG/M |
3300006854|Ga0075425_101630325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 727 | Open in IMG/M |
3300006871|Ga0075434_101513574 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
3300006871|Ga0075434_102142637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 563 | Open in IMG/M |
3300006903|Ga0075426_10153815 | All Organisms → cellular organisms → Bacteria | 1660 | Open in IMG/M |
3300006903|Ga0075426_10949834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 649 | Open in IMG/M |
3300006914|Ga0075436_100697251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 752 | Open in IMG/M |
3300006954|Ga0079219_10001611 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5739 | Open in IMG/M |
3300007521|Ga0105044_10762621 | All Organisms → cellular organisms → Bacteria | 775 | Open in IMG/M |
3300009075|Ga0105090_10487694 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300009075|Ga0105090_10680426 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
3300009085|Ga0105103_10693529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
3300009100|Ga0075418_12832410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 529 | Open in IMG/M |
3300009111|Ga0115026_10129719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1591 | Open in IMG/M |
3300009143|Ga0099792_11061095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 544 | Open in IMG/M |
3300009147|Ga0114129_11401284 | Not Available | 862 | Open in IMG/M |
3300009167|Ga0113563_12473759 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
3300009177|Ga0105248_10859125 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1024 | Open in IMG/M |
3300009545|Ga0105237_12776871 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300009553|Ga0105249_10861510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 972 | Open in IMG/M |
3300009792|Ga0126374_11428369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 565 | Open in IMG/M |
3300010051|Ga0133939_1003579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 10863 | Open in IMG/M |
3300010304|Ga0134088_10606608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 545 | Open in IMG/M |
3300010320|Ga0134109_10103153 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300010343|Ga0074044_10887037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 583 | Open in IMG/M |
3300010373|Ga0134128_10134766 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2795 | Open in IMG/M |
3300010396|Ga0134126_12738458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 535 | Open in IMG/M |
3300011106|Ga0151489_1522661 | Not Available | 632 | Open in IMG/M |
3300011119|Ga0105246_12199503 | Not Available | 537 | Open in IMG/M |
3300011429|Ga0137455_1090028 | Not Available | 893 | Open in IMG/M |
3300012200|Ga0137382_10147396 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1593 | Open in IMG/M |
3300012212|Ga0150985_120994958 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
3300012285|Ga0137370_10898685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 548 | Open in IMG/M |
3300012357|Ga0137384_11276846 | Not Available | 581 | Open in IMG/M |
3300012469|Ga0150984_122169251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
3300012501|Ga0157351_1046901 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
3300012582|Ga0137358_10823113 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 615 | Open in IMG/M |
3300012892|Ga0157294_10294851 | Not Available | 516 | Open in IMG/M |
3300012922|Ga0137394_10323543 | Not Available | 1317 | Open in IMG/M |
3300012986|Ga0164304_10411753 | All Organisms → cellular organisms → Bacteria | 963 | Open in IMG/M |
3300012986|Ga0164304_10854343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 707 | Open in IMG/M |
3300012988|Ga0164306_11858472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 524 | Open in IMG/M |
3300013102|Ga0157371_10844922 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
3300013297|Ga0157378_12673171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 552 | Open in IMG/M |
3300013306|Ga0163162_11501033 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 768 | Open in IMG/M |
3300013306|Ga0163162_12396115 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
3300013307|Ga0157372_11056848 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
3300013308|Ga0157375_11690166 | Not Available | 749 | Open in IMG/M |
3300014150|Ga0134081_10361671 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 535 | Open in IMG/M |
3300014266|Ga0075359_1020451 | Not Available | 970 | Open in IMG/M |
3300014325|Ga0163163_10007799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 9462 | Open in IMG/M |
3300014325|Ga0163163_11169444 | Not Available | 832 | Open in IMG/M |
3300014325|Ga0163163_12405442 | Not Available | 585 | Open in IMG/M |
3300014326|Ga0157380_11554382 | Not Available | 716 | Open in IMG/M |
3300014502|Ga0182021_11400714 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 842 | Open in IMG/M |
3300014745|Ga0157377_10455214 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 884 | Open in IMG/M |
3300014968|Ga0157379_11459721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum chlorophenolicum | 664 | Open in IMG/M |
3300014968|Ga0157379_11956856 | Not Available | 578 | Open in IMG/M |
3300015087|Ga0167637_1008089 | All Organisms → cellular organisms → Bacteria | 1568 | Open in IMG/M |
3300015162|Ga0167653_1083351 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 513 | Open in IMG/M |
3300015201|Ga0173478_10502967 | Not Available | 607 | Open in IMG/M |
3300015371|Ga0132258_12353390 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1335 | Open in IMG/M |
3300015372|Ga0132256_103539963 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales | 525 | Open in IMG/M |
3300015373|Ga0132257_104119649 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
3300015373|Ga0132257_104636618 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 500 | Open in IMG/M |
3300015374|Ga0132255_101736395 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
3300016341|Ga0182035_10256941 | All Organisms → cellular organisms → Bacteria | 1413 | Open in IMG/M |
3300016422|Ga0182039_10875927 | Not Available | 801 | Open in IMG/M |
3300017927|Ga0187824_10306384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 563 | Open in IMG/M |
3300017959|Ga0187779_10189482 | All Organisms → cellular organisms → Bacteria | 1283 | Open in IMG/M |
3300017961|Ga0187778_10848270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 625 | Open in IMG/M |
3300017974|Ga0187777_11401532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 516 | Open in IMG/M |
3300018075|Ga0184632_10323776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 664 | Open in IMG/M |
3300018081|Ga0184625_10087042 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 1603 | Open in IMG/M |
3300018469|Ga0190270_10983011 | Not Available | 869 | Open in IMG/M |
3300018476|Ga0190274_10709970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1051 | Open in IMG/M |
3300018476|Ga0190274_11608475 | Not Available | 743 | Open in IMG/M |
3300018476|Ga0190274_13694896 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300018481|Ga0190271_10350409 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1557 | Open in IMG/M |
3300018482|Ga0066669_12339495 | All Organisms → cellular organisms → Bacteria | 510 | Open in IMG/M |
3300018920|Ga0190273_12368921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 504 | Open in IMG/M |
3300019879|Ga0193723_1109550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 774 | Open in IMG/M |
3300019888|Ga0193751_1143283 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 865 | Open in IMG/M |
3300020082|Ga0206353_11873453 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
3300021081|Ga0210379_10581406 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300021082|Ga0210380_10306034 | Not Available | 724 | Open in IMG/M |
3300021344|Ga0193719_10054612 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1731 | Open in IMG/M |
3300025321|Ga0207656_10176272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1024 | Open in IMG/M |
3300025461|Ga0208851_1074938 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 568 | Open in IMG/M |
3300025872|Ga0208783_10309859 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 626 | Open in IMG/M |
3300025901|Ga0207688_10110683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1594 | Open in IMG/M |
3300025906|Ga0207699_10233213 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
3300025907|Ga0207645_10455724 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 864 | Open in IMG/M |
3300025907|Ga0207645_10624946 | Not Available | 732 | Open in IMG/M |
3300025912|Ga0207707_10120793 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2291 | Open in IMG/M |
3300025919|Ga0207657_11226048 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300025921|Ga0207652_10671243 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 926 | Open in IMG/M |
3300025921|Ga0207652_10694660 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 908 | Open in IMG/M |
3300025925|Ga0207650_11103344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 675 | Open in IMG/M |
3300025926|Ga0207659_11016654 | Not Available | 713 | Open in IMG/M |
3300025927|Ga0207687_11511334 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 577 | Open in IMG/M |
3300025931|Ga0207644_11443227 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 578 | Open in IMG/M |
3300025933|Ga0207706_10066110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3182 | Open in IMG/M |
3300025938|Ga0207704_10462119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1015 | Open in IMG/M |
3300025940|Ga0207691_10806328 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 789 | Open in IMG/M |
3300025940|Ga0207691_11231505 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
3300025942|Ga0207689_10361418 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
3300025944|Ga0207661_10255871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1558 | Open in IMG/M |
3300025949|Ga0207667_11689885 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 600 | Open in IMG/M |
3300025964|Ga0210127_1031657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → Herbaspirillum chlorophenolicum | 628 | Open in IMG/M |
3300025972|Ga0207668_10841930 | Not Available | 814 | Open in IMG/M |
3300025981|Ga0207640_11643909 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300025986|Ga0207658_10049231 | All Organisms → cellular organisms → Bacteria | 3095 | Open in IMG/M |
3300026035|Ga0207703_10301458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1462 | Open in IMG/M |
3300026067|Ga0207678_10029797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 4765 | Open in IMG/M |
3300026088|Ga0207641_12622282 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300026095|Ga0207676_11116609 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 780 | Open in IMG/M |
3300026121|Ga0207683_10274154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1541 | Open in IMG/M |
3300026217|Ga0209871_1004279 | All Organisms → cellular organisms → Bacteria | 2815 | Open in IMG/M |
3300026550|Ga0209474_10387288 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 741 | Open in IMG/M |
3300026552|Ga0209577_10638751 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 619 | Open in IMG/M |
3300027310|Ga0207983_1021003 | Not Available | 791 | Open in IMG/M |
3300027471|Ga0209995_1067634 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 610 | Open in IMG/M |
3300027683|Ga0209392_1146990 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
3300027725|Ga0209178_1168028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae → Lysobacter → unclassified Lysobacter → Lysobacter sp. | 765 | Open in IMG/M |
3300027885|Ga0209450_10166195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1537 | Open in IMG/M |
3300027897|Ga0209254_10957894 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
3300027948|Ga0209858_1024860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 555 | Open in IMG/M |
3300027955|Ga0209078_1138123 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300027972|Ga0209079_10301118 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 543 | Open in IMG/M |
3300028380|Ga0268265_10255903 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1554 | Open in IMG/M |
3300028380|Ga0268265_10698866 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae | 979 | Open in IMG/M |
3300028380|Ga0268265_12666567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 505 | Open in IMG/M |
3300028381|Ga0268264_12491133 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
3300028665|Ga0302160_10029005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1053 | Open in IMG/M |
3300028665|Ga0302160_10170853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 515 | Open in IMG/M |
3300028679|Ga0302169_10189314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 529 | Open in IMG/M |
3300028739|Ga0302205_10208341 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 502 | Open in IMG/M |
3300028777|Ga0302290_10208185 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 524 | Open in IMG/M |
3300028802|Ga0307503_10262072 | Not Available | 850 | Open in IMG/M |
3300028868|Ga0302163_10075337 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 831 | Open in IMG/M |
3300028869|Ga0302263_10310144 | Not Available | 626 | Open in IMG/M |
3300028869|Ga0302263_10459101 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
3300028889|Ga0247827_10100859 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1447 | Open in IMG/M |
3300029944|Ga0311352_10927209 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 674 | Open in IMG/M |
3300029980|Ga0302298_10021711 | All Organisms → cellular organisms → Bacteria | 1789 | Open in IMG/M |
3300029984|Ga0311332_11329674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 581 | Open in IMG/M |
3300030003|Ga0302172_10262852 | Not Available | 552 | Open in IMG/M |
3300030047|Ga0302286_10018459 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4092 | Open in IMG/M |
3300030050|Ga0302255_1008517 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
3300030491|Ga0302211_10022030 | All Organisms → cellular organisms → Bacteria | 1802 | Open in IMG/M |
3300030838|Ga0311335_10760896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 684 | Open in IMG/M |
3300030943|Ga0311366_10268087 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1478 | Open in IMG/M |
3300030943|Ga0311366_11886677 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 509 | Open in IMG/M |
3300031232|Ga0302323_100769457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 1056 | Open in IMG/M |
3300031521|Ga0311364_11378052 | All Organisms → cellular organisms → Bacteria | 698 | Open in IMG/M |
3300031549|Ga0318571_10130235 | Not Available | 852 | Open in IMG/M |
3300031668|Ga0318542_10034026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2218 | Open in IMG/M |
3300031722|Ga0311351_11199998 | Not Available | 582 | Open in IMG/M |
3300031771|Ga0318546_11140870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 548 | Open in IMG/M |
3300031778|Ga0318498_10345549 | Not Available | 664 | Open in IMG/M |
3300031794|Ga0318503_10172945 | Not Available | 699 | Open in IMG/M |
3300031796|Ga0318576_10483352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 585 | Open in IMG/M |
3300031798|Ga0318523_10613290 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 535 | Open in IMG/M |
3300031834|Ga0315290_11675126 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300031852|Ga0307410_10099782 | All Organisms → cellular organisms → Bacteria | 2079 | Open in IMG/M |
3300031901|Ga0307406_10189878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1503 | Open in IMG/M |
3300031910|Ga0306923_12322300 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 534 | Open in IMG/M |
3300031913|Ga0310891_10309242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 559 | Open in IMG/M |
3300031939|Ga0308174_10139078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1795 | Open in IMG/M |
3300031939|Ga0308174_10224501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1445 | Open in IMG/M |
3300031995|Ga0307409_100128911 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
3300032012|Ga0310902_11042532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Dyella → Dyella caseinilytica | 570 | Open in IMG/M |
3300032059|Ga0318533_11173352 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 562 | Open in IMG/M |
3300032074|Ga0308173_10393099 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1218 | Open in IMG/M |
3300032076|Ga0306924_10074650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3791 | Open in IMG/M |
3300032118|Ga0315277_11592187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
3300032143|Ga0315292_10275665 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
3300032144|Ga0315910_10400655 | Not Available | 1051 | Open in IMG/M |
3300032164|Ga0315283_11136451 | Not Available | 819 | Open in IMG/M |
3300032174|Ga0307470_10101649 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1648 | Open in IMG/M |
3300032180|Ga0307471_100678086 | Not Available | 1194 | Open in IMG/M |
3300032180|Ga0307471_104001241 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 521 | Open in IMG/M |
3300032205|Ga0307472_101414116 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium | 675 | Open in IMG/M |
3300032256|Ga0315271_10517841 | Not Available | 1013 | Open in IMG/M |
3300032397|Ga0315287_10352525 | All Organisms → cellular organisms → Bacteria | 1740 | Open in IMG/M |
3300032397|Ga0315287_10631735 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1267 | Open in IMG/M |
3300032397|Ga0315287_12821031 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 514 | Open in IMG/M |
3300032893|Ga0335069_10332907 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1798 | Open in IMG/M |
3300033004|Ga0335084_10857497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
3300033408|Ga0316605_11725232 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300033413|Ga0316603_11645570 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 608 | Open in IMG/M |
3300033414|Ga0316619_10477269 | Not Available | 1009 | Open in IMG/M |
3300033419|Ga0316601_100295544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1479 | Open in IMG/M |
3300033419|Ga0316601_101655887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 645 | Open in IMG/M |
3300033433|Ga0326726_10140259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2197 | Open in IMG/M |
3300033482|Ga0316627_102764243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 521 | Open in IMG/M |
3300033488|Ga0316621_11021061 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300033521|Ga0316616_104156410 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 545 | Open in IMG/M |
3300033557|Ga0316617_102132279 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 577 | Open in IMG/M |
3300034090|Ga0326723_0450170 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 588 | Open in IMG/M |
3300034127|Ga0370489_0220818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → Aromatoleum → unclassified Aromatoleum → Aromatoleum sp. | 565 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 7.33% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.03% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.03% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.03% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 3.30% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.66% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.66% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 3.66% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.93% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.20% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.20% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.20% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.83% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.83% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.83% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.47% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.47% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.47% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.47% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.10% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.10% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.10% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.10% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 1.10% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 1.10% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.10% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.10% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.73% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.73% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.73% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.73% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.73% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.73% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.73% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.73% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.73% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.73% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.73% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.73% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.73% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.73% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.37% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.37% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.37% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.37% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.37% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.37% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.37% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.37% |
Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.37% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.37% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.37% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.37% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.37% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.37% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.37% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.37% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.37% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.37% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.37% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.37% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.37% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.37% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.37% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.37% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.37% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.37% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.37% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.37% |
Industrial Wastewater | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Industrial Wastewater | 0.37% |
Wastewater Effluent | Engineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent | 0.37% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300004051 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLB_D2 | Environmental | Open in IMG/M |
3300004067 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqA_D2 | Environmental | Open in IMG/M |
3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300004781 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare2Fresh | Environmental | Open in IMG/M |
3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005885 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_401 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006056 | Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 1A DNA | Engineered | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007521 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-01 | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
3300009111 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_0915_D1 | Environmental | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010051 | Industrial wastewater microbial communities from reactors of effluent treatment plant in South Killingholme, Immingham, England. Combined Assembly of Gp0151195, Gp0151196 | Engineered | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300011106 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLMC (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011429 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT600_2 | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012501 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.4.yng.170610 | Environmental | Open in IMG/M |
3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014266 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_TuleB_D1 | Environmental | Open in IMG/M |
3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015087 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6A, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017927 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_coex redo | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025461 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025964 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_CattailNLC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
3300027310 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMB (SPAdes) | Environmental | Open in IMG/M |
3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) | Host-Associated | Open in IMG/M |
3300027683 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027948 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_50_60 (SPAdes) | Environmental | Open in IMG/M |
3300027955 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028665 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_3 | Environmental | Open in IMG/M |
3300028679 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3 | Environmental | Open in IMG/M |
3300028739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3 | Environmental | Open in IMG/M |
3300028777 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028868 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_3 | Environmental | Open in IMG/M |
3300028869 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_4 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029980 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_3 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030003 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N2_3 | Environmental | Open in IMG/M |
3300030047 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3 | Environmental | Open in IMG/M |
3300030050 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4 | Environmental | Open in IMG/M |
3300030491 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3 | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031521 | III_Fen_E2 coassembly | Environmental | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031722 | II_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031794 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23 | Environmental | Open in IMG/M |
3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Host-Associated | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
3300032144 | Garden soil microbial communities collected in Santa Monica, California, United States - Edamame soil | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033408 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day20_noCT | Environmental | Open in IMG/M |
3300033413 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day10_noCT | Environmental | Open in IMG/M |
3300033414 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D4_B | Environmental | Open in IMG/M |
3300033419 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_soil_day5_noCT | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
3300033488 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D1_C | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034127 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_05D_16 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ13530_1016244781 | 3300001213 | Wetland | DQKLEIIKQRCLQAAQVKYICVYPPQLPRYKELREQILGSAADLV* |
JGIcombinedJ13530_1057554461 | 3300001213 | Wetland | QKLDIIKQRCLQAAQVKYICVYPPQLPRYRELREQVLGTAEDFA* |
Ga0055492_100048112 | 3300004051 | Natural And Restored Wetlands | IVNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYKELREQILGSTAEVVA* |
Ga0055485_102110452 | 3300004067 | Natural And Restored Wetlands | PRDQKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPASELV* |
Ga0062384_1012806032 | 3300004082 | Bog Forest Soil | PEQVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV* |
Ga0062386_1004486522 | 3300004152 | Bog Forest Soil | RDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQILGPAAELV* |
Ga0062589_1001703981 | 3300004156 | Soil | QVIDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI* |
Ga0062589_1008463781 | 3300004156 | Soil | RDQKLEIIKQRCLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV* |
Ga0062591_1007536361 | 3300004643 | Soil | DQVIDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI* |
Ga0062383_103731611 | 3300004778 | Wetland Sediment | NPREQKLEVIKQRCLHAAQVKYICIHPPQLPRYRELRDQILGPPDVVGSG* |
Ga0062379_100860382 | 3300004781 | Wetland Sediment | NPRDQKLEIIKQRCLQAAQVKYICVYPPRLPRYRELREQILGPAADLV* |
Ga0066675_101160831 | 3300005187 | Soil | INPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRTQVLGPAAELV* |
Ga0070676_100860194 | 3300005328 | Miscanthus Rhizosphere | IDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLV* |
Ga0070690_1000269595 | 3300005330 | Switchgrass Rhizosphere | RDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV* |
Ga0070690_1012310672 | 3300005330 | Switchgrass Rhizosphere | KEPDQVIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAAEYV* |
Ga0068869_1001897041 | 3300005334 | Miscanthus Rhizosphere | QQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV* |
Ga0068868_1019439592 | 3300005338 | Miscanthus Rhizosphere | RDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV* |
Ga0070660_1019434502 | 3300005339 | Corn Rhizosphere | EPDQVIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLA* |
Ga0070689_1006457021 | 3300005340 | Switchgrass Rhizosphere | IKQRCLQAAQVKYLCVYPPQLPRYRELREQILGQAADLE* |
Ga0070687_1000713421 | 3300005343 | Switchgrass Rhizosphere | QKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV* |
Ga0070661_10000196316 | 3300005344 | Corn Rhizosphere | DQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLV* |
Ga0070692_110862982 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | IKQRCLQAAQVKYVCVYPPQLPKYRELREQILGPPDVVGSADQGVRF* |
Ga0070668_1004118861 | 3300005347 | Switchgrass Rhizosphere | IKQRCLQAAQVKYICVYPPQLPRYRELREQILGPPDMVGSG* |
Ga0070675_1005040811 | 3300005354 | Miscanthus Rhizosphere | VNPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGQAADLE* |
Ga0070671_1014875691 | 3300005355 | Switchgrass Rhizosphere | LEIIKQRCLQAAQVKYICVYPPQLPRYRELRSQILGPAAELI* |
Ga0070674_1001951931 | 3300005356 | Miscanthus Rhizosphere | IKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV* |
Ga0070673_1022601671 | 3300005364 | Switchgrass Rhizosphere | DVVVNPRDQKLETIKQRCLLAAQVKYICIYPPQLPRYRDLREQVLGPEEMPSG* |
Ga0070659_1008695383 | 3300005366 | Corn Rhizosphere | PRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPVGDLV* |
Ga0070714_1001438063 | 3300005435 | Agricultural Soil | PQQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV* |
Ga0070678_1002547922 | 3300005456 | Miscanthus Rhizosphere | IKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV* |
Ga0070662_1001288131 | 3300005457 | Corn Rhizosphere | VINPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV* |
Ga0070662_1001501051 | 3300005457 | Corn Rhizosphere | NPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV* |
Ga0068867_1004451352 | 3300005459 | Miscanthus Rhizosphere | QKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI* |
Ga0070679_1007334373 | 3300005530 | Corn Rhizosphere | VIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDL* |
Ga0070697_1006057761 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | NPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQILGPAAELV* |
Ga0070672_1007513171 | 3300005543 | Miscanthus Rhizosphere | IKQRCLQAAQVKYICVYPPQLPRYRELREQILGPASDIVQ* |
Ga0070672_1012180992 | 3300005543 | Miscanthus Rhizosphere | KLEVIKQRCLQAAQVKYLCVYPPQLPRYRELRSQILGSAADLV* |
Ga0070665_1004660443 | 3300005548 | Switchgrass Rhizosphere | RDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYKELREQILGPAADFE* |
Ga0066695_103660212 | 3300005553 | Soil | CLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV* |
Ga0066661_106567412 | 3300005554 | Soil | CLQAAQVKYMCVYPPTLPRYRELREQILGPAADLV* |
Ga0066692_107643931 | 3300005555 | Soil | IKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI* |
Ga0068855_1000010321 | 3300005563 | Corn Rhizosphere | RDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLV* |
Ga0068855_1003778473 | 3300005563 | Corn Rhizosphere | RDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELRQQILGSAADLV* |
Ga0068855_1019189731 | 3300005563 | Corn Rhizosphere | KEPDQVIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLG* |
Ga0070664_1016007912 | 3300005564 | Corn Rhizosphere | QVIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDL* |
Ga0068857_1009806851 | 3300005577 | Corn Rhizosphere | NPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQVLGPAADLV* |
Ga0068854_1012650292 | 3300005578 | Corn Rhizosphere | QKLEIIKQRCLQAAQVKYICVYPPQLPRYRELRTQILGPAAELL* |
Ga0068854_1016143442 | 3300005578 | Corn Rhizosphere | DQKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV* |
Ga0068854_1018751671 | 3300005578 | Corn Rhizosphere | RDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLA* |
Ga0066706_107083331 | 3300005598 | Soil | QNPREQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELRTQVLGPAAELV* |
Ga0066706_109644941 | 3300005598 | Soil | KQRCLQAAQVKYMCVYPPTLPRYRELREQILGPAADLV* |
Ga0068861_1002569231 | 3300005719 | Switchgrass Rhizosphere | QAAQVKYICVYPPQLPRYRELREQILGPAADLVQ* |
Ga0068861_1004329621 | 3300005719 | Switchgrass Rhizosphere | PRDQKLEIIKQRCLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV* |
Ga0068861_1017556092 | 3300005719 | Switchgrass Rhizosphere | INPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLE* |
Ga0074473_102217672 | 3300005830 | Sediment (Intertidal) | EIIKQRCLQAAQVKYICVYPPQLPRYKELREQVLGPTAEVAA* |
Ga0068863_1027266031 | 3300005841 | Switchgrass Rhizosphere | PRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAAEYV* |
Ga0075284_10690462 | 3300005885 | Rice Paddy Soil | EIIKQRCLQAAQVKYVCVYPPQLPRYRDLRTQILGPAADLL* |
Ga0066790_102418351 | 3300005995 | Soil | KLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAAELV* |
Ga0066651_101697092 | 3300006031 | Soil | QKLEIIKQRCLQAAQVKYMCVYPPTLPRYRELREQILGPAADLV* |
Ga0075417_103662961 | 3300006049 | Populus Rhizosphere | PRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRSQVLGPAAELV* |
Ga0075028_1005944021 | 3300006050 | Watersheds | QKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAAELV* |
Ga0075163_106748802 | 3300006056 | Wastewater Effluent | NPRDQKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADIAQ* |
Ga0075018_102416161 | 3300006172 | Watersheds | NPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAAELV* |
Ga0070716_1000477111 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | KEPQQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV* |
Ga0070716_1015358901 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | CLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLV* |
Ga0097621_1007759071 | 3300006237 | Miscanthus Rhizosphere | DPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLV* |
Ga0068871_1015150973 | 3300006358 | Miscanthus Rhizosphere | VNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLT* |
Ga0068871_1022117561 | 3300006358 | Miscanthus Rhizosphere | CLQAAQVKYLCVYPPQLPRYRELREQILGPSEEVESG* |
Ga0066665_101185691 | 3300006796 | Soil | QVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPSYRELRAQILGPAAELV* |
Ga0066659_101800771 | 3300006797 | Soil | NPRDQKLEIIKQRCLQAAQVKYMCVYPPTLPRYRELREQILGPAADLV* |
Ga0079220_119929041 | 3300006806 | Agricultural Soil | EPDQANNPREQKLEIIKQRCLQAAQVKYICVYPPQLPRYKELRSQILGPAAELI* |
Ga0075428_1009760912 | 3300006844 | Populus Rhizosphere | QRCLQAAQVKYLCVYPPQLPRYRELRQQILGSAADLV* |
Ga0075425_1016303252 | 3300006854 | Populus Rhizosphere | IDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI* |
Ga0075434_1015135742 | 3300006871 | Populus Rhizosphere | QKLETIKQRCLLAAQVKYICIYPPQLPRYRDLREQILGPEEMPSG* |
Ga0075434_1021426371 | 3300006871 | Populus Rhizosphere | QNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRSQVLGPAAELV* |
Ga0075426_101538153 | 3300006903 | Populus Rhizosphere | PRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI* |
Ga0075426_109498341 | 3300006903 | Populus Rhizosphere | LETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLV* |
Ga0075436_1006972511 | 3300006914 | Populus Rhizosphere | IKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV* |
Ga0079219_100016111 | 3300006954 | Agricultural Soil | ETIKQRCLQAAQVKYVCIFPPQLPRYRELREQILGPAGDFG* |
Ga0105044_107626211 | 3300007521 | Freshwater | VIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV* |
Ga0105090_104876941 | 3300009075 | Freshwater Sediment | RDQKLEIIKQRCLQAAQVKYICVYPPQLPRYKELREQVLGPTADVVA* |
Ga0105090_106804261 | 3300009075 | Freshwater Sediment | QKLEIIKQRCLQAAQVKYICVYPPQLPRYKELREQVLGSTVDVVA* |
Ga0105103_106935291 | 3300009085 | Freshwater Sediment | DTIVNPRDQKLEIIKQRCLQAAQVKYIAVYPPQLPRYRELREQILGPAADLV* |
Ga0075418_128324101 | 3300009100 | Populus Rhizosphere | REPDQLVNPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADFE* |
Ga0115026_101297191 | 3300009111 | Wetland | PRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYKELREQVLGATADVVA* |
Ga0099792_110610951 | 3300009143 | Vadose Zone Soil | LEIIKQRCLQAAQAKYMCVYPPTLPRYRERREQILGPAADLV* |
Ga0114129_114012842 | 3300009147 | Populus Rhizosphere | EIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI* |
Ga0113563_124737591 | 3300009167 | Freshwater Wetlands | QAAQVKYICVYPPQLPRYKELREQVLGATADVVA* |
Ga0105248_108591252 | 3300009177 | Switchgrass Rhizosphere | DQKLETIKQRCLLAAQVKYICIYPPQLPRYRDLREQVLGPEEMPSG* |
Ga0105237_127768711 | 3300009545 | Corn Rhizosphere | DQVIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLG* |
Ga0105249_108615101 | 3300009553 | Switchgrass Rhizosphere | EPDQVINPRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELRQQILGSAADLV* |
Ga0126374_114283691 | 3300009792 | Tropical Forest Soil | NPRDQKLEIIKQRCLQAAQVKYVCVYPPTLPRYRELRAQVLGPAAELV* |
Ga0133939_10035791 | 3300010051 | Industrial Wastewater | QRCLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV* |
Ga0134088_106066082 | 3300010304 | Grasslands Soil | KEPEQVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV* |
Ga0134109_101031532 | 3300010320 | Grasslands Soil | LEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV* |
Ga0074044_108870371 | 3300010343 | Bog Forest Soil | EPEQVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQILGPAAELV* |
Ga0134128_101347661 | 3300010373 | Terrestrial Soil | PDQVIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLA* |
Ga0134126_127384582 | 3300010396 | Terrestrial Soil | RQPEQVTNPRGQKLEVINQRCLQAAQVKYDCVYPPQLPRYRELREQVLGPAADLV* |
Ga0151489_15226612 | 3300011106 | Soil | CLQAAQVKYICVYPPQLPRYRELREQILGPAADLV* |
Ga0105246_121995032 | 3300011119 | Miscanthus Rhizosphere | AVVNPRDQKLEVIKQRCLQAAQVKYVCVYPPQLPKYRELREQILGPPDVVGSADQGVRF* |
Ga0137455_10900281 | 3300011429 | Soil | IIKQRCLQAAQVKYICVYPPQLPRYRDLREQILGPAADLV* |
Ga0137382_101473961 | 3300012200 | Vadose Zone Soil | NPRDQKLEIIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAADLV* |
Ga0150985_1209949581 | 3300012212 | Avena Fatua Rhizosphere | EQVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELREQVLGPAAELV* |
Ga0137370_108986851 | 3300012285 | Vadose Zone Soil | CLQAAQVKYLCVYPPTLPRYRELREQILGPAADLV* |
Ga0137384_112768461 | 3300012357 | Vadose Zone Soil | TVVNPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLI* |
Ga0150984_1221692511 | 3300012469 | Avena Fatua Rhizosphere | DQKLETIKQRCLQAAQVKYICIYPPQLPRYKELREQILGPAGDLL* |
Ga0157351_10469011 | 3300012501 | Unplanted Soil | RCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV* |
Ga0137358_108231131 | 3300012582 | Vadose Zone Soil | KEPEQVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRTQVLGPAAELV* |
Ga0157294_102948511 | 3300012892 | Soil | KLEVIKQSCLQAAQVKYVCVYPPQLPKYRELREQILGPPDVVGSADQGVRF* |
Ga0137394_103235431 | 3300012922 | Vadose Zone Soil | LVNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPVADLT* |
Ga0164304_104117531 | 3300012986 | Soil | QVIDPRDQKLETIKQRCLQAAQVKYVCIFPPQLPRYRELREQILGPAGDFG* |
Ga0164304_108543431 | 3300012986 | Soil | IDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLV* |
Ga0164306_118584722 | 3300012988 | Soil | KQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI* |
Ga0157371_108449222 | 3300013102 | Corn Rhizosphere | DQVIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLA* |
Ga0157378_126731711 | 3300013297 | Miscanthus Rhizosphere | IKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAAEYV* |
Ga0163162_115010331 | 3300013306 | Switchgrass Rhizosphere | NPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYKELREQILGPAADFE* |
Ga0163162_123961151 | 3300013306 | Switchgrass Rhizosphere | DQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQVLGPAADLV* |
Ga0157372_110568481 | 3300013307 | Corn Rhizosphere | PDQVIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDL* |
Ga0157375_116901661 | 3300013308 | Miscanthus Rhizosphere | CLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV* |
Ga0134081_103616712 | 3300014150 | Grasslands Soil | MALLPQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELREQVLGPAAELV* |
Ga0075359_10204511 | 3300014266 | Natural And Restored Wetlands | QKLEIIKQRCLQAAQVKYICIYPPRLPRYRELRDQVLGPGPDND* |
Ga0163163_1000779912 | 3300014325 | Switchgrass Rhizosphere | DQIKQRCLHAAQVKYICIYPPQLPRYRELREQVLGPQDLIGSGTTAP* |
Ga0163163_111694442 | 3300014325 | Switchgrass Rhizosphere | SREPDQLVNPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGQAADLE* |
Ga0163163_124054421 | 3300014325 | Switchgrass Rhizosphere | QKLEVIKQRCLQAAQVKYVCIYPPQLPRYRDLREQIIGTAEEIPSA* |
Ga0157380_115543822 | 3300014326 | Switchgrass Rhizosphere | VTNPRDQKLEIIKQRCLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV* |
Ga0182021_114007141 | 3300014502 | Fen | KEPDQVINPRDQKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV* |
Ga0157377_104552143 | 3300014745 | Miscanthus Rhizosphere | INPRDQKLEIIEQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV* |
Ga0157379_114597211 | 3300014968 | Switchgrass Rhizosphere | NPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLT* |
Ga0157379_119568562 | 3300014968 | Switchgrass Rhizosphere | CLQAAQVKYICVYPPQLPRYRELRQQILGPAADLV* |
Ga0167637_10080891 | 3300015087 | Glacier Forefield Soil | DQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAADLV* |
Ga0167653_10833512 | 3300015162 | Glacier Forefield Soil | EQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGAAADLV* |
Ga0173478_105029671 | 3300015201 | Soil | LEIIKQRCLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV* |
Ga0132258_123533901 | 3300015371 | Arabidopsis Rhizosphere | KLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI* |
Ga0132256_1035399631 | 3300015372 | Arabidopsis Rhizosphere | RCLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV* |
Ga0132257_1041196492 | 3300015373 | Arabidopsis Rhizosphere | DQVVNPRDQKLEVIKQRCLQAAQVKYICVYPPQLPRSRELREQILGPAADLV* |
Ga0132257_1046366181 | 3300015373 | Arabidopsis Rhizosphere | TIKQRCLLAAQVKYLCIYPPQLPRYRDLREQILGPAEEMREG* |
Ga0132255_1017363953 | 3300015374 | Arabidopsis Rhizosphere | IDPRDQKLETIKQRCLQAAQVKYICIFPPQLPRYRELREQILGPAGELA* |
Ga0182035_102569413 | 3300016341 | Soil | DLLDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV |
Ga0182039_108759271 | 3300016422 | Soil | EIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0187824_103063842 | 3300017927 | Freshwater Sediment | DQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRSQILGPAAELV |
Ga0187779_101894823 | 3300017959 | Tropical Peatland | NPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAAELV |
Ga0187778_108482701 | 3300017961 | Tropical Peatland | IIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAAELV |
Ga0187777_114015322 | 3300017974 | Tropical Peatland | EIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAAELV |
Ga0184632_103237761 | 3300018075 | Groundwater Sediment | EPEQVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV |
Ga0184625_100870421 | 3300018081 | Groundwater Sediment | PEQVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV |
Ga0190270_109830112 | 3300018469 | Soil | CLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV |
Ga0190274_107099701 | 3300018476 | Soil | DAVVNPREQKLEVIKQRCLHAAQVKYICVYPPQLPRYRELREQILGPPDVVGSG |
Ga0190274_116084751 | 3300018476 | Soil | QKLEIIKQRCLQAAQVKYIAIYPPQLPRYRELREQILGPAADLV |
Ga0190274_136948961 | 3300018476 | Soil | QKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLVQ |
Ga0190271_103504091 | 3300018481 | Soil | PRDQKLEIIKQRCLQAAQVKYVCVYPPQLPRYKELREQILGPAAELA |
Ga0066669_123394952 | 3300018482 | Grasslands Soil | CLQAAQVKYICVYPPTLPRYRELRSQVLGPAAELV |
Ga0190273_123689211 | 3300018920 | Soil | EVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPASDLVQ |
Ga0193723_11095501 | 3300019879 | Soil | REPDQLINPRDQKLEIIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAADLV |
Ga0193751_11432832 | 3300019888 | Soil | QKLEIIKQRCLQAAQVKYMCVYPPTLPRYRELREQILGPAADLV |
Ga0206353_118734533 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV |
Ga0210379_105814062 | 3300021081 | Groundwater Sediment | LEVIKQRCLQAAQVKYLCVYPPQLPRYRELRAQILGPAGDLV |
Ga0210380_103060342 | 3300021082 | Groundwater Sediment | PRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0193719_100546124 | 3300021344 | Soil | IKQRCLQAAQVKYICVYPPQLPRYRELREQILGPVADLT |
Ga0207656_101762722 | 3300025321 | Corn Rhizosphere | QIIDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI |
Ga0208851_10749381 | 3300025461 | Arctic Peat Soil | KQRCLQAAQVKYLCVYPPQMPRYRELREQILGPAADLV |
Ga0208783_103098592 | 3300025872 | Aqueous | TVINPRDQKLEIIKQRCLQAAQVKYVCVYPPQLPRYKDLREQILGPAAELA |
Ga0207688_101106833 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | EPDQLVNPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGQAADLE |
Ga0207699_102332131 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PRDQKLETIKQRCLHAAQVKYVCIFPPQLPRYRELREQILGPAGDLV |
Ga0207645_104557241 | 3300025907 | Miscanthus Rhizosphere | IKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV |
Ga0207645_106249461 | 3300025907 | Miscanthus Rhizosphere | IKQRCLQAAQVKYICVYPPQLPRYRELREQVLGPAADLV |
Ga0207707_101207935 | 3300025912 | Corn Rhizosphere | KEPDQVIDPRDQQLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLG |
Ga0207657_112260482 | 3300025919 | Corn Rhizosphere | PRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV |
Ga0207652_106712433 | 3300025921 | Corn Rhizosphere | VIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDL |
Ga0207652_106946603 | 3300025921 | Corn Rhizosphere | PRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0207650_111033441 | 3300025925 | Switchgrass Rhizosphere | VIDPRDQKLETLKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI |
Ga0207659_110166542 | 3300025926 | Miscanthus Rhizosphere | QAAQVKYICVYPPQLPRYRELREQILGPPDMVGSG |
Ga0207687_115113342 | 3300025927 | Miscanthus Rhizosphere | KEADQIIDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI |
Ga0207644_114432272 | 3300025931 | Switchgrass Rhizosphere | NPRDQKLETIKQRCLLAAQVKYICIYPPQLPRYRDLREQILGPAEEMREG |
Ga0207706_100661101 | 3300025933 | Corn Rhizosphere | VINPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0207704_104621192 | 3300025938 | Miscanthus Rhizosphere | QKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQVLGPAADLV |
Ga0207691_108063282 | 3300025940 | Miscanthus Rhizosphere | KLEVIKQRCLQAAQVKYLCVYPPQLPRYRELRSQILGSAADLV |
Ga0207691_112315051 | 3300025940 | Miscanthus Rhizosphere | DQVTNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQVLGPAADLV |
Ga0207689_103614182 | 3300025942 | Miscanthus Rhizosphere | PDQLVNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLT |
Ga0207661_102558711 | 3300025944 | Corn Rhizosphere | QVIDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI |
Ga0207667_116898852 | 3300025949 | Corn Rhizosphere | QVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV |
Ga0210127_10316572 | 3300025964 | Natural And Restored Wetlands | QKLEAIKQRCLQAAQVKYICIHSSQLPRYRELREQILGPPDVVGSG |
Ga0207668_108419301 | 3300025972 | Switchgrass Rhizosphere | PDQVINPRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0207640_116439091 | 3300025981 | Corn Rhizosphere | DPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLA |
Ga0207658_100492314 | 3300025986 | Switchgrass Rhizosphere | PQQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRDLREQVLGPAAELV |
Ga0207703_103014581 | 3300026035 | Switchgrass Rhizosphere | VVVNPRDQKLETIKQRCLLAAQVKYICIYPPQLPRYRDLREQVLGPEEMPSG |
Ga0207678_100297975 | 3300026067 | Corn Rhizosphere | ADQIIDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI |
Ga0207641_126222822 | 3300026088 | Switchgrass Rhizosphere | IKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAAEYV |
Ga0207676_111166093 | 3300026095 | Switchgrass Rhizosphere | QRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0207683_102741541 | 3300026121 | Miscanthus Rhizosphere | DQVVNPRDQKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV |
Ga0209871_10042794 | 3300026217 | Permafrost Soil | KEPEQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAADLV |
Ga0209474_103872881 | 3300026550 | Soil | DQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLM |
Ga0209577_106387512 | 3300026552 | Soil | IIKQRCLQAAQVKYMCVYPPTLPRYRELREQILGPAADLV |
Ga0207983_10210032 | 3300027310 | Soil | LEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV |
Ga0209995_10676342 | 3300027471 | Arabidopsis Thaliana Rhizosphere | VIDPRDQKLETIKQRCLQAAQVKYVCIYPPQLPRYRELREQILGPAAELV |
Ga0209392_11469902 | 3300027683 | Freshwater Sediment | IKQRCLQAAQVKYVCVYPPQLPRYKELREQILGPAADLA |
Ga0209178_11680281 | 3300027725 | Agricultural Soil | CLQAAQVKYVCIYPPQLPRYRELREQILGPAGDLV |
Ga0209450_101661952 | 3300027885 | Freshwater Lake Sediment | KQRCLQAAQVKYIAIYPPQLPRYRELREQVLGPAADLV |
Ga0209254_109578941 | 3300027897 | Freshwater Lake Sediment | DQKLEIIKQRCLQAAQVKYICVYPPQLPRYKELREQVLGSAADVVA |
Ga0209858_10248602 | 3300027948 | Groundwater Sand | DQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADFE |
Ga0209078_11381231 | 3300027955 | Freshwater Sediment | KQRCLQAAQVKYICVYPPQLPRYKELREQVLGPTADVVA |
Ga0209079_103011182 | 3300027972 | Freshwater Sediment | KEPDTVINPRDQKLEIIKQRCLQAAQVKYVCVYPPQLPRYKELREQILGPAADLA |
Ga0268265_102559031 | 3300028380 | Switchgrass Rhizosphere | IKQRCLLAAQVKYICIYPPQLPRYRDLREQVLGPEEMPSG |
Ga0268265_106988662 | 3300028380 | Switchgrass Rhizosphere | SKEPDQVTNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQVLGPAADLV |
Ga0268265_126665671 | 3300028380 | Switchgrass Rhizosphere | SREPDQLVNPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGQAADLE |
Ga0268264_124911331 | 3300028381 | Switchgrass Rhizosphere | SREPDQLINPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADFE |
Ga0302160_100290051 | 3300028665 | Fen | EPDQVINPRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0302160_101708532 | 3300028665 | Fen | QRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0302169_101893142 | 3300028679 | Fen | KQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0302205_102083412 | 3300028739 | Fen | EVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0302290_102081852 | 3300028777 | Fen | IKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0307503_102620721 | 3300028802 | Soil | VVNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI |
Ga0302163_100753372 | 3300028868 | Fen | RDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGSAGDLV |
Ga0302263_103101441 | 3300028869 | Fen | PRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI |
Ga0302263_104591011 | 3300028869 | Fen | QKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0247827_101008593 | 3300028889 | Soil | DQVIDPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLV |
Ga0311352_109272092 | 3300029944 | Palsa | CLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV |
Ga0302298_100217113 | 3300029980 | Fen | INPRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0311332_113296742 | 3300029984 | Fen | DQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGSAGDLV |
Ga0302172_102628522 | 3300030003 | Fen | CLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI |
Ga0302286_100184595 | 3300030047 | Fen | RCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0302255_10085173 | 3300030050 | Fen | VINPRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0302211_100220303 | 3300030491 | Fen | PEQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAAELV |
Ga0311335_107608962 | 3300030838 | Fen | AKEPDQVINPRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAGDLV |
Ga0311366_102680873 | 3300030943 | Fen | DQVINPRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGSAGDLV |
Ga0311366_118866772 | 3300030943 | Fen | LHLRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI |
Ga0302323_1007694571 | 3300031232 | Fen | PDQVINPRDQKLEVIKQRCLQAAQVKYLCVYPPQMPRYRELREQILGPAADLV |
Ga0311364_113780522 | 3300031521 | Fen | QKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGSAGDLV |
Ga0318571_101302352 | 3300031549 | Soil | VVNPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0318542_100340261 | 3300031668 | Soil | QKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0311351_111999982 | 3300031722 | Fen | KLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI |
Ga0318546_111408702 | 3300031771 | Soil | KQRCLQAAQVKYLCVYPPQLPRYRELREQILGTAADFE |
Ga0318498_103455491 | 3300031778 | Soil | TKEPDQVVNPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0318503_101729452 | 3300031794 | Soil | IKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0318576_104833522 | 3300031796 | Soil | RDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0318523_106132902 | 3300031798 | Soil | PDVVVNPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPTEEMPSA |
Ga0315290_116751261 | 3300031834 | Sediment | AVMNPRDQKLEIIKQRCLQAAQVKYICVYAPQLPRYRELREQILGPSEEMRSG |
Ga0307410_100997823 | 3300031852 | Rhizosphere | LEIIKQRCLQAAQVKYICVYPPQLPRYKDLREQVLGPAAEIL |
Ga0307406_101898782 | 3300031901 | Rhizosphere | NPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYKDLREQVLGPAAEIL |
Ga0306923_123223002 | 3300031910 | Soil | SREPEQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELREQILGPAAELV |
Ga0310891_103092421 | 3300031913 | Soil | PRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLI |
Ga0308174_101390782 | 3300031939 | Soil | RDQKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLV |
Ga0308174_102245011 | 3300031939 | Soil | KEPDQVINPRDQKLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0307409_1001289114 | 3300031995 | Rhizosphere | EIIKQRCLQAAQVKYICVYPPQLPRYKDLREQVLGPAADIV |
Ga0310902_110425321 | 3300032012 | Soil | DPRDQKLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPAGDLV |
Ga0318533_111733522 | 3300032059 | Soil | KLETIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPTEEMPSA |
Ga0308173_103930993 | 3300032074 | Soil | KEADQVIDPRDQKLETIKQRCLQAAQVKYVCIFTPQLPRYRELREQILGPAADVAV |
Ga0306924_100746501 | 3300032076 | Soil | KLEIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADLV |
Ga0315277_115921872 | 3300032118 | Sediment | NPRDQKLEVIKQRCLHAAQVKYICIRPPQLPRYRELREQILGPPDVVGSG |
Ga0315292_102756651 | 3300032143 | Sediment | VVNPRDQKLEVIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPPDVVGSG |
Ga0315910_104006552 | 3300032144 | Soil | PRDQKLEIIKQRCLQAAQVKYIAVYPPQLPRYRELREQILGPAADLV |
Ga0315283_111364512 | 3300032164 | Sediment | NPRDQKLEVIKQRCLQAAQVKYICIYPPQLPRYRELREQILGPPDVVGSG |
Ga0307470_101016493 | 3300032174 | Hardwood Forest Soil | NPRDQKLEIIKQRCLQAAQVKYVCVYPPQLPRYRELREQILGPPDVVGSG |
Ga0307471_1006780862 | 3300032180 | Hardwood Forest Soil | DQKLEIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADFTT |
Ga0307471_1040012411 | 3300032180 | Hardwood Forest Soil | REPEQVQNPRDQKLEIIKQRCLQAAQVKYLCVYPPTLPRYRELRQQILGPAAELV |
Ga0307472_1014141161 | 3300032205 | Hardwood Forest Soil | KEPEQVQNPRDQKLEIIKQRCLQAAQVKYICVYPPTLPRYRELRAQVLGPAAELV |
Ga0315271_105178412 | 3300032256 | Sediment | EIIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAGDLI |
Ga0315287_103525253 | 3300032397 | Sediment | NPRDQKLEVIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGSAGDLV |
Ga0315287_106317355 | 3300032397 | Sediment | PDAIVNPREQKLEIIKQRCLHAAQVKYVRIHPPRLPRYRELREQILGPPDVVGSG |
Ga0315287_128210312 | 3300032397 | Sediment | EIIKQRCLQAAQVKYLCVYPPQLPRYRELREQILGPAADFM |
Ga0335069_103329072 | 3300032893 | Soil | RCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV |
Ga0335084_108574971 | 3300033004 | Soil | REQKLEMIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPPDVVGSG |
Ga0316605_117252321 | 3300033408 | Soil | TKDADAVVNPRDQKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV |
Ga0316603_116455701 | 3300033413 | Soil | QKLEIIKQRCLQAAQVKYVCVYPPQLPRYRELREQILGTAGDTA |
Ga0316619_104772691 | 3300033414 | Soil | VNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYKELREQVLGTTADVVA |
Ga0316601_1002955442 | 3300033419 | Soil | DTIVNPRDQKLEIIKQRCLQAAQVKYICVYPPQLPRYKELREQVLGTTADVVA |
Ga0316601_1016558871 | 3300033419 | Soil | VNPRDQKLEIIKQRCLQAAQVKYVCVYPPQLPRYRELREQILGTAGDAA |
Ga0326726_101402594 | 3300033433 | Peat Soil | RCLQAAQVKYICVYPPQLPRYRELREQILGPPDVIGSG |
Ga0316627_1027642432 | 3300033482 | Soil | VVNPRDQKLEMIKQRCLQAAQVKYICVYPPQMPRYRELREQVLGPAADLV |
Ga0316621_110210612 | 3300033488 | Soil | DQKLEVIKQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV |
Ga0316616_1041564101 | 3300033521 | Soil | DIIKQRCLQAAQVRYICVYPPQLPRYRELREQVLGTADDYA |
Ga0316617_1021322791 | 3300033557 | Soil | EIIKQRCLQAAQVRYVCVYPPQLPRYRELREHVLGPGADLS |
Ga0326723_0450170_3_119 | 3300034090 | Peat Soil | KQRCLQAAQVKYICVYPPQLPRYRELREQILGPAADLV |
Ga0370489_0220818_430_564 | 3300034127 | Untreated Peat Soil | QKHEVIKQRCLQAAQVKYICVYPPQLPRYRELREQVLGPAADLV |
⦗Top⦘ |