NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F012904

Metagenome / Metatranscriptome Family F012904

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F012904
Family Type Metagenome / Metatranscriptome
Number of Sequences 276
Average Sequence Length 37 residues
Representative Sequence MTPEREQRRNNRRTALVLGSIALAFFVGIMLKYVMLK
Number of Associated Samples 186
Number of Associated Scaffolds 276

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 90.58 %
% of genes near scaffold ends (potentially truncated) 10.87 %
% of genes from short scaffolds (< 2000 bps) 76.45 %
Associated GOLD sequencing projects 172
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (92.029 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(34.420 % of family members)
Environment Ontology (ENVO) Unclassified
(43.841 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(36.594 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 50.77%    β-sheet: 0.00%    Coil/Unstructured: 49.23%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 276 Family Scaffolds
PF04442CtaG_Cox11 39.13
PF00115COX1 37.68
PF11174DUF2970 5.80
PF00510COX3 5.80
PF11137DUF2909 2.54
PF08241Methyltransf_11 1.45
PF02104SURF1 1.09
PF07479NAD_Gly3P_dh_C 1.09
PF13442Cytochrome_CBB3 1.09
PF13432TPR_16 0.36
PF10003DUF2244 0.36
PF02630SCO1-SenC 0.36
PF12762DDE_Tnp_IS1595 0.36
PF00950ABC-3 0.36
PF06969HemN_C 0.36
PF00156Pribosyltran 0.36
PF01467CTP_transf_like 0.36

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 276 Family Scaffolds
COG3175Cytochrome c oxidase assembly protein Cox11Posttranslational modification, protein turnover, chaperones [O] 39.13
COG1845Heme/copper-type cytochrome/quinol oxidase, subunit 3Energy production and conversion [C] 5.80
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 1.09
COG3346Cytochrome oxidase assembly protein ShyY1Posttranslational modification, protein turnover, chaperones [O] 1.09
COG0609ABC-type Fe3+-siderophore transport system, permease componentInorganic ion transport and metabolism [P] 0.36
COG0635Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductaseCoenzyme transport and metabolism [H] 0.36
COG1108ABC-type Mn2+/Zn2+ transport system, permease componentInorganic ion transport and metabolism [P] 0.36
COG1225PeroxiredoxinPosttranslational modification, protein turnover, chaperones [O] 0.36
COG1999Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC familyPosttranslational modification, protein turnover, chaperones [O] 0.36
COG4606ABC-type enterochelin transport system, permease componentInorganic ion transport and metabolism [P] 0.36


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.01 %
UnclassifiedrootN/A3.99 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2032320006|FACEOR_FYWIORV02GB111All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria515Open in IMG/M
3300002558|JGI25385J37094_10157811All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria608Open in IMG/M
3300005174|Ga0066680_10132037All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1552Open in IMG/M
3300005181|Ga0066678_10394916All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria917Open in IMG/M
3300005447|Ga0066689_11030583All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria506Open in IMG/M
3300005526|Ga0073909_10000275All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria18060Open in IMG/M
3300005526|Ga0073909_10574079All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae554Open in IMG/M
3300005540|Ga0066697_10260795All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae1026Open in IMG/M
3300005542|Ga0070732_10000792All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria18342Open in IMG/M
3300005552|Ga0066701_10011700All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae4045Open in IMG/M
3300005552|Ga0066701_10729774All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria594Open in IMG/M
3300005555|Ga0066692_10899835All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria542Open in IMG/M
3300005558|Ga0066698_10430863All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria903Open in IMG/M
3300005560|Ga0066670_10014763All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3467Open in IMG/M
3300005568|Ga0066703_10228742All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1130Open in IMG/M
3300005576|Ga0066708_10563430All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales733Open in IMG/M
3300005713|Ga0066905_100806014All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria815Open in IMG/M
3300005764|Ga0066903_100566067All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1955Open in IMG/M
3300005764|Ga0066903_103985167All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria792Open in IMG/M
3300005764|Ga0066903_104320056All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria759Open in IMG/M
3300005829|Ga0074479_10457997All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria609Open in IMG/M
3300005829|Ga0074479_10696890All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales3799Open in IMG/M
3300005829|Ga0074479_11152839All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria799Open in IMG/M
3300005830|Ga0074473_10732025All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales2013Open in IMG/M
3300005833|Ga0074472_10210507All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae4286Open in IMG/M
3300005836|Ga0074470_10266397All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4870Open in IMG/M
3300005875|Ga0075293_1004384All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae1398Open in IMG/M
3300006031|Ga0066651_10347656All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria795Open in IMG/M
3300006032|Ga0066696_10073838All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1983Open in IMG/M
3300006034|Ga0066656_10136417All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1523Open in IMG/M
3300006034|Ga0066656_10877122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria575Open in IMG/M
3300006050|Ga0075028_100104406All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1450Open in IMG/M
3300006050|Ga0075028_100670282All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria622Open in IMG/M
3300006173|Ga0070716_100009457All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae4860Open in IMG/M
3300006173|Ga0070716_100222991All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1268Open in IMG/M
3300006755|Ga0079222_10031622All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2266Open in IMG/M
3300006755|Ga0079222_11487942All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria633Open in IMG/M
3300006796|Ga0066665_11068852All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria616Open in IMG/M
3300006797|Ga0066659_10169081All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1572Open in IMG/M
3300006852|Ga0075433_10206204All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1748Open in IMG/M
3300006903|Ga0075426_10094926All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2137Open in IMG/M
3300006903|Ga0075426_10407282All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1004Open in IMG/M
3300007255|Ga0099791_10137348All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1138Open in IMG/M
3300007255|Ga0099791_10298542All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria768Open in IMG/M
3300007255|Ga0099791_10449479All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria623Open in IMG/M
3300007258|Ga0099793_10463169All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria628Open in IMG/M
3300007265|Ga0099794_10318186All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria807Open in IMG/M
3300007265|Ga0099794_10423681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria696Open in IMG/M
3300007265|Ga0099794_10483830All Organisms → cellular organisms → Bacteria651Open in IMG/M
3300007788|Ga0099795_10011555All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2644Open in IMG/M
3300007788|Ga0099795_10328646All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium679Open in IMG/M
3300009038|Ga0099829_10103770All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2216Open in IMG/M
3300009038|Ga0099829_10295594Not Available1327Open in IMG/M
3300009038|Ga0099829_10629130All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria892Open in IMG/M
3300009038|Ga0099829_10767843All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium801Open in IMG/M
3300009088|Ga0099830_10355721Not Available1178Open in IMG/M
3300009089|Ga0099828_11864305All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria528Open in IMG/M
3300009090|Ga0099827_10407972All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1162Open in IMG/M
3300009090|Ga0099827_10502807All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1041Open in IMG/M
3300009090|Ga0099827_10703937Not Available873Open in IMG/M
3300009090|Ga0099827_11283198All Organisms → cellular organisms → Bacteria → Proteobacteria637Open in IMG/M
3300009090|Ga0099827_11405345All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae607Open in IMG/M
3300009090|Ga0099827_11558154All Organisms → cellular organisms → Bacteria → Proteobacteria575Open in IMG/M
3300009137|Ga0066709_100908641All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1284Open in IMG/M
3300009597|Ga0105259_1079885All Organisms → cellular organisms → Bacteria → Proteobacteria757Open in IMG/M
3300009678|Ga0105252_10000039All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria117511Open in IMG/M
3300010046|Ga0126384_12007711All Organisms → cellular organisms → Bacteria → Proteobacteria553Open in IMG/M
3300010047|Ga0126382_11219857All Organisms → cellular organisms → Bacteria → Proteobacteria675Open in IMG/M
3300010047|Ga0126382_11637680All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria598Open in IMG/M
3300010159|Ga0099796_10036136All Organisms → cellular organisms → Bacteria → Proteobacteria1643Open in IMG/M
3300010301|Ga0134070_10430300All Organisms → cellular organisms → Bacteria → Proteobacteria525Open in IMG/M
3300010301|Ga0134070_10468232All Organisms → cellular organisms → Bacteria → Proteobacteria507Open in IMG/M
3300010323|Ga0134086_10250821All Organisms → cellular organisms → Bacteria → Proteobacteria674Open in IMG/M
3300010325|Ga0134064_10396803All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria550Open in IMG/M
3300010358|Ga0126370_10403275All Organisms → cellular organisms → Bacteria → Proteobacteria1124Open in IMG/M
3300010358|Ga0126370_12180561All Organisms → cellular organisms → Bacteria → Proteobacteria546Open in IMG/M
3300010359|Ga0126376_10108227All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2137Open in IMG/M
3300010359|Ga0126376_10242900Not Available1526Open in IMG/M
3300010359|Ga0126376_10298929All Organisms → cellular organisms → Bacteria → Proteobacteria1399Open in IMG/M
3300010359|Ga0126376_11285345All Organisms → cellular organisms → Bacteria → Proteobacteria751Open in IMG/M
3300010359|Ga0126376_12446153All Organisms → cellular organisms → Bacteria → Proteobacteria569Open in IMG/M
3300010361|Ga0126378_11069072All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria909Open in IMG/M
3300010361|Ga0126378_13460171All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria501Open in IMG/M
3300010362|Ga0126377_10876208All Organisms → cellular organisms → Bacteria → Proteobacteria960Open in IMG/M
3300010362|Ga0126377_11085512All Organisms → cellular organisms → Bacteria → Proteobacteria869Open in IMG/M
3300010366|Ga0126379_11771558All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium722Open in IMG/M
3300010366|Ga0126379_12086927All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria669Open in IMG/M
3300010376|Ga0126381_102843799All Organisms → cellular organisms → Bacteria → Proteobacteria690Open in IMG/M
3300010398|Ga0126383_10124248All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2358Open in IMG/M
3300011269|Ga0137392_10184378All Organisms → cellular organisms → Bacteria → Proteobacteria1701Open in IMG/M
3300011270|Ga0137391_11168299All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria617Open in IMG/M
3300011410|Ga0137440_1040343All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria872Open in IMG/M
3300011430|Ga0137423_1080078All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria970Open in IMG/M
3300011433|Ga0137443_1006577All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales2684Open in IMG/M
3300011438|Ga0137451_1026776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1668Open in IMG/M
3300011441|Ga0137452_1009055All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae3030Open in IMG/M
3300011442|Ga0137437_1003828All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria5330Open in IMG/M
3300011442|Ga0137437_1209662All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae676Open in IMG/M
3300011444|Ga0137463_1000114All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria31657Open in IMG/M
3300011444|Ga0137463_1001760All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales7174Open in IMG/M
3300011444|Ga0137463_1118282All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria997Open in IMG/M
3300012096|Ga0137389_10994090All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria719Open in IMG/M
3300012189|Ga0137388_10404744All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1264Open in IMG/M
3300012189|Ga0137388_10870658All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae834Open in IMG/M
3300012198|Ga0137364_10310020All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1173Open in IMG/M
3300012199|Ga0137383_10292528All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1193Open in IMG/M
3300012199|Ga0137383_10848668All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria667Open in IMG/M
3300012200|Ga0137382_10018000All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales3981Open in IMG/M
3300012201|Ga0137365_10622186All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria791Open in IMG/M
3300012201|Ga0137365_11093901All Organisms → cellular organisms → Bacteria → Proteobacteria574Open in IMG/M
3300012202|Ga0137363_10502926All Organisms → cellular organisms → Bacteria → Proteobacteria1018Open in IMG/M
3300012202|Ga0137363_11822858All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300012203|Ga0137399_10270205All Organisms → cellular organisms → Bacteria → Proteobacteria1398Open in IMG/M
3300012203|Ga0137399_10519243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria999Open in IMG/M
3300012203|Ga0137399_10883871All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria752Open in IMG/M
3300012203|Ga0137399_11123703All Organisms → cellular organisms → Bacteria → Proteobacteria661Open in IMG/M
3300012204|Ga0137374_10064794All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3642Open in IMG/M
3300012204|Ga0137374_10211333All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1661Open in IMG/M
3300012206|Ga0137380_10056503All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales3595Open in IMG/M
3300012206|Ga0137380_10326191All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1372Open in IMG/M
3300012206|Ga0137380_11622360All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300012207|Ga0137381_10669383All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria903Open in IMG/M
3300012207|Ga0137381_10877994All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria776Open in IMG/M
3300012207|Ga0137381_11099923All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria684Open in IMG/M
3300012207|Ga0137381_11408317All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria589Open in IMG/M
3300012211|Ga0137377_11445397All Organisms → cellular organisms → Bacteria → Proteobacteria615Open in IMG/M
3300012285|Ga0137370_10012190All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales4139Open in IMG/M
3300012285|Ga0137370_10079272All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae1818Open in IMG/M
3300012285|Ga0137370_10911984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium543Open in IMG/M
3300012349|Ga0137387_10059680All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2570Open in IMG/M
3300012353|Ga0137367_10491721All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria865Open in IMG/M
3300012355|Ga0137369_10643630All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae733Open in IMG/M
3300012356|Ga0137371_10024763All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales4621Open in IMG/M
3300012357|Ga0137384_10173785Not Available1803Open in IMG/M
3300012357|Ga0137384_10429846All Organisms → cellular organisms → Bacteria → Proteobacteria1088Open in IMG/M
3300012361|Ga0137360_10699873All Organisms → cellular organisms → Bacteria → Proteobacteria870Open in IMG/M
3300012532|Ga0137373_10315338All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1238Open in IMG/M
3300012683|Ga0137398_10047681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2523Open in IMG/M
3300012685|Ga0137397_10001900All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria14577Open in IMG/M
3300012685|Ga0137397_10035652All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria3554Open in IMG/M
3300012685|Ga0137397_10198773All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1491Open in IMG/M
3300012685|Ga0137397_11149395All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae562Open in IMG/M
3300012922|Ga0137394_10432524All Organisms → cellular organisms → Bacteria → Proteobacteria1121Open in IMG/M
3300012922|Ga0137394_10624972All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria910Open in IMG/M
3300012925|Ga0137419_10594587All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria888Open in IMG/M
3300012925|Ga0137419_10664409All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria842Open in IMG/M
3300012925|Ga0137419_11210047All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri633Open in IMG/M
3300012931|Ga0153915_11299243All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria850Open in IMG/M
3300012944|Ga0137410_10000615All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria24756Open in IMG/M
3300012944|Ga0137410_11077324All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria687Open in IMG/M
3300012944|Ga0137410_11310029All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria627Open in IMG/M
3300012944|Ga0137410_11327301All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria623Open in IMG/M
3300012948|Ga0126375_11748662All Organisms → cellular organisms → Bacteria → Proteobacteria541Open in IMG/M
3300012971|Ga0126369_10537192All Organisms → cellular organisms → Bacteria1232Open in IMG/M
3300012971|Ga0126369_11187819All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria853Open in IMG/M
3300012972|Ga0134077_10311642All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria663Open in IMG/M
3300014150|Ga0134081_10224681All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria647Open in IMG/M
3300014262|Ga0075301_1007760All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1598Open in IMG/M
3300014308|Ga0075354_1004527All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira1792Open in IMG/M
3300014321|Ga0075353_1006580All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1782Open in IMG/M
3300014321|Ga0075353_1033165All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1004Open in IMG/M
3300015052|Ga0137411_1221217All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2511Open in IMG/M
3300015054|Ga0137420_1445557All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria996Open in IMG/M
3300015242|Ga0137412_10006904All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria9106Open in IMG/M
3300015242|Ga0137412_10393023All Organisms → cellular organisms → Bacteria → Proteobacteria1074Open in IMG/M
3300015245|Ga0137409_10007249All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria11413Open in IMG/M
3300015245|Ga0137409_10010245All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria9479Open in IMG/M
3300017654|Ga0134069_1331539All Organisms → cellular organisms → Bacteria → Proteobacteria545Open in IMG/M
3300017657|Ga0134074_1080683All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1110Open in IMG/M
3300017659|Ga0134083_10214803All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae797Open in IMG/M
3300017939|Ga0187775_10022848All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1728Open in IMG/M
3300017944|Ga0187786_10125389All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria898Open in IMG/M
3300017959|Ga0187779_10205195All Organisms → cellular organisms → Bacteria → Proteobacteria1234Open in IMG/M
3300017974|Ga0187777_11333019All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae528Open in IMG/M
3300017997|Ga0184610_1048372All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1250Open in IMG/M
3300018000|Ga0184604_10063681Not Available1057Open in IMG/M
3300018031|Ga0184634_10187645All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria938Open in IMG/M
3300018056|Ga0184623_10020087All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2957Open in IMG/M
3300018060|Ga0187765_10124290All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1432Open in IMG/M
3300018063|Ga0184637_10013017All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae4998Open in IMG/M
3300018064|Ga0187773_10005528All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae5183Open in IMG/M
3300018071|Ga0184618_10064822All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1363Open in IMG/M
3300018074|Ga0184640_10001442All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria7164Open in IMG/M
3300018074|Ga0184640_10315493All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria709Open in IMG/M
3300018078|Ga0184612_10238670All Organisms → cellular organisms → Bacteria → Proteobacteria940Open in IMG/M
3300018082|Ga0184639_10258882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium919Open in IMG/M
3300018083|Ga0184628_10234597All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria962Open in IMG/M
3300018433|Ga0066667_10141423All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1681Open in IMG/M
3300018433|Ga0066667_10493529All Organisms → cellular organisms → Bacteria → Proteobacteria1007Open in IMG/M
3300018433|Ga0066667_10621397All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium902Open in IMG/M
3300018468|Ga0066662_10147952All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1770Open in IMG/M
3300019245|Ga0187791_1179133All Organisms → cellular organisms → Bacteria → Proteobacteria584Open in IMG/M
3300019255|Ga0184643_1297255All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae682Open in IMG/M
3300019789|Ga0137408_1173201All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae2709Open in IMG/M
3300019872|Ga0193754_1002903All Organisms → cellular organisms → Bacteria1587Open in IMG/M
3300019880|Ga0193712_1087367All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria677Open in IMG/M
3300019883|Ga0193725_1032119All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1397Open in IMG/M
3300019997|Ga0193711_1009647All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1217Open in IMG/M
3300020010|Ga0193749_1028488All Organisms → cellular organisms → Bacteria → Proteobacteria1086Open in IMG/M
3300020021|Ga0193726_1002000All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales14511Open in IMG/M
3300020170|Ga0179594_10001871All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae4811Open in IMG/M
3300020170|Ga0179594_10054896All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1353Open in IMG/M
3300020170|Ga0179594_10091803All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1082Open in IMG/M
3300021086|Ga0179596_10025601All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2206Open in IMG/M
3300021086|Ga0179596_10219669All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria930Open in IMG/M
3300021560|Ga0126371_11106779Not Available931Open in IMG/M
3300025922|Ga0207646_10424605All Organisms → cellular organisms → Bacteria → Proteobacteria1200Open in IMG/M
3300025954|Ga0210135_1002892All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1373Open in IMG/M
3300025979|Ga0210078_1002246All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium2059Open in IMG/M
3300025985|Ga0210117_1035011Not Available792Open in IMG/M
3300026277|Ga0209350_1002294All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria7554Open in IMG/M
3300026285|Ga0209438_1085588All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria998Open in IMG/M
3300026295|Ga0209234_1122568All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria956Open in IMG/M
3300026296|Ga0209235_1141756All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria974Open in IMG/M
3300026297|Ga0209237_1129965All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1035Open in IMG/M
3300026298|Ga0209236_1028511All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales3015Open in IMG/M
3300026298|Ga0209236_1074446All Organisms → cellular organisms → Bacteria → Proteobacteria1594Open in IMG/M
3300026316|Ga0209155_1119954All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria917Open in IMG/M
3300026320|Ga0209131_1410380All Organisms → cellular organisms → Bacteria → Proteobacteria508Open in IMG/M
3300026334|Ga0209377_1315007All Organisms → cellular organisms → Bacteria → Proteobacteria523Open in IMG/M
3300026340|Ga0257162_1039443All Organisms → cellular organisms → Bacteria → Proteobacteria590Open in IMG/M
3300026529|Ga0209806_1057422All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1801Open in IMG/M
3300026538|Ga0209056_10059762All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales3343Open in IMG/M
3300026548|Ga0209161_10012834All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6239Open in IMG/M
3300026557|Ga0179587_10989460All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria554Open in IMG/M
3300026557|Ga0179587_11018821All Organisms → cellular organisms → Bacteria → Proteobacteria545Open in IMG/M
3300027388|Ga0208995_1044625All Organisms → cellular organisms → Bacteria780Open in IMG/M
3300027573|Ga0208454_1000074All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria70190Open in IMG/M
3300027633|Ga0208988_1009519All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2420Open in IMG/M
3300027671|Ga0209588_1064727All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1182Open in IMG/M
3300027821|Ga0209811_10000399All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria18688Open in IMG/M
3300027842|Ga0209580_10002615All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales7741Open in IMG/M
3300027846|Ga0209180_10275984All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria965Open in IMG/M
3300027846|Ga0209180_10715510All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri543Open in IMG/M
3300027875|Ga0209283_10370530All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria937Open in IMG/M
3300027882|Ga0209590_10259683All Organisms → cellular organisms → Bacteria → Proteobacteria1110Open in IMG/M
3300027882|Ga0209590_10624272All Organisms → cellular organisms → Eukaryota693Open in IMG/M
3300027882|Ga0209590_10972393All Organisms → cellular organisms → Bacteria → Proteobacteria531Open in IMG/M
3300028792|Ga0307504_10057708All Organisms → cellular organisms → Bacteria → Proteobacteria1129Open in IMG/M
3300028802|Ga0307503_10158943All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1033Open in IMG/M
3300031152|Ga0307501_10001732All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae2510Open in IMG/M
3300031170|Ga0307498_10153125All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria767Open in IMG/M
3300031199|Ga0307495_10024927All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium1048Open in IMG/M
3300031199|Ga0307495_10170678All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae577Open in IMG/M
3300031199|Ga0307495_10239026All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae517Open in IMG/M
3300031226|Ga0307497_10004327All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae3730Open in IMG/M
3300031679|Ga0318561_10212529All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1050Open in IMG/M
3300031720|Ga0307469_10000003All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria313784Open in IMG/M
3300031720|Ga0307469_10008196All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria4920Open in IMG/M
3300031720|Ga0307469_10013586All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales4131Open in IMG/M
3300031720|Ga0307469_10020092All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales3606Open in IMG/M
3300031720|Ga0307469_10119369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae1903Open in IMG/M
3300031740|Ga0307468_100290765All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1179Open in IMG/M
3300031820|Ga0307473_10017441All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2831Open in IMG/M
3300031820|Ga0307473_10102654All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1526Open in IMG/M
3300031820|Ga0307473_10566299All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria778Open in IMG/M
3300032180|Ga0307471_100009956All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria6334Open in IMG/M
3300032180|Ga0307471_100270528All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1766Open in IMG/M
3300032180|Ga0307471_100333747Not Available1619Open in IMG/M
3300032180|Ga0307471_103655536All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria544Open in IMG/M
3300032205|Ga0307472_100626113Not Available954Open in IMG/M
3300032770|Ga0335085_10003524All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria26964Open in IMG/M
3300032783|Ga0335079_10306496All Organisms → cellular organisms → Bacteria1732Open in IMG/M
3300033004|Ga0335084_10003551All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria15221Open in IMG/M
3300033004|Ga0335084_11081566All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria805Open in IMG/M
3300033158|Ga0335077_10215076All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2151Open in IMG/M
3300033432|Ga0326729_1057820All Organisms → cellular organisms → Bacteria → Proteobacteria595Open in IMG/M
3300033433|Ga0326726_10008500All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria9117Open in IMG/M
3300033433|Ga0326726_10044637All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales3875Open in IMG/M
3300033759|Ga0314869_018534All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria518Open in IMG/M
3300033803|Ga0314862_0060063All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae834Open in IMG/M
3300033804|Ga0314863_028036All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1139Open in IMG/M
3300033809|Ga0314871_002562Not Available1058Open in IMG/M
3300033810|Ga0314872_014615All Organisms → cellular organisms → Bacteria → Proteobacteria636Open in IMG/M
3300033811|Ga0364924_089021All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium692Open in IMG/M
3300033814|Ga0364930_0049840All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1423Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil34.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil7.61%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil7.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil5.07%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil5.07%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil5.07%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil4.71%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment3.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil3.26%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)2.17%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.17%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.17%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.81%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.81%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands1.45%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.45%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.09%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.09%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.09%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.09%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.72%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.72%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.72%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.36%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.36%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.36%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil0.36%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.36%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2032320006Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+EnvironmentalOpen in IMG/M
3300002558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cmEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005552Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150EnvironmentalOpen in IMG/M
3300005555Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005830Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBMEnvironmentalOpen in IMG/M
3300005833Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBKEnvironmentalOpen in IMG/M
3300005836Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBBEnvironmentalOpen in IMG/M
3300005875Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101EnvironmentalOpen in IMG/M
3300006031Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100EnvironmentalOpen in IMG/M
3300006032Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006796Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009597Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010159Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3EnvironmentalOpen in IMG/M
3300010301Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011410Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2EnvironmentalOpen in IMG/M
3300011430Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2EnvironmentalOpen in IMG/M
3300011433Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2EnvironmentalOpen in IMG/M
3300011438Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2EnvironmentalOpen in IMG/M
3300011441Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2EnvironmentalOpen in IMG/M
3300011442Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012349Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaGEnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012361Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012972Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014150Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300014262Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1EnvironmentalOpen in IMG/M
3300014308Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1EnvironmentalOpen in IMG/M
3300014321Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1EnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015054Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300017654Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300017657Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015EnvironmentalOpen in IMG/M
3300017659Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019245Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019872Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1EnvironmentalOpen in IMG/M
3300019880Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300020010Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020170Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025954Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025979Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025985Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026277Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026295Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026298Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026334Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes)EnvironmentalOpen in IMG/M
3300026340Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-AEnvironmentalOpen in IMG/M
3300026529Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027388Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027573Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes)EnvironmentalOpen in IMG/M
3300027633Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027671Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027875Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033432Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fractionEnvironmentalOpen in IMG/M
3300033433Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MNEnvironmentalOpen in IMG/M
3300033759Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_BEnvironmentalOpen in IMG/M
3300033803Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10EnvironmentalOpen in IMG/M
3300033804Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20EnvironmentalOpen in IMG/M
3300033809Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_DEnvironmentalOpen in IMG/M
3300033810Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_EEnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACEORE_21540402032320006SoilVTPERNRDNLKTALVLGSIALVFFVGIMLKYVILK
JGI25385J37094_1015781123300002558Grasslands SoilSRAAGGEMTGNRTQRTNNRRTALVLASIAFAFFLGIILKYVLLK*
Ga0066680_1013203713300005174SoilAAGGEMTGNRTQRTNNRRTALVLASIAFAFFLGIILKYVLLK*
Ga0066678_1039491633300005181SoilMTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVIMLK*
Ga0066689_1103058313300005447SoilRATGAGMTPERLQRRSNRRTALVLGSIALVFFVAIMLKYIILK*
Ga0073909_10000275173300005526Surface SoilVTPGRGQQHNLRTALVLGSIALVFFLGIMLKYFILR*
Ga0073909_1057407923300005526Surface SoilMTSGGEQRQNNRRTAWVLASIALAFFIGIMLKYVMLK*
Ga0066697_1026079523300005540SoilMTPELEQRRSNRRTAWVLGSIALAFFLGIMLKYVMLK*
Ga0070732_1000079283300005542Surface SoilMTATRDPRPANRRTALVLASIALAFFFGIMLKYILTR*
Ga0066701_1001170083300005552SoilMTPEREQRRSNRRTAWVLGSIALAFFLGIMLKYVMLK*
Ga0066701_1072977413300005552SoilMTPERDQRRNNRWTALVLGSIALAFFVGIMLKYVMLK*
Ga0066692_1089983523300005555SoilMTGNRTQRTNNRRTALVLASIAFAFFLGIILKYVLLK*
Ga0066698_1043086323300005558SoilMTGNRTQRMNNRRTALVLASIAFAFFLGIMLKYVLLK*
Ga0066670_1001476333300005560SoilMTPELLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK*
Ga0066703_1022874233300005568SoilMTPERLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK*
Ga0066708_1056343013300005576SoilMTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVI
Ga0066905_10080601423300005713Tropical Forest SoilMTPARDQRSKLRTALVLGSVALAFFIGIMLKYIMLR*
Ga0066903_10056606723300005764Tropical Forest SoilMRSEQRRDNLRTALVLGSIAFVFFIGIMLKYVILK*
Ga0066903_10398516723300005764Tropical Forest SoilVTPQREQRPNLRTALVLGSIALAFFVGIMLKYVLLK*
Ga0066903_10432005623300005764Tropical Forest SoilVSPERQQRNNLRTALVLGSIALAFFIGIMLKYLVLK*
Ga0074479_1045799723300005829Sediment (Intertidal)MREQQRDNLRTALVLGSIALVFFAGIVLKYFVLK*
Ga0074479_1069689053300005829Sediment (Intertidal)VTREQQRDNLRTALVLGSIALVFFVGIVLKYFVLK*
Ga0074479_1115283923300005829Sediment (Intertidal)MTPEREQRRNNRRTAWVLGSIALVFFLGTMVKYVMLK*
Ga0074473_1073202543300005830Sediment (Intertidal)MNPQRTGNLRTALLLASIALVFFVGIMLKYLFLR*
Ga0074472_1021050733300005833Sediment (Intertidal)MTDHGHSASNRRTALVLASIALVFFVGIMLKYVLLK*
Ga0074470_1026639723300005836Sediment (Intertidal)VTSWRSTNLRTALVLGSIALVFFLGIMLKYLFLR*
Ga0075293_100438423300005875Rice Paddy SoilMLDRPQRINRRTALVLASVALAFFFGIMLKYVLLK*
Ga0066651_1034765623300006031SoilMTPEREQRRSNRMTALVLGSIALVFFVAIMLKYAMLK*
Ga0066696_1007383853300006032SoilPERLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK*
Ga0066656_1013641743300006034SoilMTPEREQRRNNRWTALVLGSIALAFFVGIMLKYVMLK*
Ga0066656_1087712223300006034SoilMTPEREQRRSNRMTALVLASIALVFFVAIMLKYAMLK*
Ga0075028_10010440623300006050WatershedsVTPDNGQRANIRRTAWVLGSIALAFFLGIVLKYVLLK*
Ga0075028_10067028223300006050WatershedsMPDSGQRANIRRTAWVLGSIALAFFLGIMLKYVLLK*
Ga0070716_10000945743300006173Corn, Switchgrass And Miscanthus RhizosphereMMPGREQRRSNRMTALVLGSIALAFFVAIMLKYIMLK*
Ga0070716_10022299123300006173Corn, Switchgrass And Miscanthus RhizosphereMTPEREQRRSNLRTALLLGSIALAFFVGIMLKYVMLK*
Ga0079222_1003162223300006755Agricultural SoilMTPDRDQRQNNLRTAIVLGSIALAFFFGIMLKYVMLK*
Ga0079222_1148794223300006755Agricultural SoilVTPEREQRNKLRTALVLGSIALAFFFGIMLKYIVL
Ga0066665_1106885223300006796SoilMTPERLQRRSNRRTALVLGSIALVFFVAIMLKYIILK*
Ga0066659_1016908123300006797SoilMTPEREQRRNNRWTALVLGSIALAFFVGVVLKYWLLK*
Ga0075433_1020620423300006852Populus RhizosphereMTPEREQRRNNRRTALLLGSIALVFFVAIMLKYVMLK*
Ga0075426_1009492623300006903Populus RhizosphereMTPEREQRRSNRRTALVLGSIALAFFVAIMLKYAMLK*
Ga0075426_1040728223300006903Populus RhizosphereMTPEREQRRNNHRTALVLGSIALAFFVAIMLKYAMLK*
Ga0099791_1013734823300007255Vadose Zone SoilMTPGRERQRSNRRTALVLGSIALVFFVAIMLKYVMLK*
Ga0099791_1029854223300007255Vadose Zone SoilMTPEQRTNIRRTALVLASIALAFFFGIMLKYVLVK*
Ga0099791_1044947923300007255Vadose Zone SoilMTPERERRRNNRRTAWVLGSIALAFFLGIMLKYVMLK*
Ga0099793_1046316923300007258Vadose Zone SoilMTPEQRTNIRRTALVLASIALAFFFGIMLKYALLK*
Ga0099794_1031818623300007265Vadose Zone SoilMTPGREQQRSNRRTALVLGSIALVFFVAIMLKYVMLK*
Ga0099794_1042368123300007265Vadose Zone SoilMTPEREQRRNNRRTAWVLGSIALVFFVGIMLKYVMLK*
Ga0099794_1048383023300007265Vadose Zone SoilMTGNRTQRTNNRRTALVLASIAFAFFLGIMLKYVLLK*
Ga0099795_1001155523300007788Vadose Zone SoilMTPEQRTNIRRTALMLASIALAFFFGIILKYVLLK*
Ga0099795_1032864623300007788Vadose Zone SoilMTPERLQRRSNRRTALVLGSIALAFFVAIMLKYVMLK*
Ga0099829_1010377053300009038Vadose Zone SoilMTPEQRTGIRRTALVLASIALAFFFGIMLKYALLK*
Ga0099829_1029559423300009038Vadose Zone SoilMTPERRTGIRRTALVLASVALAFFFGIMLKYVLLK*
Ga0099829_1062913023300009038Vadose Zone SoilMTPEREQRRNNRRTALVLGSIALVFFVAIMLKYVMLK*
Ga0099829_1076784323300009038Vadose Zone SoilMTPEREQRRNNRRTALVLGSIALAFFVGIMLKYVMLK*
Ga0099830_1035572113300009088Vadose Zone SoilMTPRQRTNIRRTALVLASIALAFFFGIMLKYVLIR
Ga0099828_1186430523300009089Vadose Zone SoilVTPEQRTGIRRTAIVLASIALAFFFGIMLKYVVLK*
Ga0099827_1040797223300009090Vadose Zone SoilMTPERRTGIRRTALVLASIALAFFFGIMLKYVLLK*
Ga0099827_1050280723300009090Vadose Zone SoilMTPEREQRRNNRRTAWVLGSIALFFFLGIMLKYVMLK*
Ga0099827_1070393713300009090Vadose Zone SoilMTPERERRRNNRRTAWMLGSIALAFFLGIMLKYVMLK*
Ga0099827_1128319813300009090Vadose Zone SoilMTQERARRASNRRTALVLASIAAAFFLGIMLKYVLLK*
Ga0099827_1140534523300009090Vadose Zone SoilMTPERERRRNNRWTALVLGSIALVFFLGIMLKYVMLK*
Ga0099827_1155815423300009090Vadose Zone SoilMTPEREQRRNNRWTALVLGSIALVFFVAIMLKYVMLK*
Ga0066709_10090864143300009137Grasslands SoilMTPEQRTNIRRTALVLASIALAFFIVIMLTYVLVK*
Ga0105259_107988513300009597SoilEMMLDHGHRTNNRVTALVLASIALVFFVAIMLKYVLLK*
Ga0105252_10000039403300009678SoilMMLDRGHRTHNRVTALVLASIALVFFVGIMLKYVLLK*
Ga0126384_1200771113300010046Tropical Forest SoilMRSEQRRDNLRTALVLGSIALAFFVGIMLKYVILK*
Ga0126382_1121985723300010047Tropical Forest SoilMREQRQSNLRTALVLGSIALAFFVGVMLKYVILK*
Ga0126382_1163768023300010047Tropical Forest SoilVISEQRRGNLKTALVLGSIALVFFVGIMLKYIILR*
Ga0099796_1003613643300010159Vadose Zone SoilMTPEQRTNIRRTALMLASIALAFFFGIMLKYVLVK*
Ga0134070_1043030013300010301Grasslands SoilMTPEREQRRNNRWTALALGSIALAFFVGIMLKYVMLK*
Ga0134070_1046823213300010301Grasslands SoilTGGEMTPEREQRRRNNRRTAWWLGSIALVFFLGIMLKYVMIK*
Ga0134086_1025082113300010323Grasslands SoilEREQRRNNRWTALVLGSIALAFFVGIMLKYVMLK*
Ga0134064_1039680323300010325Grasslands SoilMTPERRQWRSNRRTALVLGSIALAFFVAIMLKYAMLK*
Ga0126370_1040327523300010358Tropical Forest SoilVSPERQQRNNLRTALVLGSIALAFFIGIMLKYLALK*
Ga0126370_1218056123300010358Tropical Forest SoilVTQEREQQHNLRTALVLGSIALAFFVGVMLKYLLLK*
Ga0126376_1010822713300010359Tropical Forest SoilRAAGGEVTPERQRDNLKTALVLGSIALVFFIGIMLKYVILK*
Ga0126376_1024290033300010359Tropical Forest SoilVTSGRQRDNLRTALVLGSIALAFFIGIMLKYVVLK*
Ga0126376_1029892943300010359Tropical Forest SoilVTQERHRDNLKTALVLGSIALVFFFGIMLKYVILK*
Ga0126376_1128534513300010359Tropical Forest SoilAGGEMRSEQRRDNLRTALVLGSIAFVFFIGIMLKYVILK*
Ga0126376_1244615313300010359Tropical Forest SoilVTQEREQRHKLRTALVLGSIALAFFFGIMLKYVMLK*
Ga0126378_1106907223300010361Tropical Forest SoilVTQERHRDNLKTALVLGSIALVFFLGIMLKYVLLR*
Ga0126378_1346017123300010361Tropical Forest SoilVTPQRHRDNLKTALVLGSIALVFFLGIMLKYVLLK*
Ga0126377_1087620823300010362Tropical Forest SoilVTQEREQRHNLRTALVLGSIALAFFFGIMLKYVMLK*
Ga0126377_1108551223300010362Tropical Forest SoilVTPERQRDNLKTALVLGSIALVFFIGIMLKYVILK*
Ga0126379_1177155813300010366Tropical Forest SoilVSTERQQRNNLRTALVLGSIALAFFIGIMLKYLVLK*
Ga0126379_1208692723300010366Tropical Forest SoilMPQREQRPNLRTALVLGSIALAFFVGIMLKYVLLK*
Ga0126381_10284379923300010376Tropical Forest SoilVTQERQRDNLKTALVLGSIALVFFFGIMLKYVLLK*
Ga0126383_1012424843300010398Tropical Forest SoilVTPGRQRDNLKTALVLGSIALVFFIGIMLKYVILK*
Ga0137392_1018437843300011269Vadose Zone SoilMTPGREQRRNNRRTALLLGSIALAFFLGIMLKYVMLK*
Ga0137391_1116829923300011270Vadose Zone SoilMTGNRTQRTNNRRTALVLASIALAFFLGIMLKYVLLK*
Ga0137440_104034323300011410SoilMMLDHGHRTNNRVTALVLASIALVFFVAIMLKYVLLK*
Ga0137423_108007833300011430SoilMTGNRTQRTNNRRTALVLASLAVAFFLGIMLKYVLLK*
Ga0137443_100657723300011433SoilMMLDHGHRTNNRVTALVLASIALVFFVGIMLKYVLLK*
Ga0137451_102677643300011438SoilMMFDRGHRTNNRVTALVLASIALVFFFGIMLKYVLIK*
Ga0137452_100905543300011441SoilMMFDRGHRTHNRVTALVLASIALVFFFGIMLKYVLIK*
Ga0137437_1003828103300011442SoilVTRAPQRDNLRTALVLGSISLVFFVGIMLKYFLLK*
Ga0137437_120966223300011442SoilVTREQHRGNLRTALVLGSVALVFFAGIMLKYFILK*
Ga0137463_100011443300011444SoilMTPEREQRQNNRRTAWVLGSIALVFFLGIMLKYVMLK*
Ga0137463_100176073300011444SoilMTPEREQRRNNRRTAWVLGSIALAFFLGIMLKYVMLK*
Ga0137463_111828243300011444SoilMSHGAQRRGNLRTAMVLGSIALAFFVGIMLKYILLK*
Ga0137389_1099409023300012096Vadose Zone SoilMTPERRTGIRRTALVLASVALAFFFGIMLKYVLIR*
Ga0137388_1040474443300012189Vadose Zone SoilSRAAGGEMTGNRTQRTNNRRTALVLASIAFAFFLGIMLKYVLLK*
Ga0137388_1087065823300012189Vadose Zone SoilMTPGRDQRANIRRTAWVLGSIALAFFLGIMLKYVLLK*
Ga0137364_1031002043300012198Vadose Zone SoilMIPAREQRRSNRRTALVLGSIALVFFVAIMLKYAMLK*
Ga0137383_1029252843300012199Vadose Zone SoilATGGGMTPERDQRRNNRWTALVLGSIALAFFVGIMLKYVMLK*
Ga0137383_1084866823300012199Vadose Zone SoilMTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMLK*
Ga0137382_1001800013300012200Vadose Zone SoilMMPAREQRRSNRRTALVLGSIALVFFVAIMLKYVMLK*
Ga0137365_1062218623300012201Vadose Zone SoilMTPEREQRRNNRWTALLLGSIALAFFVGIMLKYVMLK*
Ga0137365_1109390123300012201Vadose Zone SoilMTPEREQRRNNRRTALALGSIARAFFVGIMLKYVMLK*
Ga0137363_1050292643300012202Vadose Zone SoilMPAREQRRSNRRTALVLGSIALVFFVAIMLKYVMLK*
Ga0137363_1182285813300012202Vadose Zone SoilTRAQHRDNLRTGLVLGSIALVFFVGIVLKYFILK*
Ga0137399_1027020533300012203Vadose Zone SoilMTPEREQRRNNRRTALLLGSIALVFFVAVMLKYVILK*
Ga0137399_1051924323300012203Vadose Zone SoilMTSEREQRRNNRWTALVLGSIALAFFLGIMLKYVMLK*
Ga0137399_1088387123300012203Vadose Zone SoilMTPEREQRRSNRRTAWVLASIALAFFLGIMLKYVMLK*
Ga0137399_1112370323300012203Vadose Zone SoilMMPAREQRRSNRRTALVLGSIALVFFVAIMLKYAMLK*
Ga0137374_1006479473300012204Vadose Zone SoilMTPEREQRRNNRRTAWVLGSIALVFFVGIMLKYVVLK*
Ga0137374_1021133323300012204Vadose Zone SoilMTPEQRTGIRRTALVLASIALAFFFGIILKYVLLK*
Ga0137380_1005650373300012206Vadose Zone SoilMTSERERRRNNRRTALVLGSIALVFFLGIMLKYVMLK*
Ga0137380_1032619133300012206Vadose Zone SoilMMQGRVRRASNRRTALVLASIAAAFFLGIMLKYILLK*
Ga0137380_1162236023300012206Vadose Zone SoilPERELRRNNRWTALVLGSIALVFFLGIMLKYVMLK*
Ga0137381_1066938323300012207Vadose Zone SoilMTPERELRRNNRRTALVLGSIALAFFLGIMLKYVMLK*
Ga0137381_1087799423300012207Vadose Zone SoilMTPEREQRRNNRWTALVLCSIALVFFLGIMLKYVMLK*
Ga0137381_1109992323300012207Vadose Zone SoilMTPERERRRNNRRTAWVLGSIALVFFLGIVLKYVMLK*
Ga0137381_1140831723300012207Vadose Zone SoilMRPEREQRRNNRRTALVLCSIALVFFLGIMLKHVVLK*
Ga0137377_1144539723300012211Vadose Zone SoilMTSEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMLK*
Ga0137370_1001219083300012285Vadose Zone SoilMTPEREQRRNIRWTALVLGSIALAFFVGIMLKYVMLK*
Ga0137370_1007927223300012285Vadose Zone SoilMTPERERWRNNRRTAWVLGSIALVFFLGIMLKYVMLK*
Ga0137370_1091198423300012285Vadose Zone SoilMTPERLQRRSNRKTALVLGSIALAFFLAIMLKYAMLK*
Ga0137387_1005968043300012349Vadose Zone SoilMTPEREQRRRNNRRTAWWLGSIALVFFLGIMLKYVMLK*
Ga0137367_1049172123300012353Vadose Zone SoilMTLERRTGIRRTALVLASIALAFFFGIMLKYALLK*
Ga0137369_1064363023300012355Vadose Zone SoilMTPERERRRNNRRTAWVLGSIALVFFLGIMLKYVMLK*
Ga0137371_1002476383300012356Vadose Zone SoilMTPEREQRRNNRRTALALGSIALAFFVGIMLKYVMLK*
Ga0137384_1017378533300012357Vadose Zone SoilMTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVM
Ga0137384_1042984643300012357Vadose Zone SoilATGGEMTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMLK*
Ga0137360_1069987343300012361Vadose Zone SoilMTPEREQRRNNRRTALVLGSIALVFFLGIMLKYVMLK*
Ga0137373_1031533823300012532Vadose Zone SoilMTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMIK*
Ga0137398_1004768153300012683Vadose Zone SoilMTPEREQRRNNRRTALLLGSIALVFFVAVMLKYVMLK*
Ga0137397_10001900203300012685Vadose Zone SoilVTREPQRDNVRTALVLGSIALAFFVGIMLKYFILK*
Ga0137397_1003565223300012685Vadose Zone SoilMSHGAQRRGNFRTALVLGSIALAFFVGIMLKYILLK*
Ga0137397_1019877323300012685Vadose Zone SoilMTRAQQRDNVRTAVVLGSIALVFFLGIMLKYFVLK*
Ga0137397_1114939523300012685Vadose Zone SoilMTTEREQRRNNRRTAWVLGSIALAFFLGIMLKYVMLK*
Ga0137394_1043252433300012922Vadose Zone SoilMSGNRAQRTNNRRTALVLAWIAFAFFLGIVLKYVLLK*
Ga0137394_1062497223300012922Vadose Zone SoilMTPEREQQRSNRRTAWVLGSIALAFFLGIMLKYVMLK*
Ga0137419_1059458733300012925Vadose Zone SoilGMTPEQRTNIRRTALVLASIALAFFFGIMLKYVLVK*
Ga0137419_1066440923300012925Vadose Zone SoilMTPGSEQRRNNRRTALVLGSIALVFFVAIMLKYVMLK*
Ga0137419_1121004723300012925Vadose Zone SoilMTPEQRSNIRRTALMLASIALAFFFGIILKYVLLK*
Ga0153915_1129924323300012931Freshwater WetlandsVVDRAQRMNRRTALVLASVALVFFLGIMLKYVMLK*
Ga0137410_1000061563300012944Vadose Zone SoilMTPEREQRRNNRRTAWVLGSIALAFFVGIMLKYVMLK*
Ga0137410_1107732423300012944Vadose Zone SoilVTPEREPRHKLRTALVLGSIALAFFFGIMLKYVVLK*
Ga0137410_1131002923300012944Vadose Zone SoilMTETRALRRNNRRTALVLASIALAFFLGTMLKYAWLR*
Ga0137410_1132730123300012944Vadose Zone SoilMSHGAQRRGNFRTALVLGSIALAFFVGIMLKYIVLR*
Ga0126375_1174866223300012948Tropical Forest SoilVTPERQRDNLRTALVLGSIALVFFIGIMLKYVILK*
Ga0126369_1053719223300012971Tropical Forest SoilVTREQQRLNLRTALVLGSIALVFFLGIMLKYFLLK*
Ga0126369_1118781923300012971Tropical Forest SoilVTQEREQRHNLRTALVLGSIAVAFFIGIMLKYLVLK*
Ga0134077_1031164223300012972Grasslands SoilMTPERLQRRSNRRTALVLGSIALVFFVAIMLKYAMLK*
Ga0134081_1022468123300014150Grasslands SoilMTPERLQRRSNRRTALVLGSIALAFFVAIMLKYAMLK*
Ga0075301_100776023300014262Natural And Restored WetlandsMSPQRTGNLRTALVLASIAVAFFVGIMLKYLFLR*
Ga0075354_100452723300014308Natural And Restored WetlandsMIDRGQRSNNRVTALVLASIALAFFIGIMLKYVLIK*
Ga0075353_100658023300014321Natural And Restored WetlandsMMGDRTQRGNLRTGLVLASIALVFFLGIMLKYALTK*
Ga0075353_103316523300014321Natural And Restored WetlandsMIDRGQRSNNRVTALVLASIALAFFIGIMLKYVLTK*
Ga0137411_122121733300015052Vadose Zone SoilMTPGREQQRSNRRTALVLASIALVFFVAIMLKYVMLK*
Ga0137420_144555723300015054Vadose Zone SoilMTPEREQRRSNRRTAWVLGSIALAFFLGIMLKYVRLK*
Ga0137412_1000690453300015242Vadose Zone SoilMTPEQRTNIRRTALVLASIALAFFFGIMLKYVLLK*
Ga0137412_1039302343300015242Vadose Zone SoilGAGMTPEREQRRNNRRTALLLGSIALVFFVAIMLKYVMLK*
Ga0137409_1000724933300015245Vadose Zone SoilVTPGRGQQHNLRTALVLGSIALVFFLGIMLKYLILR*
Ga0137409_10010245133300015245Vadose Zone SoilVIRAQRRDNLRTGLVLGSIALVFFVGIVLKYFILK*
Ga0134069_133153923300017654Grasslands SoilMTPEREQRRNNRWTALALGSIALAFFVGIMLKYVMLK
Ga0134074_108068313300017657Grasslands SoilMTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMLK
Ga0134083_1021480323300017659Grasslands SoilMTPELEQRRSNRRTAWMLGSIALAFFLGIMLKYVMLK
Ga0187775_1002284833300017939Tropical PeatlandVTREQQPDNLRTALVLGSIALAFFLGIVLKYFLLK
Ga0187786_1012538923300017944Tropical PeatlandVTREQRRDNLRTALVLGSIALVFFLGIMLKYFILK
Ga0187779_1020519533300017959Tropical PeatlandVTREQQRDNLRTAVVLGSIALVFFLGIMLKYFLLK
Ga0187777_1133301923300017974Tropical PeatlandVTREQQRDNLRTAVVLGSIALVFFLGVMLKYFLLK
Ga0184610_104837223300017997Groundwater SedimentMTGNRTQRTNNRRTALLLASIAFAFFLGIVLKYALLK
Ga0184604_1006368123300018000Groundwater SedimentMTPEREQRRNNRWTALVLGSIALVFFLGIMLKYVMLK
Ga0184634_1018764533300018031Groundwater SedimentPRAAGGEMTPEQRTNTRRTALVLASIALVFFFGVMLKYVALR
Ga0184623_1002008723300018056Groundwater SedimentMTGNRTQRTNNRRTALLLASIAFAFFLGIVLKYVLLK
Ga0187765_1012429033300018060Tropical PeatlandVTRDQQRDNFRTALVLGSIALVFFLGIMLKYFLLT
Ga0184637_1001301763300018063Groundwater SedimentMMLDRGHRTNNRVTALVLASIALVFFVGIMLKYILIK
Ga0187773_1000552843300018064Tropical PeatlandMGDRAHRGNLKTGLVLASIALAFFLGIMLKYVLTK
Ga0184618_1006482223300018071Groundwater SedimentMTPEREQRRNNRRTAWVLGSIALVFFVGIMLKYVMLK
Ga0184640_1000144243300018074Groundwater SedimentMTPEQRTNTRRTALVLASIALVFFFGVMLKYVALR
Ga0184640_1031549323300018074Groundwater SedimentMLDRGHRTNNRVTALVLASIALVFFVGIMLKYILIK
Ga0184612_1023867033300018078Groundwater SedimentMKVEREQRTNKRITALVLASIALAFFFGIMLKYVLLK
Ga0184639_1025888223300018082Groundwater SedimentMKVAREQRTNRRITALVLASIALAFFFGIMLKYILIK
Ga0184628_1023459723300018083Groundwater SedimentMTPEREQRRNNRRTALVLGSIALVFFLGIMLKYVMLK
Ga0066667_1014142343300018433Grasslands SoilMTPELLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK
Ga0066667_1049352943300018433Grasslands SoilGMTPEREQRRNNRWTALVLGSIALAFFVGIMLKYVMLK
Ga0066667_1062139723300018433Grasslands SoilMTPEREQRRNNRWTALVLGSIALAFFVGIMLKYVMLK
Ga0066662_1014795243300018468Grasslands SoilMTPEREQRRSNRMTALVLGSIALVFFVAIMLKYAMLK
Ga0187791_117913323300019245PeatlandMGNHVQRTNFKTGLVLASIALAFFLGIMLKYVLIK
Ga0184643_129725523300019255Groundwater SedimentMTPEREQRRSNRRTAWVLGSIALAFFLGIMLKYVMLK
Ga0137408_117320123300019789Vadose Zone SoilMTPEREQRRNNRRTALLLGSIALVFFVAIMLKYVMLK
Ga0193754_100290333300019872SoilMTPERERRRNNRRTAWVLGSIALAFFLGIMLKYVMLK
Ga0193712_108736723300019880SoilMTPGREQQRSNRRTALVLGSIALVFFVAIMLKYVMLK
Ga0193725_103211923300019883SoilMTPEREQRRNNRRTALVLGSIALVFFVAIMLKYVMLK
Ga0193711_100964723300019997SoilMMPAREQRRSNRRTALVLGSIALAFFVAIMLKYVMLK
Ga0193749_102848823300020010SoilMTPGREQRRNNRRTALLLGSIALAFFLGIMLKYVMLK
Ga0193726_1002000103300020021SoilMTPDSGQRASIRRTAWVLGSIALAFFLGIMLKYVLLK
Ga0179594_1000187163300020170Vadose Zone SoilMSHGAQRRGNFRTALVLGSIALAFFVGIMLKYILLK
Ga0179594_1005489623300020170Vadose Zone SoilMTPEREQRRNNRRTALLLGSIALVFFVAVMLKYVMLK
Ga0179594_1009180323300020170Vadose Zone SoilMTPEQRTNIRRTALVLASIALAFFFGIMLKYVLVK
Ga0179596_1002560123300021086Vadose Zone SoilMTPEREQRRNNRRTALVLGSIALAFFVGIMLKYVMLK
Ga0179596_1021966923300021086Vadose Zone SoilMTPEQRTGIRRTALVLASIALAFFFGIMLKYALLK
Ga0126371_1110677923300021560Tropical Forest SoilVSPERQQRNNMRTALVLGSIALVFFFGIMLKYVLLK
Ga0207646_1042460533300025922Corn, Switchgrass And Miscanthus RhizosphereMMRGREQRRSNRMTALVLGSIALAFFVAIMLKYIMLK
Ga0210135_100289213300025954Natural And Restored WetlandsMIHRGQRSNNWITALVLASVALAFFIGIMLKYVLTK
Ga0210078_100224623300025979Natural And Restored WetlandsMIDRGQRSNNRVTALVLASIALAFFIGIMLKYVLIK
Ga0210117_103501113300025985Natural And Restored WetlandsMMGDRTQRGNLRTGLVLASIALVFFLGIMLKYVLTK
Ga0209350_100229433300026277Grasslands SoilMTPERLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK
Ga0209438_108558823300026285Grasslands SoilMTTEREQRRNNRRTAWVLGSIALAFFLGIMLKYVMLK
Ga0209234_112256823300026295Grasslands SoilMTPERRQWRSNRRTALVLGSIALAFFVAIMLKYAMLK
Ga0209235_114175623300026296Grasslands SoilMTGNRTQRTNNRRTALVLASIAFAFFLGIILKYVLLK
Ga0209237_112996533300026297Grasslands SoilMTPEQRTNIRRTALVLASIALAFFFGIMLKYALLK
Ga0209236_102851163300026298Grasslands SoilMTPEREQQRSNRRTAWVLGSIALAFFLGIMLKYVMLK
Ga0209236_107444623300026298Grasslands SoilMTPELEQRRSNRRTAWVLGSIALAFFLGIMLKYVMLK
Ga0209155_111995423300026316SoilMTPEREQRRSNRMTALVLASIALVFFVAIMLKYAMLK
Ga0209131_141038023300026320Grasslands SoilMTETRALRRNNRRTALVLASIALAFFLGTMLKYAWLR
Ga0209377_131500723300026334SoilMTPERDQRRNNRWTALVLGSIALAFFVGIMLKYVMLK
Ga0257162_103944313300026340SoilGAGMTPERERRRNNRRTAWVLGSVALAFFLGIMLKYVMLK
Ga0209806_105742223300026529SoilMTPERLQRRSNRRTALVLGSIALVFFVAIMLKYIILK
Ga0209056_1005976273300026538SoilGGGMTPERDQRRNNRWTALVLGSIALAFFVGIMLKYVMLK
Ga0209161_1001283433300026548SoilMTPERDQRRNNRWTALVLGSIALVFFVGIMLKYVMLK
Ga0179587_1098946023300026557Vadose Zone SoilMTPEQRTNIRRTALMLASIALAFFFGIILKYVLLK
Ga0179587_1101882123300026557Vadose Zone SoilMMPAREQRRSNRRTALVLGSIALVFFVAIMLKYAMLK
Ga0208995_104462513300027388Forest SoilMTPEREQRRNNRRTAWVLGSIALAFFLGIMLKYVMLK
Ga0208454_1000074533300027573SoilMMLDRGHRTHNRVTALVLASIALVFFVGIMLKYVLLK
Ga0208988_100951943300027633Forest SoilMMPAREQRRSNRRTALVLGSIALVFFVAIMLKYVMLK
Ga0209588_106472723300027671Vadose Zone SoilMTPGRERQRSNRRTALVLGSIALVFFVAIMLKYVMLK
Ga0209811_1000039923300027821Surface SoilVTPGRGQQHNLRTALVLGSIALVFFLGIMLKYFILR
Ga0209580_1000261583300027842Surface SoilMTATRDPRPANRRTALVLASIALAFFFGIMLKYILTR
Ga0209180_1027598423300027846Vadose Zone SoilMTGNRTQRTNNRRTALVLASIAFAFFLGIMLKYVLLK
Ga0209180_1071551023300027846Vadose Zone SoilMTPERRTGIRRTALVLASVALAFFFGIMLKYVLLK
Ga0209283_1037053023300027875Vadose Zone SoilMTPEQRTNIRRTALVLASIALAFFFGIMLKYVLLK
Ga0209590_1025968323300027882Vadose Zone SoilMTPEREQRRNNRRTAWVLGSIALFFFLGIMLKYVMLK
Ga0209590_1062427223300027882Vadose Zone SoilMTPERERRRNNRRTAWMLGSIALAFFLGIMLKYVMLK
Ga0209590_1097239313300027882Vadose Zone SoilMTPEQRTGIRRTALVLASIALAFFFGIMLKYVLLK
Ga0307504_1005770823300028792SoilMTGNRVQRANNRRTAFVLASIALAFFVGIMLKYVLLK
Ga0307503_1015894323300028802SoilVTPDRGQQHNLRTALVLGSIALVFFAGIMLKYLILK
Ga0307501_1000173223300031152SoilMTPERLQRRSNRRTALVLGSIALAFFVAIMLKYAMLK
Ga0307498_1015312523300031170SoilVTLEREQRNKLRTALVLGSIALAFFFGIMLKYVVLK
Ga0307495_1002492733300031199SoilMMPAREQRRSNRRTALVLGLIALAFFVAIMLKYVMLK
Ga0307495_1017067823300031199SoilVTLEREQRNKLRTAAVLGSIALAFFFGVMLKYVVLK
Ga0307495_1023902623300031199SoilMTPERERRRNNLRTAWVLGSIALIFFLGIILKYVMHE
Ga0307497_1000432733300031226SoilMTPEREQRRNNRRTAWVLGSIALAFFFGIMLKYIVLK
Ga0318561_1021252923300031679SoilVTPGRQRDNLKTALVLGSIALVFFIGIMLKYVILK
Ga0307469_1000000383300031720Hardwood Forest SoilMMPAREQQRNNRRTAWVLASIALAFFAAIMLKYVMLK
Ga0307469_1000819663300031720Hardwood Forest SoilVTPEHEQRHKLRTALVLGSIALAFFFGIMLKYVVLK
Ga0307469_1001358633300031720Hardwood Forest SoilMTPERDQRQSNLRTALVLGSIALAFFVGIMLKYVLIK
Ga0307469_1002009243300031720Hardwood Forest SoilVTAEREQRHRLRTALVLGSIALAFFFGIMLKYVVLK
Ga0307469_1011936923300031720Hardwood Forest SoilMTSERERRRSNRRTALVLGSIALVFFLGIMLKYVMLK
Ga0307468_10029076523300031740Hardwood Forest SoilVRAVVEQRRNNLRTAIVLGSIALAFFVGIMLKYVILK
Ga0307473_1001744133300031820Hardwood Forest SoilMTPEREQRRNNRRTALVLGSIALAFFLGIMLKYVMLK
Ga0307473_1010265443300031820Hardwood Forest SoilMTPEREQRRNNRRTAWVLGSIALAFFAAIMLKHVMLE
Ga0307473_1056629923300031820Hardwood Forest SoilMTPEREQRRNNLRTAWVLGSIALIFFLGIILKYVTLE
Ga0307471_100009956103300032180Hardwood Forest SoilMTPEREQRRSNRMTALVLGSIALAFFVAIMLKYAMLK
Ga0307471_10027052843300032180Hardwood Forest SoilMTSEREQRRNNLRTALLLGSIALAFFVGIMLKYVMLK
Ga0307471_10033374723300032180Hardwood Forest SoilMSPERDQRQSNLRTALVLGSIALAFFVGIMLKYVLIK
Ga0307471_10365553623300032180Hardwood Forest SoilVTPGPGQQHNLRTALVLGSIALVFFVGIMLKYVILR
Ga0307472_10062611313300032205Hardwood Forest SoilMVHGGQRRGNLRTALVLGSIALAFFVGILLKYLILK
Ga0335085_10003524153300032770SoilMGDRAHRGNLKTGLVLASIALVFFLGIMLKYVLTK
Ga0335079_1030649623300032783SoilMTSDRERQTSNLKTALVLASIAVVFFLGIMLKYVLLR
Ga0335084_1000355133300033004SoilVTRDQHRGNLRTALVLGSIALVFFLGIMLKYFLLK
Ga0335084_1108156623300033004SoilMGNHAQRANFWTGLVLASIALVFFLGIMLKYVLIK
Ga0335077_1021507653300033158SoilTGGEMTSDRERQTSNLKTALVLASIAVVFFLGIMLKYVLLR
Ga0326729_105782023300033432Peat SoilVTRAQQRDNVRTALVLGSIALVFFLGIVLKYIILK
Ga0326726_1000850093300033433Peat SoilVTRAQQRDNVRTALVLGSIALVFFLGIVLKYFILK
Ga0326726_1004463723300033433Peat SoilVTREQQRDNLRTALVLGSIALVFFLGIMLKYFILK
Ga0314869_018534_226_3333300033759PeatlandVTREQQRDNLRTAAVLGSIALVFFLGIMLKYFLLK
Ga0314862_0060063_406_5133300033803PeatlandMREQQHRDNLRTALVLGSIALAFFLGIMLKYFMLK
Ga0314863_028036_295_4053300033804PeatlandVTREQQQRDNLRTALVLGSIALVFFLGIMLKYFILK
Ga0314871_002562_4_1113300033809PeatlandVTREHQRDNLRTALVLGSIALVFFLGIMLKYLLLK
Ga0314872_014615_447_5573300033810PeatlandVTPQRDQRSNLRTALVLGSIALAFFVGIMIKYVMLK
Ga0364924_089021_484_5973300033811SedimentMTLDRGHRTNNRVTALVLASIALVFFVGIMLKYVLIK
Ga0364930_0049840_1001_11083300033814SedimentMTPEKRTSIRRTALVLASIALAFFFGTMLRYVLIR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.