Basic Information | |
---|---|
Family ID | F012904 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 276 |
Average Sequence Length | 37 residues |
Representative Sequence | MTPEREQRRNNRRTALVLGSIALAFFVGIMLKYVMLK |
Number of Associated Samples | 186 |
Number of Associated Scaffolds | 276 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 90.58 % |
% of genes near scaffold ends (potentially truncated) | 10.87 % |
% of genes from short scaffolds (< 2000 bps) | 76.45 % |
Associated GOLD sequencing projects | 172 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.45 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (92.029 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (34.420 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.841 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (36.594 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.77% β-sheet: 0.00% Coil/Unstructured: 49.23% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 276 Family Scaffolds |
---|---|---|
PF04442 | CtaG_Cox11 | 39.13 |
PF00115 | COX1 | 37.68 |
PF11174 | DUF2970 | 5.80 |
PF00510 | COX3 | 5.80 |
PF11137 | DUF2909 | 2.54 |
PF08241 | Methyltransf_11 | 1.45 |
PF02104 | SURF1 | 1.09 |
PF07479 | NAD_Gly3P_dh_C | 1.09 |
PF13442 | Cytochrome_CBB3 | 1.09 |
PF13432 | TPR_16 | 0.36 |
PF10003 | DUF2244 | 0.36 |
PF02630 | SCO1-SenC | 0.36 |
PF12762 | DDE_Tnp_IS1595 | 0.36 |
PF00950 | ABC-3 | 0.36 |
PF06969 | HemN_C | 0.36 |
PF00156 | Pribosyltran | 0.36 |
PF01467 | CTP_transf_like | 0.36 |
COG ID | Name | Functional Category | % Frequency in 276 Family Scaffolds |
---|---|---|---|
COG3175 | Cytochrome c oxidase assembly protein Cox11 | Posttranslational modification, protein turnover, chaperones [O] | 39.13 |
COG1845 | Heme/copper-type cytochrome/quinol oxidase, subunit 3 | Energy production and conversion [C] | 5.80 |
COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.09 |
COG3346 | Cytochrome oxidase assembly protein ShyY1 | Posttranslational modification, protein turnover, chaperones [O] | 1.09 |
COG0609 | ABC-type Fe3+-siderophore transport system, permease component | Inorganic ion transport and metabolism [P] | 0.36 |
COG0635 | Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductase | Coenzyme transport and metabolism [H] | 0.36 |
COG1108 | ABC-type Mn2+/Zn2+ transport system, permease component | Inorganic ion transport and metabolism [P] | 0.36 |
COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 0.36 |
COG4606 | ABC-type enterochelin transport system, permease component | Inorganic ion transport and metabolism [P] | 0.36 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.01 % |
Unclassified | root | N/A | 3.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2032320006|FACEOR_FYWIORV02GB111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 515 | Open in IMG/M |
3300002558|JGI25385J37094_10157811 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 608 | Open in IMG/M |
3300005174|Ga0066680_10132037 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1552 | Open in IMG/M |
3300005181|Ga0066678_10394916 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 917 | Open in IMG/M |
3300005447|Ga0066689_11030583 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 506 | Open in IMG/M |
3300005526|Ga0073909_10000275 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 18060 | Open in IMG/M |
3300005526|Ga0073909_10574079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 554 | Open in IMG/M |
3300005540|Ga0066697_10260795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 1026 | Open in IMG/M |
3300005542|Ga0070732_10000792 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 18342 | Open in IMG/M |
3300005552|Ga0066701_10011700 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 4045 | Open in IMG/M |
3300005552|Ga0066701_10729774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 594 | Open in IMG/M |
3300005555|Ga0066692_10899835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 542 | Open in IMG/M |
3300005558|Ga0066698_10430863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 903 | Open in IMG/M |
3300005560|Ga0066670_10014763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3467 | Open in IMG/M |
3300005568|Ga0066703_10228742 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1130 | Open in IMG/M |
3300005576|Ga0066708_10563430 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 733 | Open in IMG/M |
3300005713|Ga0066905_100806014 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 815 | Open in IMG/M |
3300005764|Ga0066903_100566067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1955 | Open in IMG/M |
3300005764|Ga0066903_103985167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 792 | Open in IMG/M |
3300005764|Ga0066903_104320056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 759 | Open in IMG/M |
3300005829|Ga0074479_10457997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 609 | Open in IMG/M |
3300005829|Ga0074479_10696890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3799 | Open in IMG/M |
3300005829|Ga0074479_11152839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 799 | Open in IMG/M |
3300005830|Ga0074473_10732025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales | 2013 | Open in IMG/M |
3300005833|Ga0074472_10210507 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 4286 | Open in IMG/M |
3300005836|Ga0074470_10266397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4870 | Open in IMG/M |
3300005875|Ga0075293_1004384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 1398 | Open in IMG/M |
3300006031|Ga0066651_10347656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 795 | Open in IMG/M |
3300006032|Ga0066696_10073838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1983 | Open in IMG/M |
3300006034|Ga0066656_10136417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1523 | Open in IMG/M |
3300006034|Ga0066656_10877122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 575 | Open in IMG/M |
3300006050|Ga0075028_100104406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1450 | Open in IMG/M |
3300006050|Ga0075028_100670282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 622 | Open in IMG/M |
3300006173|Ga0070716_100009457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 4860 | Open in IMG/M |
3300006173|Ga0070716_100222991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1268 | Open in IMG/M |
3300006755|Ga0079222_10031622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2266 | Open in IMG/M |
3300006755|Ga0079222_11487942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 633 | Open in IMG/M |
3300006796|Ga0066665_11068852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 616 | Open in IMG/M |
3300006797|Ga0066659_10169081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1572 | Open in IMG/M |
3300006852|Ga0075433_10206204 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1748 | Open in IMG/M |
3300006903|Ga0075426_10094926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2137 | Open in IMG/M |
3300006903|Ga0075426_10407282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1004 | Open in IMG/M |
3300007255|Ga0099791_10137348 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1138 | Open in IMG/M |
3300007255|Ga0099791_10298542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 768 | Open in IMG/M |
3300007255|Ga0099791_10449479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
3300007258|Ga0099793_10463169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 628 | Open in IMG/M |
3300007265|Ga0099794_10318186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 807 | Open in IMG/M |
3300007265|Ga0099794_10423681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 696 | Open in IMG/M |
3300007265|Ga0099794_10483830 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
3300007788|Ga0099795_10011555 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2644 | Open in IMG/M |
3300007788|Ga0099795_10328646 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 679 | Open in IMG/M |
3300009038|Ga0099829_10103770 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2216 | Open in IMG/M |
3300009038|Ga0099829_10295594 | Not Available | 1327 | Open in IMG/M |
3300009038|Ga0099829_10629130 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 892 | Open in IMG/M |
3300009038|Ga0099829_10767843 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 801 | Open in IMG/M |
3300009088|Ga0099830_10355721 | Not Available | 1178 | Open in IMG/M |
3300009089|Ga0099828_11864305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 528 | Open in IMG/M |
3300009090|Ga0099827_10407972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1162 | Open in IMG/M |
3300009090|Ga0099827_10502807 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1041 | Open in IMG/M |
3300009090|Ga0099827_10703937 | Not Available | 873 | Open in IMG/M |
3300009090|Ga0099827_11283198 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 637 | Open in IMG/M |
3300009090|Ga0099827_11405345 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 607 | Open in IMG/M |
3300009090|Ga0099827_11558154 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300009137|Ga0066709_100908641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1284 | Open in IMG/M |
3300009597|Ga0105259_1079885 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 757 | Open in IMG/M |
3300009678|Ga0105252_10000039 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 117511 | Open in IMG/M |
3300010046|Ga0126384_12007711 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 553 | Open in IMG/M |
3300010047|Ga0126382_11219857 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300010047|Ga0126382_11637680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 598 | Open in IMG/M |
3300010159|Ga0099796_10036136 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1643 | Open in IMG/M |
3300010301|Ga0134070_10430300 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 525 | Open in IMG/M |
3300010301|Ga0134070_10468232 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 507 | Open in IMG/M |
3300010323|Ga0134086_10250821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 674 | Open in IMG/M |
3300010325|Ga0134064_10396803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 550 | Open in IMG/M |
3300010358|Ga0126370_10403275 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1124 | Open in IMG/M |
3300010358|Ga0126370_12180561 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
3300010359|Ga0126376_10108227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2137 | Open in IMG/M |
3300010359|Ga0126376_10242900 | Not Available | 1526 | Open in IMG/M |
3300010359|Ga0126376_10298929 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1399 | Open in IMG/M |
3300010359|Ga0126376_11285345 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
3300010359|Ga0126376_12446153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 569 | Open in IMG/M |
3300010361|Ga0126378_11069072 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 909 | Open in IMG/M |
3300010361|Ga0126378_13460171 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 501 | Open in IMG/M |
3300010362|Ga0126377_10876208 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 960 | Open in IMG/M |
3300010362|Ga0126377_11085512 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 869 | Open in IMG/M |
3300010366|Ga0126379_11771558 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 722 | Open in IMG/M |
3300010366|Ga0126379_12086927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 669 | Open in IMG/M |
3300010376|Ga0126381_102843799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 690 | Open in IMG/M |
3300010398|Ga0126383_10124248 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2358 | Open in IMG/M |
3300011269|Ga0137392_10184378 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1701 | Open in IMG/M |
3300011270|Ga0137391_11168299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 617 | Open in IMG/M |
3300011410|Ga0137440_1040343 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 872 | Open in IMG/M |
3300011430|Ga0137423_1080078 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 970 | Open in IMG/M |
3300011433|Ga0137443_1006577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 2684 | Open in IMG/M |
3300011438|Ga0137451_1026776 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1668 | Open in IMG/M |
3300011441|Ga0137452_1009055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 3030 | Open in IMG/M |
3300011442|Ga0137437_1003828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 5330 | Open in IMG/M |
3300011442|Ga0137437_1209662 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 676 | Open in IMG/M |
3300011444|Ga0137463_1000114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 31657 | Open in IMG/M |
3300011444|Ga0137463_1001760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 7174 | Open in IMG/M |
3300011444|Ga0137463_1118282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 997 | Open in IMG/M |
3300012096|Ga0137389_10994090 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 719 | Open in IMG/M |
3300012189|Ga0137388_10404744 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1264 | Open in IMG/M |
3300012189|Ga0137388_10870658 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 834 | Open in IMG/M |
3300012198|Ga0137364_10310020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1173 | Open in IMG/M |
3300012199|Ga0137383_10292528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1193 | Open in IMG/M |
3300012199|Ga0137383_10848668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 667 | Open in IMG/M |
3300012200|Ga0137382_10018000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3981 | Open in IMG/M |
3300012201|Ga0137365_10622186 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 791 | Open in IMG/M |
3300012201|Ga0137365_11093901 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 574 | Open in IMG/M |
3300012202|Ga0137363_10502926 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1018 | Open in IMG/M |
3300012202|Ga0137363_11822858 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
3300012203|Ga0137399_10270205 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
3300012203|Ga0137399_10519243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 999 | Open in IMG/M |
3300012203|Ga0137399_10883871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 752 | Open in IMG/M |
3300012203|Ga0137399_11123703 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 661 | Open in IMG/M |
3300012204|Ga0137374_10064794 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3642 | Open in IMG/M |
3300012204|Ga0137374_10211333 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1661 | Open in IMG/M |
3300012206|Ga0137380_10056503 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3595 | Open in IMG/M |
3300012206|Ga0137380_10326191 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1372 | Open in IMG/M |
3300012206|Ga0137380_11622360 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300012207|Ga0137381_10669383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 903 | Open in IMG/M |
3300012207|Ga0137381_10877994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 776 | Open in IMG/M |
3300012207|Ga0137381_11099923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 684 | Open in IMG/M |
3300012207|Ga0137381_11408317 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 589 | Open in IMG/M |
3300012211|Ga0137377_11445397 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 615 | Open in IMG/M |
3300012285|Ga0137370_10012190 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 4139 | Open in IMG/M |
3300012285|Ga0137370_10079272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 1818 | Open in IMG/M |
3300012285|Ga0137370_10911984 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 543 | Open in IMG/M |
3300012349|Ga0137387_10059680 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2570 | Open in IMG/M |
3300012353|Ga0137367_10491721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 865 | Open in IMG/M |
3300012355|Ga0137369_10643630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 733 | Open in IMG/M |
3300012356|Ga0137371_10024763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 4621 | Open in IMG/M |
3300012357|Ga0137384_10173785 | Not Available | 1803 | Open in IMG/M |
3300012357|Ga0137384_10429846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1088 | Open in IMG/M |
3300012361|Ga0137360_10699873 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 870 | Open in IMG/M |
3300012532|Ga0137373_10315338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1238 | Open in IMG/M |
3300012683|Ga0137398_10047681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2523 | Open in IMG/M |
3300012685|Ga0137397_10001900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 14577 | Open in IMG/M |
3300012685|Ga0137397_10035652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 3554 | Open in IMG/M |
3300012685|Ga0137397_10198773 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1491 | Open in IMG/M |
3300012685|Ga0137397_11149395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 562 | Open in IMG/M |
3300012922|Ga0137394_10432524 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1121 | Open in IMG/M |
3300012922|Ga0137394_10624972 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 910 | Open in IMG/M |
3300012925|Ga0137419_10594587 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 888 | Open in IMG/M |
3300012925|Ga0137419_10664409 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 842 | Open in IMG/M |
3300012925|Ga0137419_11210047 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 633 | Open in IMG/M |
3300012931|Ga0153915_11299243 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 850 | Open in IMG/M |
3300012944|Ga0137410_10000615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 24756 | Open in IMG/M |
3300012944|Ga0137410_11077324 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 687 | Open in IMG/M |
3300012944|Ga0137410_11310029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 627 | Open in IMG/M |
3300012944|Ga0137410_11327301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 623 | Open in IMG/M |
3300012948|Ga0126375_11748662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 541 | Open in IMG/M |
3300012971|Ga0126369_10537192 | All Organisms → cellular organisms → Bacteria | 1232 | Open in IMG/M |
3300012971|Ga0126369_11187819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 853 | Open in IMG/M |
3300012972|Ga0134077_10311642 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 663 | Open in IMG/M |
3300014150|Ga0134081_10224681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 647 | Open in IMG/M |
3300014262|Ga0075301_1007760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1598 | Open in IMG/M |
3300014308|Ga0075354_1004527 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae → Nitrosospira | 1792 | Open in IMG/M |
3300014321|Ga0075353_1006580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1782 | Open in IMG/M |
3300014321|Ga0075353_1033165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1004 | Open in IMG/M |
3300015052|Ga0137411_1221217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2511 | Open in IMG/M |
3300015054|Ga0137420_1445557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 996 | Open in IMG/M |
3300015242|Ga0137412_10006904 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9106 | Open in IMG/M |
3300015242|Ga0137412_10393023 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1074 | Open in IMG/M |
3300015245|Ga0137409_10007249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 11413 | Open in IMG/M |
3300015245|Ga0137409_10010245 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9479 | Open in IMG/M |
3300017654|Ga0134069_1331539 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
3300017657|Ga0134074_1080683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1110 | Open in IMG/M |
3300017659|Ga0134083_10214803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 797 | Open in IMG/M |
3300017939|Ga0187775_10022848 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1728 | Open in IMG/M |
3300017944|Ga0187786_10125389 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 898 | Open in IMG/M |
3300017959|Ga0187779_10205195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1234 | Open in IMG/M |
3300017974|Ga0187777_11333019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 528 | Open in IMG/M |
3300017997|Ga0184610_1048372 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1250 | Open in IMG/M |
3300018000|Ga0184604_10063681 | Not Available | 1057 | Open in IMG/M |
3300018031|Ga0184634_10187645 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 938 | Open in IMG/M |
3300018056|Ga0184623_10020087 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2957 | Open in IMG/M |
3300018060|Ga0187765_10124290 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1432 | Open in IMG/M |
3300018063|Ga0184637_10013017 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 4998 | Open in IMG/M |
3300018064|Ga0187773_10005528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 5183 | Open in IMG/M |
3300018071|Ga0184618_10064822 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1363 | Open in IMG/M |
3300018074|Ga0184640_10001442 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7164 | Open in IMG/M |
3300018074|Ga0184640_10315493 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 709 | Open in IMG/M |
3300018078|Ga0184612_10238670 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 940 | Open in IMG/M |
3300018082|Ga0184639_10258882 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 919 | Open in IMG/M |
3300018083|Ga0184628_10234597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 962 | Open in IMG/M |
3300018433|Ga0066667_10141423 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1681 | Open in IMG/M |
3300018433|Ga0066667_10493529 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1007 | Open in IMG/M |
3300018433|Ga0066667_10621397 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 902 | Open in IMG/M |
3300018468|Ga0066662_10147952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1770 | Open in IMG/M |
3300019245|Ga0187791_1179133 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 584 | Open in IMG/M |
3300019255|Ga0184643_1297255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 682 | Open in IMG/M |
3300019789|Ga0137408_1173201 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 2709 | Open in IMG/M |
3300019872|Ga0193754_1002903 | All Organisms → cellular organisms → Bacteria | 1587 | Open in IMG/M |
3300019880|Ga0193712_1087367 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 677 | Open in IMG/M |
3300019883|Ga0193725_1032119 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1397 | Open in IMG/M |
3300019997|Ga0193711_1009647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1217 | Open in IMG/M |
3300020010|Ga0193749_1028488 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1086 | Open in IMG/M |
3300020021|Ga0193726_1002000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 14511 | Open in IMG/M |
3300020170|Ga0179594_10001871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 4811 | Open in IMG/M |
3300020170|Ga0179594_10054896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1353 | Open in IMG/M |
3300020170|Ga0179594_10091803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1082 | Open in IMG/M |
3300021086|Ga0179596_10025601 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2206 | Open in IMG/M |
3300021086|Ga0179596_10219669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 930 | Open in IMG/M |
3300021560|Ga0126371_11106779 | Not Available | 931 | Open in IMG/M |
3300025922|Ga0207646_10424605 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1200 | Open in IMG/M |
3300025954|Ga0210135_1002892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1373 | Open in IMG/M |
3300025979|Ga0210078_1002246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Thermomicrobia → Thermomicrobiales → environmental samples → uncultured Thermomicrobiales bacterium | 2059 | Open in IMG/M |
3300025985|Ga0210117_1035011 | Not Available | 792 | Open in IMG/M |
3300026277|Ga0209350_1002294 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7554 | Open in IMG/M |
3300026285|Ga0209438_1085588 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 998 | Open in IMG/M |
3300026295|Ga0209234_1122568 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 956 | Open in IMG/M |
3300026296|Ga0209235_1141756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 974 | Open in IMG/M |
3300026297|Ga0209237_1129965 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1035 | Open in IMG/M |
3300026298|Ga0209236_1028511 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3015 | Open in IMG/M |
3300026298|Ga0209236_1074446 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1594 | Open in IMG/M |
3300026316|Ga0209155_1119954 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 917 | Open in IMG/M |
3300026320|Ga0209131_1410380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300026334|Ga0209377_1315007 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 523 | Open in IMG/M |
3300026340|Ga0257162_1039443 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 590 | Open in IMG/M |
3300026529|Ga0209806_1057422 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1801 | Open in IMG/M |
3300026538|Ga0209056_10059762 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3343 | Open in IMG/M |
3300026548|Ga0209161_10012834 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6239 | Open in IMG/M |
3300026557|Ga0179587_10989460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 554 | Open in IMG/M |
3300026557|Ga0179587_11018821 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
3300027388|Ga0208995_1044625 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
3300027573|Ga0208454_1000074 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 70190 | Open in IMG/M |
3300027633|Ga0208988_1009519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2420 | Open in IMG/M |
3300027671|Ga0209588_1064727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1182 | Open in IMG/M |
3300027821|Ga0209811_10000399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 18688 | Open in IMG/M |
3300027842|Ga0209580_10002615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 7741 | Open in IMG/M |
3300027846|Ga0209180_10275984 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 965 | Open in IMG/M |
3300027846|Ga0209180_10715510 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Tylenchina → Panagrolaimomorpha → Strongyloidoidea → Steinernematidae → Steinernema → Steinernema glaseri | 543 | Open in IMG/M |
3300027875|Ga0209283_10370530 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 937 | Open in IMG/M |
3300027882|Ga0209590_10259683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1110 | Open in IMG/M |
3300027882|Ga0209590_10624272 | All Organisms → cellular organisms → Eukaryota | 693 | Open in IMG/M |
3300027882|Ga0209590_10972393 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 531 | Open in IMG/M |
3300028792|Ga0307504_10057708 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1129 | Open in IMG/M |
3300028802|Ga0307503_10158943 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1033 | Open in IMG/M |
3300031152|Ga0307501_10001732 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 2510 | Open in IMG/M |
3300031170|Ga0307498_10153125 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 767 | Open in IMG/M |
3300031199|Ga0307495_10024927 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 1048 | Open in IMG/M |
3300031199|Ga0307495_10170678 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 577 | Open in IMG/M |
3300031199|Ga0307495_10239026 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 517 | Open in IMG/M |
3300031226|Ga0307497_10004327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 3730 | Open in IMG/M |
3300031679|Ga0318561_10212529 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1050 | Open in IMG/M |
3300031720|Ga0307469_10000003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 313784 | Open in IMG/M |
3300031720|Ga0307469_10008196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 4920 | Open in IMG/M |
3300031720|Ga0307469_10013586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 4131 | Open in IMG/M |
3300031720|Ga0307469_10020092 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3606 | Open in IMG/M |
3300031720|Ga0307469_10119369 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 1903 | Open in IMG/M |
3300031740|Ga0307468_100290765 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1179 | Open in IMG/M |
3300031820|Ga0307473_10017441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2831 | Open in IMG/M |
3300031820|Ga0307473_10102654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1526 | Open in IMG/M |
3300031820|Ga0307473_10566299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 778 | Open in IMG/M |
3300032180|Ga0307471_100009956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 6334 | Open in IMG/M |
3300032180|Ga0307471_100270528 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1766 | Open in IMG/M |
3300032180|Ga0307471_100333747 | Not Available | 1619 | Open in IMG/M |
3300032180|Ga0307471_103655536 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 544 | Open in IMG/M |
3300032205|Ga0307472_100626113 | Not Available | 954 | Open in IMG/M |
3300032770|Ga0335085_10003524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 26964 | Open in IMG/M |
3300032783|Ga0335079_10306496 | All Organisms → cellular organisms → Bacteria | 1732 | Open in IMG/M |
3300033004|Ga0335084_10003551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 15221 | Open in IMG/M |
3300033004|Ga0335084_11081566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 805 | Open in IMG/M |
3300033158|Ga0335077_10215076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2151 | Open in IMG/M |
3300033432|Ga0326729_1057820 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 595 | Open in IMG/M |
3300033433|Ga0326726_10008500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 9117 | Open in IMG/M |
3300033433|Ga0326726_10044637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales | 3875 | Open in IMG/M |
3300033759|Ga0314869_018534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 518 | Open in IMG/M |
3300033803|Ga0314862_0060063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Nitrosomonadaceae | 834 | Open in IMG/M |
3300033804|Ga0314863_028036 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1139 | Open in IMG/M |
3300033809|Ga0314871_002562 | Not Available | 1058 | Open in IMG/M |
3300033810|Ga0314872_014615 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300033811|Ga0364924_089021 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → asterids → campanulids → Asterales → Asteraceae → Asteroideae → Anthemideae → Anthemidinae → Tanacetum → Tanacetum cinerariifolium | 692 | Open in IMG/M |
3300033814|Ga0364930_0049840 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 1423 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 34.42% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.61% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 5.07% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 5.07% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.07% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 4.71% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.99% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.26% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.17% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 2.17% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.17% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.81% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.81% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.45% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.45% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.09% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.09% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.09% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.09% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.72% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.72% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.72% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.72% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.72% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.36% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.36% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.36% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.36% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2032320006 | Soil microbial communities from sample at FACE Site 5 Oak Ridge CO2+ | Environmental | Open in IMG/M |
3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
3300005875 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_0N_101 | Environmental | Open in IMG/M |
3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009597 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT299 | Environmental | Open in IMG/M |
3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
3300011430 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT600_2 | Environmental | Open in IMG/M |
3300011433 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT300_2 | Environmental | Open in IMG/M |
3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
3300011441 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT513_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300014262 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D1 | Environmental | Open in IMG/M |
3300014308 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleC_D1 | Environmental | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300015052 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019245 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019255 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300019872 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a1 | Environmental | Open in IMG/M |
3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
3300020010 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025954 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300025979 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025985 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026277 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
3300027388 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027573 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 (SPAdes) | Environmental | Open in IMG/M |
3300027633 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033759 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_B | Environmental | Open in IMG/M |
3300033803 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_10 | Environmental | Open in IMG/M |
3300033804 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_0_20 | Environmental | Open in IMG/M |
3300033809 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_D | Environmental | Open in IMG/M |
3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
FACEORE_2154040 | 2032320006 | Soil | VTPERNRDNLKTALVLGSIALVFFVGIMLKYVILK |
JGI25385J37094_101578112 | 3300002558 | Grasslands Soil | SRAAGGEMTGNRTQRTNNRRTALVLASIAFAFFLGIILKYVLLK* |
Ga0066680_101320371 | 3300005174 | Soil | AAGGEMTGNRTQRTNNRRTALVLASIAFAFFLGIILKYVLLK* |
Ga0066678_103949163 | 3300005181 | Soil | MTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVIMLK* |
Ga0066689_110305831 | 3300005447 | Soil | RATGAGMTPERLQRRSNRRTALVLGSIALVFFVAIMLKYIILK* |
Ga0073909_1000027517 | 3300005526 | Surface Soil | VTPGRGQQHNLRTALVLGSIALVFFLGIMLKYFILR* |
Ga0073909_105740792 | 3300005526 | Surface Soil | MTSGGEQRQNNRRTAWVLASIALAFFIGIMLKYVMLK* |
Ga0066697_102607952 | 3300005540 | Soil | MTPELEQRRSNRRTAWVLGSIALAFFLGIMLKYVMLK* |
Ga0070732_100007928 | 3300005542 | Surface Soil | MTATRDPRPANRRTALVLASIALAFFFGIMLKYILTR* |
Ga0066701_100117008 | 3300005552 | Soil | MTPEREQRRSNRRTAWVLGSIALAFFLGIMLKYVMLK* |
Ga0066701_107297741 | 3300005552 | Soil | MTPERDQRRNNRWTALVLGSIALAFFVGIMLKYVMLK* |
Ga0066692_108998352 | 3300005555 | Soil | MTGNRTQRTNNRRTALVLASIAFAFFLGIILKYVLLK* |
Ga0066698_104308632 | 3300005558 | Soil | MTGNRTQRMNNRRTALVLASIAFAFFLGIMLKYVLLK* |
Ga0066670_100147633 | 3300005560 | Soil | MTPELLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK* |
Ga0066703_102287423 | 3300005568 | Soil | MTPERLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK* |
Ga0066708_105634301 | 3300005576 | Soil | MTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVI |
Ga0066905_1008060142 | 3300005713 | Tropical Forest Soil | MTPARDQRSKLRTALVLGSVALAFFIGIMLKYIMLR* |
Ga0066903_1005660672 | 3300005764 | Tropical Forest Soil | MRSEQRRDNLRTALVLGSIAFVFFIGIMLKYVILK* |
Ga0066903_1039851672 | 3300005764 | Tropical Forest Soil | VTPQREQRPNLRTALVLGSIALAFFVGIMLKYVLLK* |
Ga0066903_1043200562 | 3300005764 | Tropical Forest Soil | VSPERQQRNNLRTALVLGSIALAFFIGIMLKYLVLK* |
Ga0074479_104579972 | 3300005829 | Sediment (Intertidal) | MREQQRDNLRTALVLGSIALVFFAGIVLKYFVLK* |
Ga0074479_106968905 | 3300005829 | Sediment (Intertidal) | VTREQQRDNLRTALVLGSIALVFFVGIVLKYFVLK* |
Ga0074479_111528392 | 3300005829 | Sediment (Intertidal) | MTPEREQRRNNRRTAWVLGSIALVFFLGTMVKYVMLK* |
Ga0074473_107320254 | 3300005830 | Sediment (Intertidal) | MNPQRTGNLRTALLLASIALVFFVGIMLKYLFLR* |
Ga0074472_102105073 | 3300005833 | Sediment (Intertidal) | MTDHGHSASNRRTALVLASIALVFFVGIMLKYVLLK* |
Ga0074470_102663972 | 3300005836 | Sediment (Intertidal) | VTSWRSTNLRTALVLGSIALVFFLGIMLKYLFLR* |
Ga0075293_10043842 | 3300005875 | Rice Paddy Soil | MLDRPQRINRRTALVLASVALAFFFGIMLKYVLLK* |
Ga0066651_103476562 | 3300006031 | Soil | MTPEREQRRSNRMTALVLGSIALVFFVAIMLKYAMLK* |
Ga0066696_100738385 | 3300006032 | Soil | PERLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK* |
Ga0066656_101364174 | 3300006034 | Soil | MTPEREQRRNNRWTALVLGSIALAFFVGIMLKYVMLK* |
Ga0066656_108771222 | 3300006034 | Soil | MTPEREQRRSNRMTALVLASIALVFFVAIMLKYAMLK* |
Ga0075028_1001044062 | 3300006050 | Watersheds | VTPDNGQRANIRRTAWVLGSIALAFFLGIVLKYVLLK* |
Ga0075028_1006702822 | 3300006050 | Watersheds | MPDSGQRANIRRTAWVLGSIALAFFLGIMLKYVLLK* |
Ga0070716_1000094574 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MMPGREQRRSNRMTALVLGSIALAFFVAIMLKYIMLK* |
Ga0070716_1002229912 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPEREQRRSNLRTALLLGSIALAFFVGIMLKYVMLK* |
Ga0079222_100316222 | 3300006755 | Agricultural Soil | MTPDRDQRQNNLRTAIVLGSIALAFFFGIMLKYVMLK* |
Ga0079222_114879422 | 3300006755 | Agricultural Soil | VTPEREQRNKLRTALVLGSIALAFFFGIMLKYIVL |
Ga0066665_110688522 | 3300006796 | Soil | MTPERLQRRSNRRTALVLGSIALVFFVAIMLKYIILK* |
Ga0066659_101690812 | 3300006797 | Soil | MTPEREQRRNNRWTALVLGSIALAFFVGVVLKYWLLK* |
Ga0075433_102062042 | 3300006852 | Populus Rhizosphere | MTPEREQRRNNRRTALLLGSIALVFFVAIMLKYVMLK* |
Ga0075426_100949262 | 3300006903 | Populus Rhizosphere | MTPEREQRRSNRRTALVLGSIALAFFVAIMLKYAMLK* |
Ga0075426_104072822 | 3300006903 | Populus Rhizosphere | MTPEREQRRNNHRTALVLGSIALAFFVAIMLKYAMLK* |
Ga0099791_101373482 | 3300007255 | Vadose Zone Soil | MTPGRERQRSNRRTALVLGSIALVFFVAIMLKYVMLK* |
Ga0099791_102985422 | 3300007255 | Vadose Zone Soil | MTPEQRTNIRRTALVLASIALAFFFGIMLKYVLVK* |
Ga0099791_104494792 | 3300007255 | Vadose Zone Soil | MTPERERRRNNRRTAWVLGSIALAFFLGIMLKYVMLK* |
Ga0099793_104631692 | 3300007258 | Vadose Zone Soil | MTPEQRTNIRRTALVLASIALAFFFGIMLKYALLK* |
Ga0099794_103181862 | 3300007265 | Vadose Zone Soil | MTPGREQQRSNRRTALVLGSIALVFFVAIMLKYVMLK* |
Ga0099794_104236812 | 3300007265 | Vadose Zone Soil | MTPEREQRRNNRRTAWVLGSIALVFFVGIMLKYVMLK* |
Ga0099794_104838302 | 3300007265 | Vadose Zone Soil | MTGNRTQRTNNRRTALVLASIAFAFFLGIMLKYVLLK* |
Ga0099795_100115552 | 3300007788 | Vadose Zone Soil | MTPEQRTNIRRTALMLASIALAFFFGIILKYVLLK* |
Ga0099795_103286462 | 3300007788 | Vadose Zone Soil | MTPERLQRRSNRRTALVLGSIALAFFVAIMLKYVMLK* |
Ga0099829_101037705 | 3300009038 | Vadose Zone Soil | MTPEQRTGIRRTALVLASIALAFFFGIMLKYALLK* |
Ga0099829_102955942 | 3300009038 | Vadose Zone Soil | MTPERRTGIRRTALVLASVALAFFFGIMLKYVLLK* |
Ga0099829_106291302 | 3300009038 | Vadose Zone Soil | MTPEREQRRNNRRTALVLGSIALVFFVAIMLKYVMLK* |
Ga0099829_107678432 | 3300009038 | Vadose Zone Soil | MTPEREQRRNNRRTALVLGSIALAFFVGIMLKYVMLK* |
Ga0099830_103557211 | 3300009088 | Vadose Zone Soil | MTPRQRTNIRRTALVLASIALAFFFGIMLKYVLIR |
Ga0099828_118643052 | 3300009089 | Vadose Zone Soil | VTPEQRTGIRRTAIVLASIALAFFFGIMLKYVVLK* |
Ga0099827_104079722 | 3300009090 | Vadose Zone Soil | MTPERRTGIRRTALVLASIALAFFFGIMLKYVLLK* |
Ga0099827_105028072 | 3300009090 | Vadose Zone Soil | MTPEREQRRNNRRTAWVLGSIALFFFLGIMLKYVMLK* |
Ga0099827_107039371 | 3300009090 | Vadose Zone Soil | MTPERERRRNNRRTAWMLGSIALAFFLGIMLKYVMLK* |
Ga0099827_112831981 | 3300009090 | Vadose Zone Soil | MTQERARRASNRRTALVLASIAAAFFLGIMLKYVLLK* |
Ga0099827_114053452 | 3300009090 | Vadose Zone Soil | MTPERERRRNNRWTALVLGSIALVFFLGIMLKYVMLK* |
Ga0099827_115581542 | 3300009090 | Vadose Zone Soil | MTPEREQRRNNRWTALVLGSIALVFFVAIMLKYVMLK* |
Ga0066709_1009086414 | 3300009137 | Grasslands Soil | MTPEQRTNIRRTALVLASIALAFFIVIMLTYVLVK* |
Ga0105259_10798851 | 3300009597 | Soil | EMMLDHGHRTNNRVTALVLASIALVFFVAIMLKYVLLK* |
Ga0105252_1000003940 | 3300009678 | Soil | MMLDRGHRTHNRVTALVLASIALVFFVGIMLKYVLLK* |
Ga0126384_120077111 | 3300010046 | Tropical Forest Soil | MRSEQRRDNLRTALVLGSIALAFFVGIMLKYVILK* |
Ga0126382_112198572 | 3300010047 | Tropical Forest Soil | MREQRQSNLRTALVLGSIALAFFVGVMLKYVILK* |
Ga0126382_116376802 | 3300010047 | Tropical Forest Soil | VISEQRRGNLKTALVLGSIALVFFVGIMLKYIILR* |
Ga0099796_100361364 | 3300010159 | Vadose Zone Soil | MTPEQRTNIRRTALMLASIALAFFFGIMLKYVLVK* |
Ga0134070_104303001 | 3300010301 | Grasslands Soil | MTPEREQRRNNRWTALALGSIALAFFVGIMLKYVMLK* |
Ga0134070_104682321 | 3300010301 | Grasslands Soil | TGGEMTPEREQRRRNNRRTAWWLGSIALVFFLGIMLKYVMIK* |
Ga0134086_102508211 | 3300010323 | Grasslands Soil | EREQRRNNRWTALVLGSIALAFFVGIMLKYVMLK* |
Ga0134064_103968032 | 3300010325 | Grasslands Soil | MTPERRQWRSNRRTALVLGSIALAFFVAIMLKYAMLK* |
Ga0126370_104032752 | 3300010358 | Tropical Forest Soil | VSPERQQRNNLRTALVLGSIALAFFIGIMLKYLALK* |
Ga0126370_121805612 | 3300010358 | Tropical Forest Soil | VTQEREQQHNLRTALVLGSIALAFFVGVMLKYLLLK* |
Ga0126376_101082271 | 3300010359 | Tropical Forest Soil | RAAGGEVTPERQRDNLKTALVLGSIALVFFIGIMLKYVILK* |
Ga0126376_102429003 | 3300010359 | Tropical Forest Soil | VTSGRQRDNLRTALVLGSIALAFFIGIMLKYVVLK* |
Ga0126376_102989294 | 3300010359 | Tropical Forest Soil | VTQERHRDNLKTALVLGSIALVFFFGIMLKYVILK* |
Ga0126376_112853451 | 3300010359 | Tropical Forest Soil | AGGEMRSEQRRDNLRTALVLGSIAFVFFIGIMLKYVILK* |
Ga0126376_124461531 | 3300010359 | Tropical Forest Soil | VTQEREQRHKLRTALVLGSIALAFFFGIMLKYVMLK* |
Ga0126378_110690722 | 3300010361 | Tropical Forest Soil | VTQERHRDNLKTALVLGSIALVFFLGIMLKYVLLR* |
Ga0126378_134601712 | 3300010361 | Tropical Forest Soil | VTPQRHRDNLKTALVLGSIALVFFLGIMLKYVLLK* |
Ga0126377_108762082 | 3300010362 | Tropical Forest Soil | VTQEREQRHNLRTALVLGSIALAFFFGIMLKYVMLK* |
Ga0126377_110855122 | 3300010362 | Tropical Forest Soil | VTPERQRDNLKTALVLGSIALVFFIGIMLKYVILK* |
Ga0126379_117715581 | 3300010366 | Tropical Forest Soil | VSTERQQRNNLRTALVLGSIALAFFIGIMLKYLVLK* |
Ga0126379_120869272 | 3300010366 | Tropical Forest Soil | MPQREQRPNLRTALVLGSIALAFFVGIMLKYVLLK* |
Ga0126381_1028437992 | 3300010376 | Tropical Forest Soil | VTQERQRDNLKTALVLGSIALVFFFGIMLKYVLLK* |
Ga0126383_101242484 | 3300010398 | Tropical Forest Soil | VTPGRQRDNLKTALVLGSIALVFFIGIMLKYVILK* |
Ga0137392_101843784 | 3300011269 | Vadose Zone Soil | MTPGREQRRNNRRTALLLGSIALAFFLGIMLKYVMLK* |
Ga0137391_111682992 | 3300011270 | Vadose Zone Soil | MTGNRTQRTNNRRTALVLASIALAFFLGIMLKYVLLK* |
Ga0137440_10403432 | 3300011410 | Soil | MMLDHGHRTNNRVTALVLASIALVFFVAIMLKYVLLK* |
Ga0137423_10800783 | 3300011430 | Soil | MTGNRTQRTNNRRTALVLASLAVAFFLGIMLKYVLLK* |
Ga0137443_10065772 | 3300011433 | Soil | MMLDHGHRTNNRVTALVLASIALVFFVGIMLKYVLLK* |
Ga0137451_10267764 | 3300011438 | Soil | MMFDRGHRTNNRVTALVLASIALVFFFGIMLKYVLIK* |
Ga0137452_10090554 | 3300011441 | Soil | MMFDRGHRTHNRVTALVLASIALVFFFGIMLKYVLIK* |
Ga0137437_100382810 | 3300011442 | Soil | VTRAPQRDNLRTALVLGSISLVFFVGIMLKYFLLK* |
Ga0137437_12096622 | 3300011442 | Soil | VTREQHRGNLRTALVLGSVALVFFAGIMLKYFILK* |
Ga0137463_10001144 | 3300011444 | Soil | MTPEREQRQNNRRTAWVLGSIALVFFLGIMLKYVMLK* |
Ga0137463_10017607 | 3300011444 | Soil | MTPEREQRRNNRRTAWVLGSIALAFFLGIMLKYVMLK* |
Ga0137463_11182824 | 3300011444 | Soil | MSHGAQRRGNLRTAMVLGSIALAFFVGIMLKYILLK* |
Ga0137389_109940902 | 3300012096 | Vadose Zone Soil | MTPERRTGIRRTALVLASVALAFFFGIMLKYVLIR* |
Ga0137388_104047444 | 3300012189 | Vadose Zone Soil | SRAAGGEMTGNRTQRTNNRRTALVLASIAFAFFLGIMLKYVLLK* |
Ga0137388_108706582 | 3300012189 | Vadose Zone Soil | MTPGRDQRANIRRTAWVLGSIALAFFLGIMLKYVLLK* |
Ga0137364_103100204 | 3300012198 | Vadose Zone Soil | MIPAREQRRSNRRTALVLGSIALVFFVAIMLKYAMLK* |
Ga0137383_102925284 | 3300012199 | Vadose Zone Soil | ATGGGMTPERDQRRNNRWTALVLGSIALAFFVGIMLKYVMLK* |
Ga0137383_108486682 | 3300012199 | Vadose Zone Soil | MTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMLK* |
Ga0137382_100180001 | 3300012200 | Vadose Zone Soil | MMPAREQRRSNRRTALVLGSIALVFFVAIMLKYVMLK* |
Ga0137365_106221862 | 3300012201 | Vadose Zone Soil | MTPEREQRRNNRWTALLLGSIALAFFVGIMLKYVMLK* |
Ga0137365_110939012 | 3300012201 | Vadose Zone Soil | MTPEREQRRNNRRTALALGSIARAFFVGIMLKYVMLK* |
Ga0137363_105029264 | 3300012202 | Vadose Zone Soil | MPAREQRRSNRRTALVLGSIALVFFVAIMLKYVMLK* |
Ga0137363_118228581 | 3300012202 | Vadose Zone Soil | TRAQHRDNLRTGLVLGSIALVFFVGIVLKYFILK* |
Ga0137399_102702053 | 3300012203 | Vadose Zone Soil | MTPEREQRRNNRRTALLLGSIALVFFVAVMLKYVILK* |
Ga0137399_105192432 | 3300012203 | Vadose Zone Soil | MTSEREQRRNNRWTALVLGSIALAFFLGIMLKYVMLK* |
Ga0137399_108838712 | 3300012203 | Vadose Zone Soil | MTPEREQRRSNRRTAWVLASIALAFFLGIMLKYVMLK* |
Ga0137399_111237032 | 3300012203 | Vadose Zone Soil | MMPAREQRRSNRRTALVLGSIALVFFVAIMLKYAMLK* |
Ga0137374_100647947 | 3300012204 | Vadose Zone Soil | MTPEREQRRNNRRTAWVLGSIALVFFVGIMLKYVVLK* |
Ga0137374_102113332 | 3300012204 | Vadose Zone Soil | MTPEQRTGIRRTALVLASIALAFFFGIILKYVLLK* |
Ga0137380_100565037 | 3300012206 | Vadose Zone Soil | MTSERERRRNNRRTALVLGSIALVFFLGIMLKYVMLK* |
Ga0137380_103261913 | 3300012206 | Vadose Zone Soil | MMQGRVRRASNRRTALVLASIAAAFFLGIMLKYILLK* |
Ga0137380_116223602 | 3300012206 | Vadose Zone Soil | PERELRRNNRWTALVLGSIALVFFLGIMLKYVMLK* |
Ga0137381_106693832 | 3300012207 | Vadose Zone Soil | MTPERELRRNNRRTALVLGSIALAFFLGIMLKYVMLK* |
Ga0137381_108779942 | 3300012207 | Vadose Zone Soil | MTPEREQRRNNRWTALVLCSIALVFFLGIMLKYVMLK* |
Ga0137381_110999232 | 3300012207 | Vadose Zone Soil | MTPERERRRNNRRTAWVLGSIALVFFLGIVLKYVMLK* |
Ga0137381_114083172 | 3300012207 | Vadose Zone Soil | MRPEREQRRNNRRTALVLCSIALVFFLGIMLKHVVLK* |
Ga0137377_114453972 | 3300012211 | Vadose Zone Soil | MTSEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMLK* |
Ga0137370_100121908 | 3300012285 | Vadose Zone Soil | MTPEREQRRNIRWTALVLGSIALAFFVGIMLKYVMLK* |
Ga0137370_100792722 | 3300012285 | Vadose Zone Soil | MTPERERWRNNRRTAWVLGSIALVFFLGIMLKYVMLK* |
Ga0137370_109119842 | 3300012285 | Vadose Zone Soil | MTPERLQRRSNRKTALVLGSIALAFFLAIMLKYAMLK* |
Ga0137387_100596804 | 3300012349 | Vadose Zone Soil | MTPEREQRRRNNRRTAWWLGSIALVFFLGIMLKYVMLK* |
Ga0137367_104917212 | 3300012353 | Vadose Zone Soil | MTLERRTGIRRTALVLASIALAFFFGIMLKYALLK* |
Ga0137369_106436302 | 3300012355 | Vadose Zone Soil | MTPERERRRNNRRTAWVLGSIALVFFLGIMLKYVMLK* |
Ga0137371_100247638 | 3300012356 | Vadose Zone Soil | MTPEREQRRNNRRTALALGSIALAFFVGIMLKYVMLK* |
Ga0137384_101737853 | 3300012357 | Vadose Zone Soil | MTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVM |
Ga0137384_104298464 | 3300012357 | Vadose Zone Soil | ATGGEMTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMLK* |
Ga0137360_106998734 | 3300012361 | Vadose Zone Soil | MTPEREQRRNNRRTALVLGSIALVFFLGIMLKYVMLK* |
Ga0137373_103153382 | 3300012532 | Vadose Zone Soil | MTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMIK* |
Ga0137398_100476815 | 3300012683 | Vadose Zone Soil | MTPEREQRRNNRRTALLLGSIALVFFVAVMLKYVMLK* |
Ga0137397_1000190020 | 3300012685 | Vadose Zone Soil | VTREPQRDNVRTALVLGSIALAFFVGIMLKYFILK* |
Ga0137397_100356522 | 3300012685 | Vadose Zone Soil | MSHGAQRRGNFRTALVLGSIALAFFVGIMLKYILLK* |
Ga0137397_101987732 | 3300012685 | Vadose Zone Soil | MTRAQQRDNVRTAVVLGSIALVFFLGIMLKYFVLK* |
Ga0137397_111493952 | 3300012685 | Vadose Zone Soil | MTTEREQRRNNRRTAWVLGSIALAFFLGIMLKYVMLK* |
Ga0137394_104325243 | 3300012922 | Vadose Zone Soil | MSGNRAQRTNNRRTALVLAWIAFAFFLGIVLKYVLLK* |
Ga0137394_106249722 | 3300012922 | Vadose Zone Soil | MTPEREQQRSNRRTAWVLGSIALAFFLGIMLKYVMLK* |
Ga0137419_105945873 | 3300012925 | Vadose Zone Soil | GMTPEQRTNIRRTALVLASIALAFFFGIMLKYVLVK* |
Ga0137419_106644092 | 3300012925 | Vadose Zone Soil | MTPGSEQRRNNRRTALVLGSIALVFFVAIMLKYVMLK* |
Ga0137419_112100472 | 3300012925 | Vadose Zone Soil | MTPEQRSNIRRTALMLASIALAFFFGIILKYVLLK* |
Ga0153915_112992432 | 3300012931 | Freshwater Wetlands | VVDRAQRMNRRTALVLASVALVFFLGIMLKYVMLK* |
Ga0137410_100006156 | 3300012944 | Vadose Zone Soil | MTPEREQRRNNRRTAWVLGSIALAFFVGIMLKYVMLK* |
Ga0137410_110773242 | 3300012944 | Vadose Zone Soil | VTPEREPRHKLRTALVLGSIALAFFFGIMLKYVVLK* |
Ga0137410_113100292 | 3300012944 | Vadose Zone Soil | MTETRALRRNNRRTALVLASIALAFFLGTMLKYAWLR* |
Ga0137410_113273012 | 3300012944 | Vadose Zone Soil | MSHGAQRRGNFRTALVLGSIALAFFVGIMLKYIVLR* |
Ga0126375_117486622 | 3300012948 | Tropical Forest Soil | VTPERQRDNLRTALVLGSIALVFFIGIMLKYVILK* |
Ga0126369_105371922 | 3300012971 | Tropical Forest Soil | VTREQQRLNLRTALVLGSIALVFFLGIMLKYFLLK* |
Ga0126369_111878192 | 3300012971 | Tropical Forest Soil | VTQEREQRHNLRTALVLGSIAVAFFIGIMLKYLVLK* |
Ga0134077_103116422 | 3300012972 | Grasslands Soil | MTPERLQRRSNRRTALVLGSIALVFFVAIMLKYAMLK* |
Ga0134081_102246812 | 3300014150 | Grasslands Soil | MTPERLQRRSNRRTALVLGSIALAFFVAIMLKYAMLK* |
Ga0075301_10077602 | 3300014262 | Natural And Restored Wetlands | MSPQRTGNLRTALVLASIAVAFFVGIMLKYLFLR* |
Ga0075354_10045272 | 3300014308 | Natural And Restored Wetlands | MIDRGQRSNNRVTALVLASIALAFFIGIMLKYVLIK* |
Ga0075353_10065802 | 3300014321 | Natural And Restored Wetlands | MMGDRTQRGNLRTGLVLASIALVFFLGIMLKYALTK* |
Ga0075353_10331652 | 3300014321 | Natural And Restored Wetlands | MIDRGQRSNNRVTALVLASIALAFFIGIMLKYVLTK* |
Ga0137411_12212173 | 3300015052 | Vadose Zone Soil | MTPGREQQRSNRRTALVLASIALVFFVAIMLKYVMLK* |
Ga0137420_14455572 | 3300015054 | Vadose Zone Soil | MTPEREQRRSNRRTAWVLGSIALAFFLGIMLKYVRLK* |
Ga0137412_100069045 | 3300015242 | Vadose Zone Soil | MTPEQRTNIRRTALVLASIALAFFFGIMLKYVLLK* |
Ga0137412_103930234 | 3300015242 | Vadose Zone Soil | GAGMTPEREQRRNNRRTALLLGSIALVFFVAIMLKYVMLK* |
Ga0137409_100072493 | 3300015245 | Vadose Zone Soil | VTPGRGQQHNLRTALVLGSIALVFFLGIMLKYLILR* |
Ga0137409_1001024513 | 3300015245 | Vadose Zone Soil | VIRAQRRDNLRTGLVLGSIALVFFVGIVLKYFILK* |
Ga0134069_13315392 | 3300017654 | Grasslands Soil | MTPEREQRRNNRWTALALGSIALAFFVGIMLKYVMLK |
Ga0134074_10806831 | 3300017657 | Grasslands Soil | MTPEREQRRRNNRRTAWLLGSIALVFFLGIMLKYVMLK |
Ga0134083_102148032 | 3300017659 | Grasslands Soil | MTPELEQRRSNRRTAWMLGSIALAFFLGIMLKYVMLK |
Ga0187775_100228483 | 3300017939 | Tropical Peatland | VTREQQPDNLRTALVLGSIALAFFLGIVLKYFLLK |
Ga0187786_101253892 | 3300017944 | Tropical Peatland | VTREQRRDNLRTALVLGSIALVFFLGIMLKYFILK |
Ga0187779_102051953 | 3300017959 | Tropical Peatland | VTREQQRDNLRTAVVLGSIALVFFLGIMLKYFLLK |
Ga0187777_113330192 | 3300017974 | Tropical Peatland | VTREQQRDNLRTAVVLGSIALVFFLGVMLKYFLLK |
Ga0184610_10483722 | 3300017997 | Groundwater Sediment | MTGNRTQRTNNRRTALLLASIAFAFFLGIVLKYALLK |
Ga0184604_100636812 | 3300018000 | Groundwater Sediment | MTPEREQRRNNRWTALVLGSIALVFFLGIMLKYVMLK |
Ga0184634_101876453 | 3300018031 | Groundwater Sediment | PRAAGGEMTPEQRTNTRRTALVLASIALVFFFGVMLKYVALR |
Ga0184623_100200872 | 3300018056 | Groundwater Sediment | MTGNRTQRTNNRRTALLLASIAFAFFLGIVLKYVLLK |
Ga0187765_101242903 | 3300018060 | Tropical Peatland | VTRDQQRDNFRTALVLGSIALVFFLGIMLKYFLLT |
Ga0184637_100130176 | 3300018063 | Groundwater Sediment | MMLDRGHRTNNRVTALVLASIALVFFVGIMLKYILIK |
Ga0187773_100055284 | 3300018064 | Tropical Peatland | MGDRAHRGNLKTGLVLASIALAFFLGIMLKYVLTK |
Ga0184618_100648222 | 3300018071 | Groundwater Sediment | MTPEREQRRNNRRTAWVLGSIALVFFVGIMLKYVMLK |
Ga0184640_100014424 | 3300018074 | Groundwater Sediment | MTPEQRTNTRRTALVLASIALVFFFGVMLKYVALR |
Ga0184640_103154932 | 3300018074 | Groundwater Sediment | MLDRGHRTNNRVTALVLASIALVFFVGIMLKYILIK |
Ga0184612_102386703 | 3300018078 | Groundwater Sediment | MKVEREQRTNKRITALVLASIALAFFFGIMLKYVLLK |
Ga0184639_102588822 | 3300018082 | Groundwater Sediment | MKVAREQRTNRRITALVLASIALAFFFGIMLKYILIK |
Ga0184628_102345972 | 3300018083 | Groundwater Sediment | MTPEREQRRNNRRTALVLGSIALVFFLGIMLKYVMLK |
Ga0066667_101414234 | 3300018433 | Grasslands Soil | MTPELLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK |
Ga0066667_104935294 | 3300018433 | Grasslands Soil | GMTPEREQRRNNRWTALVLGSIALAFFVGIMLKYVMLK |
Ga0066667_106213972 | 3300018433 | Grasslands Soil | MTPEREQRRNNRWTALVLGSIALAFFVGIMLKYVMLK |
Ga0066662_101479524 | 3300018468 | Grasslands Soil | MTPEREQRRSNRMTALVLGSIALVFFVAIMLKYAMLK |
Ga0187791_11791332 | 3300019245 | Peatland | MGNHVQRTNFKTGLVLASIALAFFLGIMLKYVLIK |
Ga0184643_12972552 | 3300019255 | Groundwater Sediment | MTPEREQRRSNRRTAWVLGSIALAFFLGIMLKYVMLK |
Ga0137408_11732012 | 3300019789 | Vadose Zone Soil | MTPEREQRRNNRRTALLLGSIALVFFVAIMLKYVMLK |
Ga0193754_10029033 | 3300019872 | Soil | MTPERERRRNNRRTAWVLGSIALAFFLGIMLKYVMLK |
Ga0193712_10873672 | 3300019880 | Soil | MTPGREQQRSNRRTALVLGSIALVFFVAIMLKYVMLK |
Ga0193725_10321192 | 3300019883 | Soil | MTPEREQRRNNRRTALVLGSIALVFFVAIMLKYVMLK |
Ga0193711_10096472 | 3300019997 | Soil | MMPAREQRRSNRRTALVLGSIALAFFVAIMLKYVMLK |
Ga0193749_10284882 | 3300020010 | Soil | MTPGREQRRNNRRTALLLGSIALAFFLGIMLKYVMLK |
Ga0193726_100200010 | 3300020021 | Soil | MTPDSGQRASIRRTAWVLGSIALAFFLGIMLKYVLLK |
Ga0179594_100018716 | 3300020170 | Vadose Zone Soil | MSHGAQRRGNFRTALVLGSIALAFFVGIMLKYILLK |
Ga0179594_100548962 | 3300020170 | Vadose Zone Soil | MTPEREQRRNNRRTALLLGSIALVFFVAVMLKYVMLK |
Ga0179594_100918032 | 3300020170 | Vadose Zone Soil | MTPEQRTNIRRTALVLASIALAFFFGIMLKYVLVK |
Ga0179596_100256012 | 3300021086 | Vadose Zone Soil | MTPEREQRRNNRRTALVLGSIALAFFVGIMLKYVMLK |
Ga0179596_102196692 | 3300021086 | Vadose Zone Soil | MTPEQRTGIRRTALVLASIALAFFFGIMLKYALLK |
Ga0126371_111067792 | 3300021560 | Tropical Forest Soil | VSPERQQRNNMRTALVLGSIALVFFFGIMLKYVLLK |
Ga0207646_104246053 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MMRGREQRRSNRMTALVLGSIALAFFVAIMLKYIMLK |
Ga0210135_10028921 | 3300025954 | Natural And Restored Wetlands | MIHRGQRSNNWITALVLASVALAFFIGIMLKYVLTK |
Ga0210078_10022462 | 3300025979 | Natural And Restored Wetlands | MIDRGQRSNNRVTALVLASIALAFFIGIMLKYVLIK |
Ga0210117_10350111 | 3300025985 | Natural And Restored Wetlands | MMGDRTQRGNLRTGLVLASIALVFFLGIMLKYVLTK |
Ga0209350_10022943 | 3300026277 | Grasslands Soil | MTPERLQRRSNRKTALVLGSIALAFFVAIMLKYAMLK |
Ga0209438_10855882 | 3300026285 | Grasslands Soil | MTTEREQRRNNRRTAWVLGSIALAFFLGIMLKYVMLK |
Ga0209234_11225682 | 3300026295 | Grasslands Soil | MTPERRQWRSNRRTALVLGSIALAFFVAIMLKYAMLK |
Ga0209235_11417562 | 3300026296 | Grasslands Soil | MTGNRTQRTNNRRTALVLASIAFAFFLGIILKYVLLK |
Ga0209237_11299653 | 3300026297 | Grasslands Soil | MTPEQRTNIRRTALVLASIALAFFFGIMLKYALLK |
Ga0209236_10285116 | 3300026298 | Grasslands Soil | MTPEREQQRSNRRTAWVLGSIALAFFLGIMLKYVMLK |
Ga0209236_10744462 | 3300026298 | Grasslands Soil | MTPELEQRRSNRRTAWVLGSIALAFFLGIMLKYVMLK |
Ga0209155_11199542 | 3300026316 | Soil | MTPEREQRRSNRMTALVLASIALVFFVAIMLKYAMLK |
Ga0209131_14103802 | 3300026320 | Grasslands Soil | MTETRALRRNNRRTALVLASIALAFFLGTMLKYAWLR |
Ga0209377_13150072 | 3300026334 | Soil | MTPERDQRRNNRWTALVLGSIALAFFVGIMLKYVMLK |
Ga0257162_10394431 | 3300026340 | Soil | GAGMTPERERRRNNRRTAWVLGSVALAFFLGIMLKYVMLK |
Ga0209806_10574222 | 3300026529 | Soil | MTPERLQRRSNRRTALVLGSIALVFFVAIMLKYIILK |
Ga0209056_100597627 | 3300026538 | Soil | GGGMTPERDQRRNNRWTALVLGSIALAFFVGIMLKYVMLK |
Ga0209161_100128343 | 3300026548 | Soil | MTPERDQRRNNRWTALVLGSIALVFFVGIMLKYVMLK |
Ga0179587_109894602 | 3300026557 | Vadose Zone Soil | MTPEQRTNIRRTALMLASIALAFFFGIILKYVLLK |
Ga0179587_110188212 | 3300026557 | Vadose Zone Soil | MMPAREQRRSNRRTALVLGSIALVFFVAIMLKYAMLK |
Ga0208995_10446251 | 3300027388 | Forest Soil | MTPEREQRRNNRRTAWVLGSIALAFFLGIMLKYVMLK |
Ga0208454_100007453 | 3300027573 | Soil | MMLDRGHRTHNRVTALVLASIALVFFVGIMLKYVLLK |
Ga0208988_10095194 | 3300027633 | Forest Soil | MMPAREQRRSNRRTALVLGSIALVFFVAIMLKYVMLK |
Ga0209588_10647272 | 3300027671 | Vadose Zone Soil | MTPGRERQRSNRRTALVLGSIALVFFVAIMLKYVMLK |
Ga0209811_100003992 | 3300027821 | Surface Soil | VTPGRGQQHNLRTALVLGSIALVFFLGIMLKYFILR |
Ga0209580_100026158 | 3300027842 | Surface Soil | MTATRDPRPANRRTALVLASIALAFFFGIMLKYILTR |
Ga0209180_102759842 | 3300027846 | Vadose Zone Soil | MTGNRTQRTNNRRTALVLASIAFAFFLGIMLKYVLLK |
Ga0209180_107155102 | 3300027846 | Vadose Zone Soil | MTPERRTGIRRTALVLASVALAFFFGIMLKYVLLK |
Ga0209283_103705302 | 3300027875 | Vadose Zone Soil | MTPEQRTNIRRTALVLASIALAFFFGIMLKYVLLK |
Ga0209590_102596832 | 3300027882 | Vadose Zone Soil | MTPEREQRRNNRRTAWVLGSIALFFFLGIMLKYVMLK |
Ga0209590_106242722 | 3300027882 | Vadose Zone Soil | MTPERERRRNNRRTAWMLGSIALAFFLGIMLKYVMLK |
Ga0209590_109723931 | 3300027882 | Vadose Zone Soil | MTPEQRTGIRRTALVLASIALAFFFGIMLKYVLLK |
Ga0307504_100577082 | 3300028792 | Soil | MTGNRVQRANNRRTAFVLASIALAFFVGIMLKYVLLK |
Ga0307503_101589432 | 3300028802 | Soil | VTPDRGQQHNLRTALVLGSIALVFFAGIMLKYLILK |
Ga0307501_100017322 | 3300031152 | Soil | MTPERLQRRSNRRTALVLGSIALAFFVAIMLKYAMLK |
Ga0307498_101531252 | 3300031170 | Soil | VTLEREQRNKLRTALVLGSIALAFFFGIMLKYVVLK |
Ga0307495_100249273 | 3300031199 | Soil | MMPAREQRRSNRRTALVLGLIALAFFVAIMLKYVMLK |
Ga0307495_101706782 | 3300031199 | Soil | VTLEREQRNKLRTAAVLGSIALAFFFGVMLKYVVLK |
Ga0307495_102390262 | 3300031199 | Soil | MTPERERRRNNLRTAWVLGSIALIFFLGIILKYVMHE |
Ga0307497_100043273 | 3300031226 | Soil | MTPEREQRRNNRRTAWVLGSIALAFFFGIMLKYIVLK |
Ga0318561_102125292 | 3300031679 | Soil | VTPGRQRDNLKTALVLGSIALVFFIGIMLKYVILK |
Ga0307469_100000038 | 3300031720 | Hardwood Forest Soil | MMPAREQQRNNRRTAWVLASIALAFFAAIMLKYVMLK |
Ga0307469_100081966 | 3300031720 | Hardwood Forest Soil | VTPEHEQRHKLRTALVLGSIALAFFFGIMLKYVVLK |
Ga0307469_100135863 | 3300031720 | Hardwood Forest Soil | MTPERDQRQSNLRTALVLGSIALAFFVGIMLKYVLIK |
Ga0307469_100200924 | 3300031720 | Hardwood Forest Soil | VTAEREQRHRLRTALVLGSIALAFFFGIMLKYVVLK |
Ga0307469_101193692 | 3300031720 | Hardwood Forest Soil | MTSERERRRSNRRTALVLGSIALVFFLGIMLKYVMLK |
Ga0307468_1002907652 | 3300031740 | Hardwood Forest Soil | VRAVVEQRRNNLRTAIVLGSIALAFFVGIMLKYVILK |
Ga0307473_100174413 | 3300031820 | Hardwood Forest Soil | MTPEREQRRNNRRTALVLGSIALAFFLGIMLKYVMLK |
Ga0307473_101026544 | 3300031820 | Hardwood Forest Soil | MTPEREQRRNNRRTAWVLGSIALAFFAAIMLKHVMLE |
Ga0307473_105662992 | 3300031820 | Hardwood Forest Soil | MTPEREQRRNNLRTAWVLGSIALIFFLGIILKYVTLE |
Ga0307471_10000995610 | 3300032180 | Hardwood Forest Soil | MTPEREQRRSNRMTALVLGSIALAFFVAIMLKYAMLK |
Ga0307471_1002705284 | 3300032180 | Hardwood Forest Soil | MTSEREQRRNNLRTALLLGSIALAFFVGIMLKYVMLK |
Ga0307471_1003337472 | 3300032180 | Hardwood Forest Soil | MSPERDQRQSNLRTALVLGSIALAFFVGIMLKYVLIK |
Ga0307471_1036555362 | 3300032180 | Hardwood Forest Soil | VTPGPGQQHNLRTALVLGSIALVFFVGIMLKYVILR |
Ga0307472_1006261131 | 3300032205 | Hardwood Forest Soil | MVHGGQRRGNLRTALVLGSIALAFFVGILLKYLILK |
Ga0335085_1000352415 | 3300032770 | Soil | MGDRAHRGNLKTGLVLASIALVFFLGIMLKYVLTK |
Ga0335079_103064962 | 3300032783 | Soil | MTSDRERQTSNLKTALVLASIAVVFFLGIMLKYVLLR |
Ga0335084_100035513 | 3300033004 | Soil | VTRDQHRGNLRTALVLGSIALVFFLGIMLKYFLLK |
Ga0335084_110815662 | 3300033004 | Soil | MGNHAQRANFWTGLVLASIALVFFLGIMLKYVLIK |
Ga0335077_102150765 | 3300033158 | Soil | TGGEMTSDRERQTSNLKTALVLASIAVVFFLGIMLKYVLLR |
Ga0326729_10578202 | 3300033432 | Peat Soil | VTRAQQRDNVRTALVLGSIALVFFLGIVLKYIILK |
Ga0326726_100085009 | 3300033433 | Peat Soil | VTRAQQRDNVRTALVLGSIALVFFLGIVLKYFILK |
Ga0326726_100446372 | 3300033433 | Peat Soil | VTREQQRDNLRTALVLGSIALVFFLGIMLKYFILK |
Ga0314869_018534_226_333 | 3300033759 | Peatland | VTREQQRDNLRTAAVLGSIALVFFLGIMLKYFLLK |
Ga0314862_0060063_406_513 | 3300033803 | Peatland | MREQQHRDNLRTALVLGSIALAFFLGIMLKYFMLK |
Ga0314863_028036_295_405 | 3300033804 | Peatland | VTREQQQRDNLRTALVLGSIALVFFLGIMLKYFILK |
Ga0314871_002562_4_111 | 3300033809 | Peatland | VTREHQRDNLRTALVLGSIALVFFLGIMLKYLLLK |
Ga0314872_014615_447_557 | 3300033810 | Peatland | VTPQRDQRSNLRTALVLGSIALAFFVGIMIKYVMLK |
Ga0364924_089021_484_597 | 3300033811 | Sediment | MTLDRGHRTNNRVTALVLASIALVFFVGIMLKYVLIK |
Ga0364930_0049840_1001_1108 | 3300033814 | Sediment | MTPEKRTSIRRTALVLASIALAFFFGTMLRYVLIR |
⦗Top⦘ |