Basic Information | |
---|---|
Family ID | F009328 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 319 |
Average Sequence Length | 43 residues |
Representative Sequence | MDEGYYCVVCGRYIEADEHGVIVHDDVPHPPDMDFAEEEKPQ |
Number of Associated Samples | 169 |
Number of Associated Scaffolds | 319 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 77.44 % |
% of genes near scaffold ends (potentially truncated) | 31.03 % |
% of genes from short scaffolds (< 2000 bps) | 68.97 % |
Associated GOLD sequencing projects | 152 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (52.978 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (19.436 % of family members) |
Environment Ontology (ENVO) | Unclassified (42.006 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.172 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.43% Coil/Unstructured: 88.57% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 319 Family Scaffolds |
---|---|---|
PF13392 | HNH_3 | 2.19 |
PF00271 | Helicase_C | 1.57 |
PF13730 | HTH_36 | 1.25 |
PF03237 | Terminase_6N | 1.25 |
PF15943 | YdaS_antitoxin | 1.25 |
PF11753 | DUF3310 | 1.25 |
PF05866 | RusA | 0.94 |
PF08774 | VRR_NUC | 0.94 |
PF00196 | GerE | 0.63 |
PF13203 | DUF2201_N | 0.63 |
PF00959 | Phage_lysozyme | 0.63 |
PF03819 | MazG | 0.63 |
PF00182 | Glyco_hydro_19 | 0.63 |
PF02195 | ParBc | 0.63 |
PF08273 | Prim_Zn_Ribbon | 0.63 |
PF06067 | DUF932 | 0.63 |
PF01612 | DNA_pol_A_exo1 | 0.63 |
PF01381 | HTH_3 | 0.63 |
PF04404 | ERF | 0.63 |
PF10124 | Mu-like_gpT | 0.63 |
PF07102 | YbcO | 0.63 |
PF13479 | AAA_24 | 0.63 |
PF00176 | SNF2-rel_dom | 0.63 |
PF04447 | dATP-dGTP_PPHyd | 0.31 |
PF07728 | AAA_5 | 0.31 |
PF05970 | PIF1 | 0.31 |
PF07022 | Phage_CI_repr | 0.31 |
PF10991 | DUF2815 | 0.31 |
PF12705 | PDDEXK_1 | 0.31 |
PF04606 | Ogr_Delta | 0.31 |
PF13986 | DUF4224 | 0.31 |
PF00535 | Glycos_transf_2 | 0.31 |
PF00145 | DNA_methylase | 0.31 |
PF09374 | PG_binding_3 | 0.31 |
PF16080 | Phage_holin_2_3 | 0.31 |
PF11351 | GTA_holin_3TM | 0.31 |
PF05838 | Glyco_hydro_108 | 0.31 |
PF13876 | Phage_gp49_66 | 0.31 |
PF13560 | HTH_31 | 0.31 |
PF00303 | Thymidylat_synt | 0.31 |
PF00694 | Aconitase_C | 0.31 |
PF00462 | Glutaredoxin | 0.31 |
PF08291 | Peptidase_M15_3 | 0.31 |
PF08241 | Methyltransf_11 | 0.31 |
PF16786 | RecA_dep_nuc | 0.31 |
PF00132 | Hexapep | 0.31 |
PF09588 | YqaJ | 0.31 |
PF00126 | HTH_1 | 0.31 |
PF02739 | 5_3_exonuc_N | 0.31 |
COG ID | Name | Functional Category | % Frequency in 319 Family Scaffolds |
---|---|---|---|
COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 0.94 |
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 0.63 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 0.63 |
COG4643 | Uncharacterized domain associated with phage/plasmid primase | Mobilome: prophages, transposons [X] | 0.63 |
COG0207 | Thymidylate synthase | Nucleotide transport and metabolism [F] | 0.31 |
COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 0.31 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.31 |
COG0507 | ATPase/5’-3’ helicase helicase subunit RecD of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 0.31 |
COG3926 | Lysozyme family protein | General function prediction only [R] | 0.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.50 % |
Unclassified | root | N/A | 18.50 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000558|Draft_10006650 | All Organisms → Viruses → Predicted Viral | 1755 | Open in IMG/M |
3300000558|Draft_10030082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300000558|Draft_10264966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300001580|Draft_10397654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300001605|Draft_10136006 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1635 | Open in IMG/M |
3300001605|Draft_10171717 | All Organisms → Viruses → Predicted Viral | 1356 | Open in IMG/M |
3300002206|metazooDRAFT_1304712 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300002212|metazooDRAFT_1346173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300002220|MLSBCLC_10070608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6116 | Open in IMG/M |
3300002220|MLSBCLC_10128244 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 2626 | Open in IMG/M |
3300002220|MLSBCLC_10184987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1095 | Open in IMG/M |
3300002220|MLSBCLC_10554770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 909 | Open in IMG/M |
3300002835|B570J40625_101601619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300002856|draft_10003600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300002856|draft_11479871 | All Organisms → Viruses → Predicted Viral | 1642 | Open in IMG/M |
3300003277|JGI25908J49247_10015071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2363 | Open in IMG/M |
3300003277|JGI25908J49247_10020295 | All Organisms → Viruses → Predicted Viral | 1982 | Open in IMG/M |
3300003393|JGI25909J50240_1037327 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1044 | Open in IMG/M |
3300003411|JGI25911J50253_10206285 | Not Available | 541 | Open in IMG/M |
3300003499|JGI25930J51415_1071817 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
3300003860|Ga0031658_1021566 | All Organisms → Viruses → Predicted Viral | 1083 | Open in IMG/M |
3300004240|Ga0007787_10030003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2342 | Open in IMG/M |
3300004240|Ga0007787_10143147 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300004240|Ga0007787_10214884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 939 | Open in IMG/M |
3300004481|Ga0069718_10054676 | All Organisms → Viruses → Predicted Viral | 3475 | Open in IMG/M |
3300004481|Ga0069718_15892958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300004481|Ga0069718_16262356 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300005527|Ga0068876_10007241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7493 | Open in IMG/M |
3300005527|Ga0068876_10324816 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 870 | Open in IMG/M |
3300005527|Ga0068876_10455449 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 707 | Open in IMG/M |
3300005527|Ga0068876_10466879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300005527|Ga0068876_10573993 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300005527|Ga0068876_10593311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300005528|Ga0068872_10281394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300005581|Ga0049081_10041073 | All Organisms → Viruses → Predicted Viral | 1756 | Open in IMG/M |
3300005581|Ga0049081_10089133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1154 | Open in IMG/M |
3300005581|Ga0049081_10178251 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300005581|Ga0049081_10266196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300005582|Ga0049080_10006108 | All Organisms → Viruses → Predicted Viral | 4176 | Open in IMG/M |
3300005582|Ga0049080_10311576 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300005662|Ga0078894_10011815 | Not Available | 6891 | Open in IMG/M |
3300005662|Ga0078894_10090514 | All Organisms → Viruses → Predicted Viral | 2683 | Open in IMG/M |
3300005662|Ga0078894_10121323 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2327 | Open in IMG/M |
3300005662|Ga0078894_11304280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
3300005662|Ga0078894_11440731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
3300005664|Ga0073685_1047693 | All Organisms → cellular organisms → Bacteria | 1201 | Open in IMG/M |
3300005672|Ga0074421_103873 | Not Available | 6495 | Open in IMG/M |
3300005805|Ga0079957_1031365 | All Organisms → Viruses → Predicted Viral | 3513 | Open in IMG/M |
3300005805|Ga0079957_1106491 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → Chromatiaceae → Lamprocystis → Lamprocystis purpurea | 1515 | Open in IMG/M |
3300005805|Ga0079957_1158883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1139 | Open in IMG/M |
3300005805|Ga0079957_1196630 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300006030|Ga0075470_10002523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5701 | Open in IMG/M |
3300006030|Ga0075470_10029998 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1682 | Open in IMG/M |
3300006030|Ga0075470_10073132 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
3300006033|Ga0075012_10035819 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 4102 | Open in IMG/M |
3300006037|Ga0075465_10167174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. XJ19-13 | 504 | Open in IMG/M |
3300006637|Ga0075461_10249373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300006641|Ga0075471_10154627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1211 | Open in IMG/M |
3300006641|Ga0075471_10190779 | All Organisms → Viruses → Predicted Viral | 1071 | Open in IMG/M |
3300006641|Ga0075471_10481518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 616 | Open in IMG/M |
3300006802|Ga0070749_10024586 | All Organisms → Viruses → Predicted Viral | 3792 | Open in IMG/M |
3300006802|Ga0070749_10103476 | All Organisms → Viruses → Predicted Viral | 1682 | Open in IMG/M |
3300006802|Ga0070749_10298626 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 903 | Open in IMG/M |
3300006802|Ga0070749_10309748 | Not Available | 883 | Open in IMG/M |
3300006802|Ga0070749_10399553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 758 | Open in IMG/M |
3300006802|Ga0070749_10491304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300006802|Ga0070749_10521011 | Not Available | 646 | Open in IMG/M |
3300006802|Ga0070749_10544618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300006802|Ga0070749_10585435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 603 | Open in IMG/M |
3300006802|Ga0070749_10594820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300006802|Ga0070749_10722451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300006805|Ga0075464_10139658 | All Organisms → Viruses → Predicted Viral | 1417 | Open in IMG/M |
3300006805|Ga0075464_10301835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 964 | Open in IMG/M |
3300006805|Ga0075464_10734531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300006863|Ga0075459_1010243 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1533 | Open in IMG/M |
3300006863|Ga0075459_1034983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
3300006863|Ga0075459_1069697 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300006917|Ga0075472_10434650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300006917|Ga0075472_10540158 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300007540|Ga0099847_1218180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300007542|Ga0099846_1330987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300007600|Ga0102920_1194310 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300007639|Ga0102865_1050633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
3300007735|Ga0104988_10562 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 17879 | Open in IMG/M |
3300007974|Ga0105747_1005579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3202 | Open in IMG/M |
3300007974|Ga0105747_1161708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300008055|Ga0108970_10342778 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 906 | Open in IMG/M |
3300008055|Ga0108970_11167990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300008107|Ga0114340_1040803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3200 | Open in IMG/M |
3300008107|Ga0114340_1108945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300008107|Ga0114340_1267117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300008111|Ga0114344_1223009 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300008113|Ga0114346_1052422 | All Organisms → Viruses → Predicted Viral | 2029 | Open in IMG/M |
3300008114|Ga0114347_1208799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300008120|Ga0114355_1133890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300008263|Ga0114349_1067700 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1664 | Open in IMG/M |
3300008266|Ga0114363_1000190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 63661 | Open in IMG/M |
3300008266|Ga0114363_1000318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 43187 | Open in IMG/M |
3300008266|Ga0114363_1009248 | All Organisms → cellular organisms → Bacteria | 4750 | Open in IMG/M |
3300008266|Ga0114363_1064011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1419 | Open in IMG/M |
3300008266|Ga0114363_1112254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
3300008266|Ga0114363_1168121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 709 | Open in IMG/M |
3300008266|Ga0114363_1247817 | Not Available | 503 | Open in IMG/M |
3300008267|Ga0114364_1005140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16880 | Open in IMG/M |
3300008267|Ga0114364_1013764 | Not Available | 3582 | Open in IMG/M |
3300008448|Ga0114876_1084740 | All Organisms → Viruses → Predicted Viral | 1305 | Open in IMG/M |
3300008448|Ga0114876_1160347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
3300008448|Ga0114876_1217367 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300008448|Ga0114876_1246853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 557 | Open in IMG/M |
3300008450|Ga0114880_1047002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1842 | Open in IMG/M |
3300008450|Ga0114880_1244637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300008450|Ga0114880_1272993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Parazoarcus → Parazoarcus communis | 511 | Open in IMG/M |
3300009068|Ga0114973_10051134 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2439 | Open in IMG/M |
3300009161|Ga0114966_10460551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300009165|Ga0105102_10644037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300009168|Ga0105104_10545862 | Not Available | 656 | Open in IMG/M |
3300009169|Ga0105097_10537574 | Not Available | 655 | Open in IMG/M |
3300009180|Ga0114979_10282757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 988 | Open in IMG/M |
3300009184|Ga0114976_10003545 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9753 | Open in IMG/M |
3300009184|Ga0114976_10664096 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300009194|Ga0114983_1036578 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
3300009419|Ga0114982_1197964 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300010338|Ga0116245_10487164 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Rhodocyclaceae → unclassified Rhodocyclaceae → Rhodocyclaceae bacterium | 628 | Open in IMG/M |
3300010354|Ga0129333_10024201 | Not Available | 5756 | Open in IMG/M |
3300010354|Ga0129333_10193159 | All Organisms → Viruses → Predicted Viral | 1854 | Open in IMG/M |
3300010354|Ga0129333_10237283 | All Organisms → Viruses → Predicted Viral | 1648 | Open in IMG/M |
3300010354|Ga0129333_10434983 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
3300010354|Ga0129333_10773364 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 820 | Open in IMG/M |
3300010354|Ga0129333_10934925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300010354|Ga0129333_11086465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300010354|Ga0129333_11701157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300010356|Ga0116237_10627863 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 928 | Open in IMG/M |
3300010388|Ga0136551_1027260 | Not Available | 1088 | Open in IMG/M |
3300010429|Ga0116241_10666055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. XJ19-13 | 804 | Open in IMG/M |
3300011113|Ga0151517_1605 | Not Available | 12291 | Open in IMG/M |
3300011115|Ga0151514_10962 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11409 | Open in IMG/M |
3300011115|Ga0151514_10981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11252 | Open in IMG/M |
3300011184|Ga0136709_1000840 | Not Available | 5657 | Open in IMG/M |
3300011268|Ga0151620_1120853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300011995|Ga0153800_1000321 | Not Available | 4722 | Open in IMG/M |
3300011995|Ga0153800_1038972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300012006|Ga0119955_1000998 | Not Available | 14680 | Open in IMG/M |
3300012012|Ga0153799_1001745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6189 | Open in IMG/M |
3300012012|Ga0153799_1044071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 831 | Open in IMG/M |
3300012020|Ga0119869_1168472 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. XJ19-13 | 670 | Open in IMG/M |
3300012720|Ga0157613_1045829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
3300012990|Ga0159060_1002956 | All Organisms → Viruses → Predicted Viral | 4533 | Open in IMG/M |
3300012990|Ga0159060_1063441 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → unclassified Pseudomonas → Pseudomonas sp. KSR10 | 971 | Open in IMG/M |
3300013004|Ga0164293_10101614 | All Organisms → Viruses → Predicted Viral | 2206 | Open in IMG/M |
3300013004|Ga0164293_10827896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300013005|Ga0164292_10482144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 815 | Open in IMG/M |
3300013005|Ga0164292_10525562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 772 | Open in IMG/M |
3300013793|Ga0119894_1003575 | All Organisms → Viruses → Predicted Viral | 1633 | Open in IMG/M |
3300014203|Ga0172378_10892641 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. XJ19-13 | 639 | Open in IMG/M |
3300014810|Ga0119896_1001947 | All Organisms → Viruses → Predicted Viral | 4516 | Open in IMG/M |
3300014811|Ga0119960_1040417 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300014957|Ga0119942_1034579 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300015360|Ga0163144_11243994 | Not Available | 679 | Open in IMG/M |
3300017707|Ga0181363_1060979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300017716|Ga0181350_1026538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
3300017747|Ga0181352_1116637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Parazoarcus → Parazoarcus communis | 723 | Open in IMG/M |
3300017747|Ga0181352_1136123 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300017754|Ga0181344_1002218 | Not Available | 6913 | Open in IMG/M |
3300017754|Ga0181344_1068820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1045 | Open in IMG/M |
3300017754|Ga0181344_1131304 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 719 | Open in IMG/M |
3300017754|Ga0181344_1132215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 716 | Open in IMG/M |
3300017766|Ga0181343_1028466 | All Organisms → Viruses → Predicted Viral | 1697 | Open in IMG/M |
3300017766|Ga0181343_1184987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300017780|Ga0181346_1149411 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 875 | Open in IMG/M |
3300017780|Ga0181346_1250789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
3300017780|Ga0181346_1262254 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 599 | Open in IMG/M |
3300017780|Ga0181346_1279363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
3300017784|Ga0181348_1182071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 765 | Open in IMG/M |
3300017785|Ga0181355_1025240 | All Organisms → Viruses → Predicted Viral | 2578 | Open in IMG/M |
3300017785|Ga0181355_1191618 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobiaceae → unclassified Verrucomicrobiaceae → Verrucomicrobiaceae bacterium | 807 | Open in IMG/M |
3300017785|Ga0181355_1318861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300018048|Ga0181606_10689905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
3300018416|Ga0181553_10159912 | All Organisms → Viruses → Predicted Viral | 1333 | Open in IMG/M |
3300018420|Ga0181563_10456017 | Not Available | 723 | Open in IMG/M |
3300019781|Ga0181360_100457 | All Organisms → Viruses → Predicted Viral | 2792 | Open in IMG/M |
3300019784|Ga0181359_1032117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2030 | Open in IMG/M |
3300019784|Ga0181359_1034555 | Not Available | 1957 | Open in IMG/M |
3300019784|Ga0181359_1047133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1665 | Open in IMG/M |
3300019784|Ga0181359_1133528 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300019784|Ga0181359_1135825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 862 | Open in IMG/M |
3300020498|Ga0208050_1022112 | Not Available | 655 | Open in IMG/M |
3300021956|Ga0213922_1013430 | All Organisms → Viruses → Predicted Viral | 2211 | Open in IMG/M |
3300021956|Ga0213922_1084775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
3300021961|Ga0222714_10081673 | All Organisms → Viruses → Predicted Viral | 2105 | Open in IMG/M |
3300021961|Ga0222714_10108070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1744 | Open in IMG/M |
3300021961|Ga0222714_10186064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1211 | Open in IMG/M |
3300021961|Ga0222714_10326596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300021962|Ga0222713_10004485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13989 | Open in IMG/M |
3300021962|Ga0222713_10427445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 809 | Open in IMG/M |
3300021962|Ga0222713_10847246 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300021963|Ga0222712_10081387 | Not Available | 2313 | Open in IMG/M |
3300021963|Ga0222712_10416764 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300021963|Ga0222712_10480768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 739 | Open in IMG/M |
3300021963|Ga0222712_10502252 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus → Cupriavidus gilardii | 717 | Open in IMG/M |
3300022179|Ga0181353_1006509 | All Organisms → cellular organisms → Bacteria | 2806 | Open in IMG/M |
3300022179|Ga0181353_1033655 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
3300022179|Ga0181353_1075197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
3300022179|Ga0181353_1078677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300022179|Ga0181353_1096978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300022200|Ga0196901_1067424 | All Organisms → Viruses → Predicted Viral | 1301 | Open in IMG/M |
3300022407|Ga0181351_1215586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300022591|Ga0236341_1140068 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium | 505 | Open in IMG/M |
3300023179|Ga0214923_10001059 | Not Available | 40044 | Open in IMG/M |
3300023184|Ga0214919_10003264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 24649 | Open in IMG/M |
3300023184|Ga0214919_10688091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300023311|Ga0256681_11881917 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 654 | Open in IMG/M |
3300024277|Ga0255207_1013381 | All Organisms → Viruses → Predicted Viral | 1394 | Open in IMG/M |
3300024289|Ga0255147_1000181 | Not Available | 24929 | Open in IMG/M |
3300024348|Ga0244776_10494048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300024502|Ga0255181_1000092 | Not Available | 36630 | Open in IMG/M |
3300024506|Ga0255168_1029925 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 926 | Open in IMG/M |
3300025075|Ga0209615_109747 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300025091|Ga0209616_1001516 | Not Available | 4794 | Open in IMG/M |
3300025445|Ga0208424_1017702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 826 | Open in IMG/M |
3300025445|Ga0208424_1051108 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 517 | Open in IMG/M |
3300025585|Ga0208546_1000244 | Not Available | 22867 | Open in IMG/M |
3300025630|Ga0208004_1143519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300025866|Ga0208822_1140013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. XJ19-13 | 905 | Open in IMG/M |
3300025889|Ga0208644_1316950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 611 | Open in IMG/M |
3300025896|Ga0208916_10014430 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3091 | Open in IMG/M |
3300025896|Ga0208916_10164346 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300027121|Ga0255074_1015129 | All Organisms → Viruses → Predicted Viral | 1001 | Open in IMG/M |
3300027154|Ga0255111_1090726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
3300027302|Ga0255096_1053088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
3300027302|Ga0255096_1099290 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300027396|Ga0255146_1051817 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 861 | Open in IMG/M |
3300027600|Ga0255117_1023778 | Not Available | 1354 | Open in IMG/M |
3300027659|Ga0208975_1148471 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Rhodocyclales → Zoogloeaceae → Parazoarcus → Parazoarcus communis | 655 | Open in IMG/M |
3300027693|Ga0209704_1245983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300027710|Ga0209599_10040810 | All Organisms → Viruses → Predicted Viral | 1240 | Open in IMG/M |
3300027734|Ga0209087_1000072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 58074 | Open in IMG/M |
3300027763|Ga0209088_10243022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300027785|Ga0209246_10012616 | Not Available | 3143 | Open in IMG/M |
3300027785|Ga0209246_10170875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300027804|Ga0209358_10183618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1094 | Open in IMG/M |
3300027804|Ga0209358_10210491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1000 | Open in IMG/M |
3300027816|Ga0209990_10280260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 751 | Open in IMG/M |
3300027816|Ga0209990_10318873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 692 | Open in IMG/M |
3300027851|Ga0209066_10240573 | All Organisms → Viruses → Predicted Viral | 1050 | Open in IMG/M |
3300027899|Ga0209668_10983149 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300027900|Ga0209253_10249423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1397 | Open in IMG/M |
3300027963|Ga0209400_1053348 | All Organisms → Viruses → Predicted Viral | 2081 | Open in IMG/M |
3300028025|Ga0247723_1003005 | Not Available | 8612 | Open in IMG/M |
3300028025|Ga0247723_1003194 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8313 | Open in IMG/M |
3300028025|Ga0247723_1009026 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4042 | Open in IMG/M |
3300029288|Ga0265297_10001467 | All Organisms → cellular organisms → Bacteria | 55136 | Open in IMG/M |
3300029931|Ga0119911_100310 | Not Available | 5422 | Open in IMG/M |
3300031707|Ga0315291_10435864 | All Organisms → Viruses → Predicted Viral | 1235 | Open in IMG/M |
3300031707|Ga0315291_11534358 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Sterolibacteriaceae → Methyloversatilis → unclassified Methyloversatilis → Methyloversatilis sp. XJ19-13 | 522 | Open in IMG/M |
3300031758|Ga0315907_10000392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 63826 | Open in IMG/M |
3300031758|Ga0315907_10002117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 25658 | Open in IMG/M |
3300031758|Ga0315907_10323943 | All Organisms → Viruses → Predicted Viral | 1260 | Open in IMG/M |
3300031758|Ga0315907_10671586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300031784|Ga0315899_10582695 | All Organisms → Viruses → Predicted Viral | 1058 | Open in IMG/M |
3300031787|Ga0315900_10118590 | All Organisms → Viruses → Predicted Viral | 2525 | Open in IMG/M |
3300031787|Ga0315900_10288572 | All Organisms → Viruses → Predicted Viral | 1369 | Open in IMG/M |
3300031787|Ga0315900_10400813 | Not Available | 1082 | Open in IMG/M |
3300031787|Ga0315900_10421183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 1044 | Open in IMG/M |
3300031787|Ga0315900_10566818 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 840 | Open in IMG/M |
3300031787|Ga0315900_10582824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 823 | Open in IMG/M |
3300031787|Ga0315900_10851422 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Podoviridae sp. ctwJH20 | 620 | Open in IMG/M |
3300031857|Ga0315909_10000322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 63812 | Open in IMG/M |
3300031857|Ga0315909_10001049 | Not Available | 37332 | Open in IMG/M |
3300031857|Ga0315909_10030724 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5217 | Open in IMG/M |
3300031857|Ga0315909_10070222 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3135 | Open in IMG/M |
3300031857|Ga0315909_10365050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1049 | Open in IMG/M |
3300031857|Ga0315909_10429999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
3300031857|Ga0315909_10729019 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae | 638 | Open in IMG/M |
3300031951|Ga0315904_10103306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2990 | Open in IMG/M |
3300031951|Ga0315904_10300888 | All Organisms → Viruses → Predicted Viral | 1503 | Open in IMG/M |
3300031963|Ga0315901_10647525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300031999|Ga0315274_11527583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 633 | Open in IMG/M |
3300031999|Ga0315274_11621640 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 606 | Open in IMG/M |
3300032050|Ga0315906_10100635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Nevskiales → Sinobacteraceae → unclassified Sinobacteraceae → Sinobacteraceae bacterium | 2876 | Open in IMG/M |
3300032116|Ga0315903_10404193 | All Organisms → Viruses → Predicted Viral | 1111 | Open in IMG/M |
3300032116|Ga0315903_10476884 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 992 | Open in IMG/M |
3300032275|Ga0315270_10275269 | Not Available | 1050 | Open in IMG/M |
3300032397|Ga0315287_11553724 | Not Available | 746 | Open in IMG/M |
3300033521|Ga0316616_100073866 | All Organisms → Viruses → Predicted Viral | 2839 | Open in IMG/M |
3300033521|Ga0316616_100657593 | All Organisms → Viruses → Predicted Viral | 1245 | Open in IMG/M |
3300033521|Ga0316616_103564905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300033816|Ga0334980_0006539 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5168 | Open in IMG/M |
3300033993|Ga0334994_0045196 | All Organisms → Viruses → Predicted Viral | 2776 | Open in IMG/M |
3300033993|Ga0334994_0046587 | All Organisms → Viruses → Predicted Viral | 2727 | Open in IMG/M |
3300033994|Ga0334996_0007864 | Not Available | 7165 | Open in IMG/M |
3300034012|Ga0334986_0011189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6419 | Open in IMG/M |
3300034012|Ga0334986_0023809 | All Organisms → Viruses → Predicted Viral | 4123 | Open in IMG/M |
3300034021|Ga0335004_0258001 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
3300034061|Ga0334987_0151229 | Not Available | 1699 | Open in IMG/M |
3300034102|Ga0335029_0365580 | Not Available | 884 | Open in IMG/M |
3300034112|Ga0335066_0505152 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 640 | Open in IMG/M |
3300034118|Ga0335053_0793825 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 19.44% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 11.91% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 8.15% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.21% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.64% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 3.76% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 3.45% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 3.45% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.45% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 3.13% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 2.51% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.51% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 2.51% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.25% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.25% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.25% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 1.25% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.94% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.94% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.94% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.94% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.94% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.94% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.94% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.94% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 0.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.31% |
Aquatic | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Aquatic | 0.31% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.31% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.31% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.31% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.31% |
Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.31% |
Activated Sludge | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge | 0.31% |
Activated Sludge | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge | 0.31% |
Lab-Scale Ebpr Bioreactor | Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Lab-Scale Ebpr Bioreactor | 0.31% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.63% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.63% |
Watersheds | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Watersheds | 0.63% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.63% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.63% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.63% |
Wastewater | Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Wastewater | 0.63% |
Hydrocarbon Resource Environments | Engineered → Biotransformation → Microbial Solubilization Of Coal → Unclassified → Unclassified → Hydrocarbon Resource Environments | 0.63% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300002206 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - OCT 2012 | Environmental | Open in IMG/M |
3300002212 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JAN 2013 | Environmental | Open in IMG/M |
3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300002856 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Tailing Pond Surface TP_surface | Engineered | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300003860 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005664 | Freshwater viral communities from Emiquon reservoir, Havana, Illinois, USA | Environmental | Open in IMG/M |
3300005672 | Enhanced biological phosphorus removal bioreactor viral communities from the University of Queensland, Australia - SBR4-V90308 Phage Sequencing | Engineered | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006033 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007600 | Estuarine microbial communities from the Columbia River estuary - metaG 1568A-3 | Environmental | Open in IMG/M |
3300007639 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
3300007974 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460C_0.2um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300010338 | AD_JPMRca | Engineered | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010356 | AD_USDEca | Engineered | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010429 | AD_USRAca | Engineered | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300011115 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300011995 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 880 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012006 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1101B | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012020 | Activated sludge microbial communities from Shanghai, China - wastewater treatment plant - Activated sludge | Engineered | Open in IMG/M |
3300012720 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES141 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013793 | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - WX_AS_meta | Engineered | Open in IMG/M |
3300014203 | Groundwater microbial communities from an aquifer near a municipal landfill in Southern Ontario, Canada - Pumphouse #3_1 metaG | Environmental | Open in IMG/M |
3300014810 | Wastewater microbial communities from municipal sewage treatment plant in Nanjing, China - WX_IW_meta | Engineered | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300014957 | Aquatic microbial communities from drinking water treatment system in Nanjing, China - Disinfected water - DW | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300018048 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019781 | Freshwater viral communities from Lake Michigan, USA - Sp13.ND.MM15.S.D | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022591 | Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300023311 | Combined Assembly of Gp0281739, Gp0281740, Gp0281741 | Environmental | Open in IMG/M |
3300024277 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Miss_RepA_8d | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024502 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepC_8d | Environmental | Open in IMG/M |
3300024506 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8d | Environmental | Open in IMG/M |
3300024514 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepB_8d | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
3300025445 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025818 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025866 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_STIC08_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027154 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Yuk_RepA_8h | Environmental | Open in IMG/M |
3300027302 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Atlam_RepA_8d | Environmental | Open in IMG/M |
3300027396 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_8h | Environmental | Open in IMG/M |
3300027600 | Freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027804 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027851 | Freshwater microbial communities in response to fracking from Pennsylvania, USA - Allegheny Zone_MetaG_DW_15 (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300029288 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 137-91 | Engineered | Open in IMG/M |
3300029931 | Activated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V90308 | Engineered | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300032275 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottom | Environmental | Open in IMG/M |
3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033816 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Sep2004-rr0005 | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034021 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Oct2014-rr0057 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034112 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Aug2014-rr0191 | Environmental | Open in IMG/M |
3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Draft_100066502 | 3300000558 | Hydrocarbon Resource Environments | MTITLTREEGYYCVVCGRYLPADECGVIIHDDVPHPVDMDFGDEENPQ* |
Draft_100300821 | 3300000558 | Hydrocarbon Resource Environments | MTIKLTREETDGYYCVVCGRFLPEEDDVIVHDDVPHPIDMDFG |
Draft_102649664 | 3300000558 | Hydrocarbon Resource Environments | MTITLTREEGYYCVVCGRFLPEEDGVIVHDDVPHPIDMDFGDEE |
JGIcombinedJ13530_1029692344 | 3300001213 | Wetland | MTDKDVYYCVVCGRGIERDEYGIFAHDDVPHPPDMTFDEEETPQ* |
JGIcombinedJ13530_1081673133 | 3300001213 | Wetland | MNDEDVYYCVVCGRGIERNEYGVFVHDDVPHPPDMTFDEEETSQ* |
Draft_103976541 | 3300001580 | Hydrocarbon Resource Environments | CVVCGRFXPEEDGVIVHDDVPHPVDMDFGDEEKPQ* |
Draft_101360066 | 3300001605 | Hydrocarbon Resource Environments | MTITLTREEGYYCVVCGRFLPEEDGVIVHDDVPHPVDMDFGDEEXPQ* |
Draft_101717174 | 3300001605 | Hydrocarbon Resource Environments | MNDGYYCVVCGRYLEANEDRVIVHDDVPHPPEMDFADEEKPQ* |
metazooDRAFT_13047123 | 3300002206 | Lake | KGEEHMSVEEGYYCVVCGRFLPAIDGVIVHDDIEHPQEMDFAEEEKPQ* |
metazooDRAFT_13461733 | 3300002212 | Lake | MMEGYYCVVCGKFLLADDRGVIVHEDIAHPPDMDFNEEATPQ* |
MLSBCLC_100706087 | 3300002220 | Hydrocarbon Resource Environments | MTSDGYYCVVCGRYLPADECGVIIHDDVPHPVDMDFGDEENPQ* |
MLSBCLC_101282444 | 3300002220 | Hydrocarbon Resource Environments | VDEGYYCVVCGRLIEADERGVIVHDDVPHPPEMDFADEEKPQ* |
MLSBCLC_101849874 | 3300002220 | Hydrocarbon Resource Environments | MTIKLTREETDGYYCVVCGRFLPEEDDVIVHDDVPHPIDMDFGDEENPQ* |
MLSBCLC_105547702 | 3300002220 | Hydrocarbon Resource Environments | MSDGYYCVVCKRFIEADELGVIVHDDLPHPPDMDFAEEENPQ* |
B570J40625_1016016192 | 3300002835 | Freshwater | MAETDGYYCVICGKFIEAVNGVIVHDDIPHPPLMDFDEESNPQ* |
draft_100036002 | 3300002856 | Hydrocarbon Resource Environments | MDEGYYCVVCGRYIEADEHGVIVHDDVPHPPDMDFAEEEKPQ* |
draft_114798712 | 3300002856 | Hydrocarbon Resource Environments | MITLTREEGYYCVVCGRFLPEEDGVIVHDDVPHPIDMDFGDEEKPQ* |
JGI25908J49247_100150712 | 3300003277 | Freshwater Lake | MTDKEVMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEIDFGDEEKPQ* |
JGI25908J49247_100202954 | 3300003277 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEKNPQ* |
JGI25909J50240_10373272 | 3300003393 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPXEMAFDDEXNPQ* |
JGI25911J50253_102062852 | 3300003411 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPHEMAFDDEENPQ* |
JGI25930J51415_10718173 | 3300003499 | Freshwater Lake | MTITLTREEGCYCVVCGKFLPEEDGVIVHDDVPHPVDMDFGDEENPQ* |
Ga0031658_10215662 | 3300003860 | Freshwater Lake Sediment | MSDGYYCVVCGRXLLANEHGVIVHDDILHPQEMDFADEEKPQ* |
Ga0007787_100300037 | 3300004240 | Freshwater Lake | EGYYCVVCGRFLLEEDGVIVHDDVPHPIDMDFGDEEKPQ* |
Ga0007787_101431473 | 3300004240 | Freshwater Lake | MITLTREEADGYYCVVCGKFLPLENGVIVHDDVPHPADMKFNDEETTQ* |
Ga0007787_102148843 | 3300004240 | Freshwater Lake | MDEGYYCVVCGKYIEAVDDVIVHDDIPHPVDMAFDEEENPQ* |
Ga0069718_100546763 | 3300004481 | Sediment | MDDGYYCVVCGKYIEAVDGVIVHDDIPHPPDMAFDEEEKPQ* |
Ga0069718_158929582 | 3300004481 | Sediment | MDDGYYCVVCGRFLLAVDGVVVHDNVPHPDMAFDDEERPQ* |
Ga0069718_162623562 | 3300004481 | Sediment | MDDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ* |
Ga0068876_1000724112 | 3300005527 | Freshwater Lake | MNDGYYCVVCGRFLLEEDGVIVHDDVPHPLDMDFGDEEKPQ* |
Ga0068876_103248163 | 3300005527 | Freshwater Lake | MTITLTRKEGYYCVVCGRFLPEEDGVIAHDDVPHPADMDFGDEEKPQ* |
Ga0068876_104554492 | 3300005527 | Freshwater Lake | MDDGYYCVICGRYIEAVDGVVVHDDIPHPDMAFDDEENPQ* |
Ga0068876_104668792 | 3300005527 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEENPQ* |
Ga0068876_105739931 | 3300005527 | Freshwater Lake | MSDGYYCVVCGRFLLANEHGVIVHDDILHPQEMDFADEEKPQ* |
Ga0068876_105933111 | 3300005527 | Freshwater Lake | MDDGYYCVICGRYIEAVDGVVVHDDIPHPDMAFDDE |
Ga0068872_102813943 | 3300005528 | Freshwater Lake | MSIEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEIDFGDEEKPQ* |
Ga0049081_100410735 | 3300005581 | Freshwater Lentic | MTGYYCVVCNKFLPANELGVIVHDDVPHPVDMDFGDEEKPQ* |
Ga0049081_100891332 | 3300005581 | Freshwater Lentic | MSIEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEMDFGDEENQQ* |
Ga0049081_101782513 | 3300005581 | Freshwater Lentic | MDDGYYCVVCGKYIEAVDGVIVHDDIPHPPDMAFDEEERPQ* |
Ga0049081_102661962 | 3300005581 | Freshwater Lentic | MDETEGYYCVICGKFIEAVDGVIVHDDIPHPPLMDFDEESNPQ* |
Ga0049081_103239721 | 3300005581 | Freshwater Lentic | MTDNYYCVICGKLIEATIDGIFVHDPIPHPENMTFDEEDNPQ* |
Ga0049080_1000610810 | 3300005582 | Freshwater Lentic | MTDKEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEIDFG |
Ga0049080_103115762 | 3300005582 | Freshwater Lentic | GEEHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEENPQ* |
Ga0078894_1001181518 | 3300005662 | Freshwater Lake | MREGYHCVVCGRFLPADEYGVIVHDDIEHPQEMDFADEEKPQ* |
Ga0078894_100905142 | 3300005662 | Freshwater Lake | MTREDGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFADEEKPQ* |
Ga0078894_101213235 | 3300005662 | Freshwater Lake | MTITLTREEGYYCVVCGRFLPEEDGVVVHDDVPHPVDMDFGDEENPQ* |
Ga0078894_113042802 | 3300005662 | Freshwater Lake | MDDGYYCVVCGRFLLADEYGVILHDDVPHPADMDFGDEEKPQ* |
Ga0078894_114407312 | 3300005662 | Freshwater Lake | MNDAPKGYYCVVCGRFIEADEYGVIVHDDIPHPPNMDFADEENPQ* |
Ga0073685_10476933 | 3300005664 | Aquatic | MTWSEVLDDQDGYWCVVCGKFLPANEYGVVVHDNIPHPPSMTFDEMDNPQ* |
Ga0074421_1038739 | 3300005672 | Lab-Scale Ebpr Bioreactor | MKKEGYWCVVCGRFLAADNAGVIVHDDVPHPETMTFNEEDVQQ* |
Ga0079957_10313659 | 3300005805 | Lake | MIDKDVYYCVVCGRGIERDEHGIFVHDDVPHPPDMTFDEEETPQ* |
Ga0079957_11064915 | 3300005805 | Lake | MTITLTREEGYYCVICGKFLPEEDGVIVHDDVPHPIDMDFGDEEKPQ* |
Ga0079957_11588835 | 3300005805 | Lake | MNQEDGYYCFVCGKYIEAVDGVIVHDDIPHPPDMSFDEEENP |
Ga0079957_11966301 | 3300005805 | Lake | MTEGYYCVVCGKYIEAVDGVIVHDDIPHPPDMSFDEEENP |
Ga0075470_100025236 | 3300006030 | Aqueous | MDEGYYCVLCGKYIEAVDGVIVHDDIPHPDMSFDDEENPQ* |
Ga0075470_100299985 | 3300006030 | Aqueous | MSDGYYCIVCGRFLPEEDGLIVHDDVPHPVDMTFDEEENPQ* |
Ga0075470_100731321 | 3300006030 | Aqueous | YCVVCGRFLPADEDGVIVHDDIPHPPEMDFADEENPQ* |
Ga0075012_100358196 | 3300006033 | Watersheds | MSGYYCVVCGRLLPEIDGVIVHDDVPHPGNMDFADEGNPQ* |
Ga0075465_101671742 | 3300006037 | Aqueous | LNDLLCAGGYWCVVCGRHLPADEDGLIVHDDVPHPEDMTFDEEERPQ* |
Ga0075461_102493732 | 3300006637 | Aqueous | MTITLTSEEGYYCVVCGRFLPEENGVIVHDDVPHPVDMDFGDEEKPQ* |
Ga0075471_101546272 | 3300006641 | Aqueous | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMSFDDEENPQ* |
Ga0075471_101907794 | 3300006641 | Aqueous | MTITLTREEGYYCVVCGRFLLEEDGVIVHDDVPHPVDMDFGDEENPQ* |
Ga0075471_104815183 | 3300006641 | Aqueous | MNDGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFGDEDKPQ* |
Ga0070749_1002458612 | 3300006802 | Aqueous | MNKEGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFGDEENPQ* |
Ga0070749_101034765 | 3300006802 | Aqueous | MNEEGYYCVVCGRFLPADEHGVIVHDDIEHPQEMDFADEEKPQ* |
Ga0070749_102986261 | 3300006802 | Aqueous | YYCVVCGRFLPADEDGVIVHDDIPHPPEMDFADEENPQ* |
Ga0070749_103097481 | 3300006802 | Aqueous | MTTLTRKEGYYCVVCGRFLPEEDGVIVHDDVPHPVDMD |
Ga0070749_103995531 | 3300006802 | Aqueous | QTYWCVVCQRELIGFGGVFVHDDIPHPPEMDFAEEENPQ* |
Ga0070749_104913043 | 3300006802 | Aqueous | MTAEDGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFADEEKPQ* |
Ga0070749_105210112 | 3300006802 | Aqueous | MNDEPEGYYCVVCGRFIEANKYGVIVHDDVHHPPNMDFADEENPQ* |
Ga0070749_105446183 | 3300006802 | Aqueous | YYCVVCGRFLPEEDGVIVHDDVPHPVDMDFGDEEKPQ* |
Ga0070749_105854352 | 3300006802 | Aqueous | MITLTREEADGYYCIVCGRFLSEEDGLIVHDDVPHPVDMTFDEEENPQ* |
Ga0070749_105948202 | 3300006802 | Aqueous | MNEEGYYCVVCGRFLPADEYGVIVHDDIEHPPEMNFDDEEKPQ* |
Ga0070749_107224512 | 3300006802 | Aqueous | VITLTREEGYYCVVCGKFLPEEGGLIVHDDVPHPADMDFGDEEKPQ* |
Ga0075464_101396583 | 3300006805 | Aqueous | MSDGYYCVVCGRFLLANEHGVIVHDDILHPQEIDFADEEKPQ* |
Ga0075464_103018355 | 3300006805 | Aqueous | MTGYYCVVCGKFLPADEHGVIVHNDVPHPVDMDFGDEEKPQ* |
Ga0075464_107345312 | 3300006805 | Aqueous | SQTQGEEHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMSFDDEENPQ* |
Ga0075459_10102432 | 3300006863 | Aqueous | MITLTREEGYYCVVCGRFLPEEDGVIVHDDVPHSVDMDFGDEENTK* |
Ga0075459_10349834 | 3300006863 | Aqueous | GYYCVVCGKFLPLENGVIVHDDVPHPADMKFNDEETTQ* |
Ga0075459_10696971 | 3300006863 | Aqueous | MIEVLKQGYHCVVCGRFLPANEHGVIVHDDIEHPQEMDFGDEEKPQ* |
Ga0075472_104346502 | 3300006917 | Aqueous | MTEGYYCIVCGRFLLANELGVIVHDDISHPHEMAFDDEENPQ* |
Ga0075472_105401581 | 3300006917 | Aqueous | MMEGYYCVVCGKFLPADERGVIVHDDISHPPDMDFDEEARPQ* |
Ga0102978_11285992 | 3300007177 | Freshwater Lake | MSERDIYYCVVCGRAIEANEYGVFVHDDTPHPPDMDFSEEDKPQ* |
Ga0099847_12181801 | 3300007540 | Aqueous | HMNEEGYYCVVCGRFLPADEHGVIVHDDIEHPQEMDFADEEKPQ* |
Ga0099846_13309871 | 3300007542 | Aqueous | MTDKEVMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEMDFGDEENQQ* |
Ga0102920_11943102 | 3300007600 | Estuarine | MTEGYYGIVCGRFLLANEFGVIVHDDISHPPEMSFDDEENPQ* |
Ga0102865_10506334 | 3300007639 | Estuarine | MTDKEVMKEGYYCVICGRFLPDEHGVIVHDDIEHPQEIDFGDEEKPQ* |
Ga0102859_12021762 | 3300007708 | Estuarine | SQTQAKERLCRGEEHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEKNPQ* |
Ga0104988_1056228 | 3300007735 | Freshwater | MDEGYYCVVCGKYIEAVDGVIVHDDIPHPDMAFDDEEKPQ* |
Ga0105746_13476312 | 3300007973 | Estuary Water | MKPDIYYCVVCGRALEAVDGVFVHDDVPHPVDMTFDEDDNPQ* |
Ga0105747_10055791 | 3300007974 | Estuary Water | EHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEKNPQ* |
Ga0105747_11617082 | 3300007974 | Estuary Water | MDDGYYCVICGRYIEAVDGVVVHDDVPHPDMAFDDEERPQ* |
Ga0108970_103427781 | 3300008055 | Estuary | EHMTEGYYCIVCGRFLLANEFGVIVHDDISHPHEMAFDDEEKPQ* |
Ga0108970_111679901 | 3300008055 | Estuary | EHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEENPQ* |
Ga0114340_10408036 | 3300008107 | Freshwater, Plankton | MDDGYYCVICGRYIEAVDGVVVHDDIPHPDMAFDDEEAD* |
Ga0114340_11089451 | 3300008107 | Freshwater, Plankton | AKERLRRGEHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEENPQ* |
Ga0114340_12671172 | 3300008107 | Freshwater, Plankton | MDDGYYCVICGRYIKAVDGVVVHDNVPHPDMAFDDEERPQ* |
Ga0114344_12230091 | 3300008111 | Freshwater, Plankton | MTDKEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEIDFGDEEKPQ* |
Ga0114346_10524224 | 3300008113 | Freshwater, Plankton | MTITLTREEGYYCVVCGRFLLEEDGVIVHDDVPHPLDMDFGDEEKPQ* |
Ga0114346_13348221 | 3300008113 | Freshwater, Plankton | EEMIDEHVYYCVVCGRGIERDEYGIFVNDDVPHPPDMTFDEEEKPQ* |
Ga0114347_12087993 | 3300008114 | Freshwater, Plankton | MDDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEEKPQ* |
Ga0114355_11338904 | 3300008120 | Freshwater, Plankton | MINGYHCVICGRFLPEKDGVIVHDDVLHPVDINFDDEEKPQ* |
Ga0114349_10677003 | 3300008263 | Freshwater, Plankton | MDDGYYCVICGRYIEAVDGVVVHDAVPHPDMAFDDEEKPQ* |
Ga0114363_100019082 | 3300008266 | Freshwater, Plankton | RTMDDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ* |
Ga0114363_10003185 | 3300008266 | Freshwater, Plankton | MTQDDGYYCVVCGRLLPSNDGIIVHDDVPHPPDMTFDEEEKPQ* |
Ga0114363_100924814 | 3300008266 | Freshwater, Plankton | MTITLTREEGYYCVICGRFLPEEDGLIVHDDVPHPVDMTF |
Ga0114363_10640113 | 3300008266 | Freshwater, Plankton | MTMILTREDDYYCVVCGRFLPEEDGVIVHDDVPHPIDMDFGDEEKPQ* |
Ga0114363_11122544 | 3300008266 | Freshwater, Plankton | MTITLTREEGYYCVVCGRFLPEEDGVIAHDDVPHPADMDFGDEEK |
Ga0114363_11681211 | 3300008266 | Freshwater, Plankton | MTITLTRKEGYYCVVCGRFLPEEDGVIAHDDVPHPADMDFGDEEK |
Ga0114363_12478171 | 3300008266 | Freshwater, Plankton | SKRRRAMDEGYYCVVCVKYIEAVDDVIVHDDIPHPVDMAFDEEENPQ* |
Ga0114364_100514021 | 3300008267 | Freshwater, Plankton | MNDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ* |
Ga0114364_10137644 | 3300008267 | Freshwater, Plankton | MSIEAMKQDEGYYCVVCGKFLPADEHGVILHDDLPHPVDMDFGDEEKPQ* |
Ga0114876_10847404 | 3300008448 | Freshwater Lake | MTDKEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEIDFGD |
Ga0114876_11603472 | 3300008448 | Freshwater Lake | TQGEEHMSDGYYCVVCGRFLLANEHGVIVHDDILHPQEMDFADEEKPQ* |
Ga0114876_12173673 | 3300008448 | Freshwater Lake | MTITLTREEGYYCVVCGRFLPEEDGVIAHDDVPHPADMDFGDEE |
Ga0114876_12468531 | 3300008448 | Freshwater Lake | MTDKEVMKEGYYCVICGRFLPADEHGVIVHDDIEHPQE |
Ga0114880_10470022 | 3300008450 | Freshwater Lake | MNGYYCVVCGKLLIADEHGVIVHDDVPHPVDMDFADEEKPQ* |
Ga0114880_12446371 | 3300008450 | Freshwater Lake | VEEKMSIEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEMDFGDEENQQ* |
Ga0114880_12729931 | 3300008450 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFD |
Ga0114973_100511347 | 3300009068 | Freshwater Lake | MDDGYYCVICSRFLPSDEHGVIVHDDVPHPDMDFAEEEKPQ* |
Ga0114966_104605512 | 3300009161 | Freshwater Lake | LRRGKEHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMSFDDEENPQ* |
Ga0105102_106440372 | 3300009165 | Freshwater Sediment | MNDAPKGYYCVVCGRFIEADKYGVIVHDDIPHPPNMDFADEEKPQ* |
Ga0105104_105458622 | 3300009168 | Freshwater Sediment | MSDALEGYYCVVCGRFIKADEHGVIVHDDVPHPPNMDFADEENPQ* |
Ga0105097_105375742 | 3300009169 | Freshwater Sediment | MIMSDAPEGYYCVVCGRFIEADEHGVIVHDDVPHPPNMDFADEENPQ* |
Ga0114979_102827573 | 3300009180 | Freshwater Lake | MDDGYYCVICGRYIEADEYGVIVHDDIPHPPEMDFAEEENTQ* |
Ga0114976_1000354518 | 3300009184 | Freshwater Lake | MDDGYYCVICSRFLPSDEHGVIVHDDVPHSDMDFAEEEKPQ* |
Ga0114976_106640963 | 3300009184 | Freshwater Lake | MSIDAMKQGYYCVVCGRFLPADEHGVIVHDDVPHPIDMDFGD |
Ga0114983_10365783 | 3300009194 | Deep Subsurface | MADGYYCVVCGRYIEAVDGVVVHDDVPHPDMAFDDEEKPQ* |
Ga0114982_11979642 | 3300009419 | Deep Subsurface | VSLSRRRITMDEGYYCVVCGRFLLAVDGVVVHDNVPHPDMTFDDEENPQ* |
Ga0116245_104871643 | 3300010338 | Anaerobic Digestor Sludge | AGYWCVICGRFLRADDGVIVHDEIPHPTEMIFEETMQ* |
Ga0129333_1002420112 | 3300010354 | Freshwater To Marine Saline Gradient | MSIEAMKEGYYCVICGRFLPADEHGVIVHDDIEHSQEMDFGDEENPQ* |
Ga0129333_101931591 | 3300010354 | Freshwater To Marine Saline Gradient | MEEMIDEDVYYCVVCGRGIERDEYGVFVHDDVPHPPEMTFDEEEKPQ* |
Ga0129333_102372833 | 3300010354 | Freshwater To Marine Saline Gradient | MERPEMIDEDVYYCVVCGRGIERDEYGIFVHDDVPHPPEMTFDEEEKPQ* |
Ga0129333_104349831 | 3300010354 | Freshwater To Marine Saline Gradient | GYYCVVCGRFLPTDEYGVIVHDDIPHPPEMDFGDEDRPQ* |
Ga0129333_107733642 | 3300010354 | Freshwater To Marine Saline Gradient | VDDGYYCVVCCRYIEADEYGVIVHDDVPHMPEMDFAEEENPQ* |
Ga0129333_109349252 | 3300010354 | Freshwater To Marine Saline Gradient | MTEEGYYCVVCGRFLPTDEYGVIVHDDVPHPPDMDFGDEDRPQ* |
Ga0129333_110864651 | 3300010354 | Freshwater To Marine Saline Gradient | MNDGYYCMVCGRYLEANEDGVIVHDDVPHPPEMDFADEEKPQ* |
Ga0129333_117011572 | 3300010354 | Freshwater To Marine Saline Gradient | MNDGYYCVVCGRYIEADKYGVIVHDDIPHPDMDFAEEEKPQ* |
Ga0116237_106278634 | 3300010356 | Anaerobic Digestor Sludge | MTITLTREEGYYCVICGKFLPEEDGVIVHDDVPHPVDMDFGDEEKPQ* |
Ga0129336_102811022 | 3300010370 | Freshwater To Marine Saline Gradient | MEEMNDEDVYYCVVCGRGIERDEYGIFVHDDVPHPPDMTFDEEEKPQ* |
Ga0129336_107061252 | 3300010370 | Freshwater To Marine Saline Gradient | DEDVYYCVVCGRGIERDEYGIFVHDDVPHPPEMTFDEEEKPQ* |
Ga0136551_10272602 | 3300010388 | Pond Fresh Water | MNSDGYYCVVCGRYIEADEHGVIVHDNVPHPPDMDFAEEARPQ* |
Ga0116241_106660552 | 3300010429 | Anaerobic Digestor Sludge | VLKHKDITTDMMDGLCADGYWCVVCWRFLEAEYGVIVHDNVPHPKDMTFDDEDKPQ* |
Ga0151517_16055 | 3300011113 | Freshwater | MDEGYYCVVCGKFIEAVDGVIVHDDIPHPDMAFDDEENPQ* |
Ga0151514_1096225 | 3300011115 | Freshwater | MTGYYCVVCGKFLPEDEHGIIVHEDVPHPVDMDFGDEEKPQ* |
Ga0151514_109814 | 3300011115 | Freshwater | MKGNNMTGYYCVVCGKFLPEDEHGIIVHDDVPHPVDMDFGDEEKPQ* |
Ga0136709_100084012 | 3300011184 | Freshwater | MNDGYYCVVCGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ* |
Ga0151620_11208531 | 3300011268 | Freshwater | MTDKEVMKEGYYCVICGRFLSADEHGVIVHDDIEHPQEIDFGDEEKPQ* |
Ga0153800_10003211 | 3300011995 | Freshwater | MSIEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEI |
Ga0153800_10389721 | 3300011995 | Freshwater | MTDKEVMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEI |
Ga0119955_100099814 | 3300012006 | Freshwater | VKDGYYCVVCGRFLPANEYGVIVHDDIEHPQEMDFVDEEKPQ* |
Ga0153799_100174522 | 3300012012 | Freshwater | MDEGYKRIIDQGYYCVVCGKYIESVDGVIVHDDIPHPYMAFDDEENPQ* |
Ga0153799_10440711 | 3300012012 | Freshwater | GYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEKNPQ* |
Ga0119869_11684722 | 3300012020 | Activated Sludge | VLKHKDITTDMMDGLCADGYWCVVCGRFLEAEYGVIVHDNVPHPKDMTFDDEDKPQ* |
Ga0157613_10458291 | 3300012720 | Freshwater | MTITLTREEGYYCVVCGRFLPEEDGVVVHDDVPHPIDMDFGDE |
Ga0159060_10029567 | 3300012990 | Hydrocarbon Resource Environments | MDEGYYCVVCGRYIEANNNGVIVHDDIPHPPEMDFAEEEKPQ* |
Ga0159060_10634413 | 3300012990 | Hydrocarbon Resource Environments | MNDGYYCVVCGRYIEADQHGVIVHDDIPHPDMDFAEEEKLQ* |
Ga0164293_1010161410 | 3300013004 | Freshwater | MNDEDVYYCVVCGRGIERNEDGIFVHDPVPHPPDMTFDEEETPQ* |
Ga0164293_108278962 | 3300013004 | Freshwater | MTGYYCVVCCKFLLADKHGVIVHDDVPHPVDMDFGDEEKPQ* |
Ga0164292_103361032 | 3300013005 | Freshwater | MKPDIYYCVVCGRGIEPDEYGVYVHDDVPHPPDMAFDEEENPQ* |
Ga0164292_103500421 | 3300013005 | Freshwater | DSNKATKLERKQMNDEDVYYCVVCGRGIERNEDGIFVHDPVPHPPDMTFDEEETPQ* |
Ga0164292_104821441 | 3300013005 | Freshwater | KERLRRGEHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEENPQ* |
Ga0164292_105255622 | 3300013005 | Freshwater | MTITLTREEGYYCVVCGRFLPEEDGVVVHDDVPHPIDMDFGDEEKPQ* |
Ga0119894_10035754 | 3300013793 | Wastewater | MMDGLCADGYWCVVCGRFLEAEYGVIVHDNVPHPKDMTFDDEDKPQ* |
Ga0172378_108926412 | 3300014203 | Groundwater | VVCGRHLPADKDGVIVHDDVPHPEEMTFDEEERPQ* |
Ga0119896_10019474 | 3300014810 | Wastewater | MSECVYHCVVCGRSLPIIDGVIVHDDVPHPEIMDFAEEERPQ* |
Ga0119960_10404172 | 3300014811 | Aquatic | MGEENMSDGYYCVVCGRFLLANEHGVIVHDDILHPQEMDFADEEKPQ* |
Ga0119942_10345792 | 3300014957 | Aquatic | MDEGYYCVVCGKYIEAVDDVIAHDDIPHPVDMAFDEEENPQ* |
Ga0163144_112439941 | 3300015360 | Freshwater Microbial Mat | CMSEGYWCVVCGCYLPANEDGVIVHKDIPHPEMMAFDDDERPQ* |
Ga0181363_10609794 | 3300017707 | Freshwater Lake | TGYYCVVCGKFLLADEHGVIVHDDVPHPVDMDFGDEEKPQ |
Ga0181350_10265384 | 3300017716 | Freshwater Lake | RRDVRSSKYFEGAQHMTGYYCVVCGKFLPADEHDVIVHDNVPHPVDMDFGDEEKPQ |
Ga0181352_11166373 | 3300017747 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGFIVHDDISHPPEMAFDDEENPQ |
Ga0181352_11361232 | 3300017747 | Freshwater Lake | MNREDGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFADEEKPQ |
Ga0181344_100221815 | 3300017754 | Freshwater Lake | MTITLTREEGYYCVVCGRFLPEEDGVIVHDDVPHPTDMDFGDEDKPQ |
Ga0181344_10088714 | 3300017754 | Freshwater Lake | YVGNARPMERPRMIDEDVYYCVVCGRGIERNEDGVFVHDPVPHPLDMTFDEEERLQ |
Ga0181344_10688206 | 3300017754 | Freshwater Lake | MNPEDVYYCVVCGRGIERNEDGIFVHDDVPHPPDMTFDEE |
Ga0181344_11313042 | 3300017754 | Freshwater Lake | MTGYYCVVCGKFLLADEHGVIVHDDVPHPVDMDFGDEEKPQ |
Ga0181344_11322151 | 3300017754 | Freshwater Lake | MTGYYCVVCGKFLPADEHGVIVHDDVPHPVDMDFGDE |
Ga0181343_10284664 | 3300017766 | Freshwater Lake | MREGYHCVVCGRFLPADEYGVIVHDDIEHPQEMDFADEEKPQ |
Ga0181343_11849872 | 3300017766 | Freshwater Lake | MDDGYYCVVCGRFLLADEYGVILHDDVPHPADMDFGDEEKPQ |
Ga0181346_11494113 | 3300017780 | Freshwater Lake | MNDGYHCVVCGRFLLAVDGVIVHDDIPHPDMAFDDEKNPQ |
Ga0181346_12507893 | 3300017780 | Freshwater Lake | MTITLTRAEGYYCVVCGRFLPEEDGVVVHDDVPHPVDMD |
Ga0181346_12622543 | 3300017780 | Freshwater Lake | MDDGYYCVVCGKYIEAVDGVIVHDAIPHPPDMAFDEEEKPQ |
Ga0181346_12793631 | 3300017780 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPHEMAFDDEE |
Ga0181348_11820713 | 3300017784 | Freshwater Lake | MTGYYCVVCGKFLPADEHDVIVHDDVPHPVDMDFGDEEKPQ |
Ga0181355_10252405 | 3300017785 | Freshwater Lake | MTGYYCVVCGKFLPADEHGVIVHANVPHPVDMDFADEEKPQ |
Ga0181355_10822715 | 3300017785 | Freshwater Lake | MIDEDVYYSVVCGRGIERDEYGIFVHDDVPHSPDMTFDEEEKPQ |
Ga0181355_11916184 | 3300017785 | Freshwater Lake | MTQDDGYYCVVCGRLLPSNDGIIFHDAVPHPPGMTFDDEE |
Ga0181355_13188611 | 3300017785 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPHEMAFDDEEN |
Ga0181355_13394632 | 3300017785 | Freshwater Lake | MKPASDVYYCVVCGRAIEPDEYGVYVHDDMPHPADMTFDEDENPQ |
Ga0181606_106899052 | 3300018048 | Salt Marsh | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMSFDDEENPQ |
Ga0181553_101599124 | 3300018416 | Salt Marsh | MNEEGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFVDEEKPQ |
Ga0181563_104560171 | 3300018420 | Salt Marsh | TEGYYCVICGKFIEAVDGVIVHDDIPHPPLMDFDEESNPQ |
Ga0181360_1004571 | 3300019781 | Freshwater Lake | MTDKEVMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEIDFGDEEKPQ |
Ga0181359_10321174 | 3300019784 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEKNPQ |
Ga0181359_10345553 | 3300019784 | Freshwater Lake | MDETEGYYCVICGKFIEAVDGVIVHDDIPHPPLMDFDEESNPQ |
Ga0181359_10471335 | 3300019784 | Freshwater Lake | MTITLTRKEGYYCVVCGRFLLEEDGVIVHDDVPHPVDMDFGDEENPQ |
Ga0181359_11335282 | 3300019784 | Freshwater Lake | MSDGYYCVVCGRFLLANEHGVIVHDDILHPQEMDFADEEKPQ |
Ga0181359_11358252 | 3300019784 | Freshwater Lake | DDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ |
Ga0208050_10221122 | 3300020498 | Freshwater | MAETDGYYCVICGKFIEAVNGVIVHDDIPHPPLMDFDEESNPQ |
Ga0213922_10134307 | 3300021956 | Freshwater | MNDKDVYYCVVCGRGIERNEYGIFAHDDVPHPPDMTFDEEETPQ |
Ga0213922_10847753 | 3300021956 | Freshwater | MIEVLKQGYHCVVCGRFLPANEHGVIVHDDIEHPQEMDFGDEEKPQ |
Ga0222714_100816737 | 3300021961 | Estuarine Water | MIEVLKQGYHCVVCGRFLPADEHGVIVHDDIEHPQEMDFADEEKPQ |
Ga0222714_101080706 | 3300021961 | Estuarine Water | MNDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEENPQ |
Ga0222714_101860641 | 3300021961 | Estuarine Water | MIEEGYYCVVCGRFLPADEHGVIVHDDIEHPPEMDFADEEK |
Ga0222714_103265963 | 3300021961 | Estuarine Water | MDEGYYCVVCGKFIEAVDGVIVHDDIPHPDMAFDDEENPQ |
Ga0222713_1000448532 | 3300021962 | Estuarine Water | MIEEGYYCVVCGRFLPADEHGVIVHDDIEHPPEMDFADEEKPQ |
Ga0222713_104274454 | 3300021962 | Estuarine Water | MTDGYYCVVCGKYIEAVDGVIVHDDIPHPPDMAFDEEEKPQ |
Ga0222713_108472461 | 3300021962 | Estuarine Water | RRRTMDEGYYCVVCGKYIEAVDGVIVHDDIPHPDMAFDDEEKPQ |
Ga0222712_100813875 | 3300021963 | Estuarine Water | MITLIREEADGYYCVVCGKFLPLENGVIVYDDVPHSADMKFNDEET |
Ga0222712_104167643 | 3300021963 | Estuarine Water | MITLTREEADGYYCIVCGRFLPEEDGLIVHDDVPHPVDMTFDEEENPQ |
Ga0222712_104807681 | 3300021963 | Estuarine Water | MTREDGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFA |
Ga0222712_105022523 | 3300021963 | Estuarine Water | GMINLTREEADGYYCVVCGKFLPLENGVIVYDDVPHSADMKFNDEETTQ |
Ga0181353_10065094 | 3300022179 | Freshwater Lake | MSIEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEMDFGDEENQQ |
Ga0181353_10136967 | 3300022179 | Freshwater Lake | MIDEDVYYCVVCGRGIERDEYGIFVHDDVPHSPDMTFDEEEKPQ |
Ga0181353_10143992 | 3300022179 | Freshwater Lake | MKTDVYYCVVCGHDIEPNEFGVYVHDDVPHPPDMAFDEDKNPQ |
Ga0181353_10336552 | 3300022179 | Freshwater Lake | MTITLTREEGYYCVVCGRFLPEEDGVVVHDDVPHPIDMDFGDEEKPQ |
Ga0181353_10751974 | 3300022179 | Freshwater Lake | MDEGYYCVVCGKYIEAVDDVIVHDDIPHPVDMAFDEEENPQ |
Ga0181353_10786772 | 3300022179 | Freshwater Lake | MTGYYCVVCCKFLLADKHGVIVHDDVPHPVDMDFGDEEKPQ |
Ga0181353_10969783 | 3300022179 | Freshwater Lake | VDDGYYCVVCCRYIEADEYGVIVHDDVPHMPEMDFAEEENPQ |
Ga0196901_10674245 | 3300022200 | Aqueous | MTDGYYCVVCGKFLEADDGVIVHDDVPHPIDMDFGDEEKPQ |
Ga0181351_12009592 | 3300022407 | Freshwater Lake | MIDEDVYYCVVCGRGIERDEYGIFAHDDVPHPPDMTFDEEERLQ |
Ga0181351_12155862 | 3300022407 | Freshwater Lake | MTITLTRAEGYYCVVCGRFLPEEDGVVVHDDVPHPVDMDFGDEENPQ |
Ga0236341_11400681 | 3300022591 | Freshwater | GYWCVVCGRFLPEDPEDDDIIVHDDVPHPIDMTFEEDNNPQ |
Ga0214923_100010591 | 3300023179 | Freshwater | MDETEGYYCVICGKFIEAVDGVIVHDDIPHPPLMDFD |
Ga0214919_100032643 | 3300023184 | Freshwater | VICGRFLPANEYGVIVHDDVPHPADMDFGDEEKPQ |
Ga0214919_106880913 | 3300023184 | Freshwater | MTDKEAMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEMDFGDEEKPQ |
Ga0256681_118819172 | 3300023311 | Freshwater | MPGYWCVVCGRFLPEDPEDDDIIVHDDVPHPIDMTFEEDNNPQ |
Ga0255207_10133814 | 3300024277 | Freshwater | MNDGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFGDEDKPQ |
Ga0255147_10001814 | 3300024289 | Freshwater | MSERNIYYCVVCGRAIEADDHDVFVHDDVPHPLDMDFSEEDKPQ |
Ga0244776_104940482 | 3300024348 | Estuarine | ERLCRGEEHMTEGYYCIVCGRFLLANEFGVIVHDDISHPHEMAFDDEENPQ |
Ga0255181_100009212 | 3300024502 | Freshwater | MDEGYYCVVCGRYLEANEDRVIVHDDVLHPPEMDFADEEKPQ |
Ga0255168_10299254 | 3300024506 | Freshwater | YYCVICGRFLPADEYGVIVHDDIPHPPEMDFAEEEKPQ |
Ga0255177_10310802 | 3300024514 | Freshwater | MSERNIYYCVVCGRAIEADDHDVFVHDDVPHPLDMDFSEED |
Ga0209615_1097472 | 3300025075 | Freshwater | MTEGYYCIVCGRFLLANEFGVIIHDDISHPPEMAFDDEENPQ |
Ga0209616_100151611 | 3300025091 | Freshwater | MNDGYYCVVCGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ |
Ga0208424_10177024 | 3300025445 | Aqueous | GYYCVVCGKFLPLENGVIVHDDVPHPADMKFNDEETTQ |
Ga0208424_10511082 | 3300025445 | Aqueous | MNKEGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFGDEENPQ |
Ga0208546_100024416 | 3300025585 | Aqueous | MDEGYYCVLCGKYIEAVDGVIVHDDIPHPDMSFDDEENPQ |
Ga0208004_11435192 | 3300025630 | Aqueous | MTITLTSEEGYYCVVCGRFLPEENGVIVHDDVPHPVDMDFGDEEKPQ |
Ga0208542_12065381 | 3300025818 | Aqueous | KHYCAFRSQTKAKERLCRGEKHMNKEGYYCVVCGRFLPADEYGVIVHDDIEHPQEMDFGDEENPQ |
Ga0208822_11400131 | 3300025866 | Anaerobic Digestor Sludge | GGYWCVVCGRYLPSDEDGLIVHDNVPHPEDMTFDEEEMPQ |
Ga0208644_13169503 | 3300025889 | Aqueous | YYCVVCGRFLPEEDGVIVHDDVPHPVDMDFGDEEKPQ |
Ga0208916_100144305 | 3300025896 | Aqueous | VVCGRHLPADKDGVIVHDDVPHPEDMTFDEEERPQ |
Ga0208916_101643463 | 3300025896 | Aqueous | ERLRRGKEHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEENPQ |
Ga0255074_10151294 | 3300027121 | Freshwater | MTDGYYCVICGRYLEADDESVIVHDPIPHPDSMTFD |
Ga0255111_10907261 | 3300027154 | Freshwater | MNEKTEGYHCVVCGRFLPADEYGVIVHDDIPHPPEMDFAEEE |
Ga0255096_10530881 | 3300027302 | Freshwater | IVCGRFLLANEFGVIVHDDISHPPEMAFDDEKNPQ |
Ga0255096_10992901 | 3300027302 | Freshwater | MSIEAMKQDEGYYCVVCGKFLPADEHGVILHDDLPHPVDMDFGDEEKPQ |
Ga0255146_10518174 | 3300027396 | Freshwater | GYYCVICGRFLPADEYGVIVHDDIPHPPEMDFAEEEKPQ |
Ga0255117_10237781 | 3300027600 | Freshwater | MNEKTEGYHCVVCGRFLPADEYGVIVHDDIPHPPEMD |
Ga0208975_11484713 | 3300027659 | Freshwater Lentic | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEEN |
Ga0209704_12459832 | 3300027693 | Freshwater Sediment | MNDAPKGYYCVVCGRFIEADKYGVIVHDDIPHPPNMDFADEEKPQ |
Ga0209599_100408103 | 3300027710 | Deep Subsurface | MDEGYYCVVCGRFLLAVDGVVVHDNVPHPDMTFDDEENPQ |
Ga0209087_100007260 | 3300027734 | Freshwater Lake | MDDGYYCVICSRFLPSDEHGVIVHDDVPHSDMDFAEEEKPQ |
Ga0209088_102430222 | 3300027763 | Freshwater Lake | MDDGYYCVICGRYIEADEYGVIVHDDIPHPPEMDFAEEENTQ |
Ga0209246_1001261611 | 3300027785 | Freshwater Lake | MTEGYYCIVCGRFLLANEFGVIVHDDISHPHEMAFDDE |
Ga0209246_101708752 | 3300027785 | Freshwater Lake | FTLCGRSQTQGEEHMSDGYYCVVCGRFLLANEHGVIVHDDILHPQEMDFADEEKPQ |
Ga0209358_101836184 | 3300027804 | Freshwater Lake | MTITLTREEGYYCVVCGRFLLEEDGVIVHDDVPHPVDMDFGDEENPQ |
Ga0209358_102104911 | 3300027804 | Freshwater Lake | ITLTREEGYYCVVCGRFLPEEDGVVVHDDVPHPIDMDFGDEEKPQ |
Ga0209990_102802602 | 3300027816 | Freshwater Lake | MTITLTREEGYYCVVCGRFLPEEDGVIAHDDVPHPADMDFGDEEKPQ |
Ga0209990_103188731 | 3300027816 | Freshwater Lake | DGYYCVICGRYIKAVDGVVVHDNVPHPDMAFDDEERPQ |
Ga0209066_102405732 | 3300027851 | Watersheds | MSGYYCVVCGRLLPEIDGVIVHDDVPHPGNMDFADEGNPQ |
Ga0209668_109831492 | 3300027899 | Freshwater Lake Sediment | MTGYYCVVCGKFLPADEHGVIVHEDVSHPVDMDFGDEEKPQ |
Ga0209253_102494236 | 3300027900 | Freshwater Lake Sediment | YCVICGKFIEAVDGVIVHDDIPHPPLMDFDEESNPQ |
Ga0209400_10533487 | 3300027963 | Freshwater Lake | MDDGYYCVICSRFLPSDEHGVIVHDDVPHPDMDFAEEEKPQ |
Ga0247723_100300524 | 3300028025 | Deep Subsurface Sediment | MSDGYYCVVCGRFLLANEHGVIVHDDILHPQEMDF |
Ga0247723_100319429 | 3300028025 | Deep Subsurface Sediment | MSDGYHCVVCGRFLLANEHGVIVHDDILHPQEMDFADEEKPQ |
Ga0247723_10090265 | 3300028025 | Deep Subsurface Sediment | CADGYWCVVCGRYLPDDDGVVVHDDVPHPEMTFDEEERPQ |
Ga0265297_1000146767 | 3300029288 | Landfill Leachate | MNAPTQAGYWCVVCGRFLPSIDGVITHDQVPHPDNMQFDDEDNPQ |
Ga0119911_1003106 | 3300029931 | Activated Sludge | MKKEGYWCVVCGRFLAADNAGVIVHDDVPHPETMTFNEEDVQQ |
Ga0315291_104358644 | 3300031707 | Sediment | MIEVWKQGYHCVICGRFLLADEYGVILHDDIEHPPEMNFDDEENPQ |
Ga0315291_115343582 | 3300031707 | Sediment | LNELLEGGGYWCVVCGRYLPDDDGVIVHDDVPHPKEMAFDDEEKPQ |
Ga0315907_100003921 | 3300031758 | Freshwater | TMDDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ |
Ga0315907_1000211712 | 3300031758 | Freshwater | MDDGYYCVICGRYIEAVDGVVVHDAVPHPDMAFDDEEKPQ |
Ga0315907_103239433 | 3300031758 | Freshwater | MTITLTRKEGYYCVVCGRFLPEEDGVIAHDDVPHPADMDFGDEEKPQ |
Ga0315907_106715862 | 3300031758 | Freshwater | EHMTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEENPQ |
Ga0315899_105826955 | 3300031784 | Freshwater | KGTSMTDKEVMKEGYYCVICGRFLPADEHGVIVHDDIEHPQEIDFGDEEKPQ |
Ga0315900_101185905 | 3300031787 | Freshwater | REDGPTEGEEHMSDGYYCVVCGRFLLANEHGVIVHDDILHPQEMDFADEEKPQ |
Ga0315900_102885725 | 3300031787 | Freshwater | MNDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ |
Ga0315900_104008133 | 3300031787 | Freshwater | MTITLTREEGYYCVVCGRFLPEEDGVIAHDDVPHPADMDF |
Ga0315900_104211834 | 3300031787 | Freshwater | MTTMLTREDDYYCVVCGRFLPEEDGVIVHDDVPHPIDMDFGDEEKPQ |
Ga0315900_105668181 | 3300031787 | Freshwater | PSKPNSRRRTMDDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEERPQ |
Ga0315900_105828244 | 3300031787 | Freshwater | MDDGYYCVVCGKYIEAVDGVIVHDDIPHPPDMAFDEEERPQ |
Ga0315900_108514222 | 3300031787 | Freshwater | MNEDQNGYWCVICARLLPADDDGVIVHDDIEHPPEMDFGEEDK |
Ga0315909_100003221 | 3300031857 | Freshwater | MDDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDD |
Ga0315909_1000104960 | 3300031857 | Freshwater | MSDGYYCVVCGRFLLANEHGVIVHDDILHPQKMDFADEEKPQ |
Ga0315909_100307241 | 3300031857 | Freshwater | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEE |
Ga0315909_100702221 | 3300031857 | Freshwater | MTKGYYCIVCGRFLLANEFGVIVHDDISHPPEMAFDDEENPQ |
Ga0315909_103650503 | 3300031857 | Freshwater | MTMILTREDDYYCVVCGRFLPEEDGVIVHDDVPHPIDMDFGDEEKPQ |
Ga0315909_104299992 | 3300031857 | Freshwater | MNGYYCVVCGKLLIADEHGVIVHDDVPHPVDMDFADEEKPQ |
Ga0315909_107290193 | 3300031857 | Freshwater | EGYYCVVCGRFLPEEDGVIAHDDVPHPADMDFGDEEKPQ |
Ga0315904_101033061 | 3300031951 | Freshwater | MTEGYYCIVCGRFLLANEFGVIVHDDISHPPEMAF |
Ga0315904_103008884 | 3300031951 | Freshwater | MINGYHCVICGRFLPEKDGVIVHDDVLHPVDINFDDEEKPQ |
Ga0315904_110015502 | 3300031951 | Freshwater | MGMKPDIYYCVVCGRGIEPDEYGVYVHNDVPHPPDMAFDEEENPQ |
Ga0315901_106475251 | 3300031963 | Freshwater | MNDGYYCVVCGRFLLEEDGVIVHDDVPHPLDMDFVDEEKPQ |
Ga0315274_115275832 | 3300031999 | Sediment | MITLTREEGYYCVVCGKFLPEEDGVILHDDVPHPVDMDFGDEEKPQ |
Ga0315274_116216402 | 3300031999 | Sediment | MIEVLKQGYHCVICSRFLLADEYGVILHDDIEHPPEMNFDDEENPQ |
Ga0315906_101006351 | 3300032050 | Freshwater | MDDGYYCVICGRYIEAVDGVVVHDNVPHPDMAFDDEE |
Ga0315903_104041933 | 3300032116 | Freshwater | MDEGYYCVVCVKYIEAVDDVIVHDDIPHPVDMAFDEEENPQ |
Ga0315903_104768844 | 3300032116 | Freshwater | MTTMLTREDDYYCVVCGRFLPEEDGVIVHDDVPHPADMDF |
Ga0315270_102752691 | 3300032275 | Sediment | LLEGGGYWCVVCGRYLPDDDGVIVHDDVQHPTEMAFDDEEKPQ |
Ga0315287_115537242 | 3300032397 | Sediment | LNDLLCAGGYWCVVCGRYMPAEDGVVVHDDIPHPDMTFDEEERPQ |
Ga0316616_1000738663 | 3300033521 | Soil | MAETEGYYCVICGKFIEAVDGVIVHDDIPHPPLMDFDEESNPQ |
Ga0316616_1006575931 | 3300033521 | Soil | MTEKDGYYCVVCGRFIEAVDGVIVHDDIPHPAEMDFGDE |
Ga0316616_1035649051 | 3300033521 | Soil | GCRGGTDMSIEAIKEGYYCMICGRFLPADEHGVIVHDDIEHPQEMDFGDEENPQ |
Ga0334980_0006539_3427_3561 | 3300033816 | Freshwater | MIDEDVYYCVVCGRCIERNEHGVFVHDDVPHPPDMTFDEEEKLQ |
Ga0334994_0045196_252_377 | 3300033993 | Freshwater | MTGYYCVVCGKFLPADEHDVIVHDNVPHPVDMDFGDEEKPQ |
Ga0334994_0046587_959_1102 | 3300033993 | Freshwater | MIITLTREEGYYCVVCGRFLPEEDGVIAHDDVPHPADMDFGDEEKPQ |
Ga0334996_0007864_4319_4441 | 3300033994 | Freshwater | MTEGYYCVVCGKYIEAVDGVIVHDDIPHPDMTFDEEERPQ |
Ga0334986_0011189_1950_2090 | 3300034012 | Freshwater | MITLTREEGYYCVVCGRFLPEENGVIVHDDVPHSADMDFGDEEKPQ |
Ga0334986_0023809_4004_4123 | 3300034012 | Freshwater | MDETEGYYCVICGKFIEAVDGVIVHDDIPHPPLMDFDEES |
Ga0334986_0025042_3250_3384 | 3300034012 | Freshwater | MIDEDVYYCVVCGRGIERDEHGIFVHDDVPHPPDMTFDEEETPQ |
Ga0335004_0258001_32_211 | 3300034021 | Freshwater | LGQFLPSHRSQTQGEEHMSDGYYCVVCGRFLLANEHGVIVHDDILHPQEMDFADEEKPQ |
Ga0334987_0151229_13_138 | 3300034061 | Freshwater | MHDGYYCVVCGRFIEAVDGVIVHDDIPHPPDMTFDEGENSQ |
Ga0335029_0365580_73_198 | 3300034102 | Freshwater | MDDGYYCAVCGKYIEAVDGVIVHDDIPHPPDMAFDEEERPQ |
Ga0335036_0360295_241_372 | 3300034106 | Freshwater | MKPDIYYCVVCGRGIEPDEYGVYVHDDVPHPPDMAFDEEENPQ |
Ga0335066_0505152_508_639 | 3300034112 | Freshwater | IEDDDGYYCVVCGRYIEAVDGLIVHDDIPHPLSMDFDEEDNPQ |
Ga0335053_0793825_3_110 | 3300034118 | Freshwater | VVCCKFLLADKHGVIVHDDVPHPVDMDFGDEEKPQ |
⦗Top⦘ |