NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F004297

Metagenome / Metatranscriptome Family F004297

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F004297
Family Type Metagenome / Metatranscriptome
Number of Sequences 445
Average Sequence Length 42 residues
Representative Sequence MLRKLLWTGLYAGLGAGATLAARRAASRIWRLATGEEPPTKK
Number of Associated Samples 272
Number of Associated Scaffolds 445

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 55.33 %
% of genes near scaffold ends (potentially truncated) 33.71 %
% of genes from short scaffolds (< 2000 bps) 85.84 %
Associated GOLD sequencing projects 249
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.888 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(13.258 % of family members)
Environment Ontology (ENVO) Unclassified
(22.247 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(48.764 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 47.14%    β-sheet: 0.00%    Coil/Unstructured: 52.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 445 Family Scaffolds
PF07332Phage_holin_3_6 28.54
PF01425Amidase 11.91
PF01316Arg_repressor 10.56
PF02863Arg_repressor_C 9.21
PF11950DUF3467 3.60
PF12277DUF3618 3.37
PF09939DUF2171 2.92
PF03631Virul_fac_BrkB 2.25
PF05239PRC 1.57
PF05532CsbD 0.90
PF10944DUF2630 0.45
PF02817E3_binding 0.45
PF12847Methyltransf_18 0.22
PF13561adh_short_C2 0.22
PF06224HTH_42 0.22
PF00583Acetyltransf_1 0.22
PF00571CBS 0.22
PF03473MOSC 0.22
PF13280WYL 0.22
PF14490HHH_4 0.22
PF00589Phage_integrase 0.22
PF01643Acyl-ACP_TE 0.22
PF03861ANTAR 0.22
PF03147FDX-ACB 0.22
PF02779Transket_pyr 0.22
PF02645DegV 0.22
PF05957DUF883 0.22
PF12911OppC_N 0.22
PF05157T2SSE_N 0.22
PF02912Phe_tRNA-synt_N 0.22
PF06772LtrA 0.22
PF06835LptC 0.22

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 445 Family Scaffolds
COG1438Arginine repressorTranscription [K] 19.78
COG0154Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidaseTranslation, ribosomal structure and biogenesis [J] 11.91
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 2.25
COG3237Uncharacterized conserved protein YjbJ, UPF0337 familyFunction unknown [S] 0.90
COG0508Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) componentEnergy production and conversion [C] 0.45
COG0016Phenylalanyl-tRNA synthetase alpha subunitTranslation, ribosomal structure and biogenesis [J] 0.22
COG0072Phenylalanyl-tRNA synthetase beta subunitTranslation, ribosomal structure and biogenesis [J] 0.22
COG3214DNA glycosylase YcaQ, repair of DNA interstrand crosslinksReplication, recombination and repair [L] 0.22
COG3707Two-component response regulator, AmiR/NasT family, consists of REC and RNA-binding antiterminator (ANTAR) domainsTranscription [K] 0.22
COG3884Acyl-ACP thioesteraseLipid transport and metabolism [I] 0.22
COG4292Low temperature requirement protein LtrA (function unknown)Function unknown [S] 0.22
COG4575Membrane-anchored ribosome-binding protein ElaB, inhibits growth in stationary phase, YqjD/DUF883 familyTranslation, ribosomal structure and biogenesis [J] 0.22


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.89 %
UnclassifiedrootN/A10.11 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2065487018|GPINP_F5MS3JC02IKP8IAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria516Open in IMG/M
2067725004|GPKC_F5OHE3B02FKINUAll Organisms → cellular organisms → Bacteria → Terrabacteria group529Open in IMG/M
2070309009|GPKNP_GG3DY5402H7DSXAll Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium518Open in IMG/M
2119805009|FNTS007_GKN1E7E02INH56Not Available525Open in IMG/M
2170459019|G14TP7Y02HLK47All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria696Open in IMG/M
3300000033|ICChiseqgaiiDRAFT_c0517392Not Available574Open in IMG/M
3300000363|ICChiseqgaiiFebDRAFT_14232090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium890Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_104207836All Organisms → cellular organisms → Bacteria → Terrabacteria group505Open in IMG/M
3300000858|JGI10213J12805_10135075All Organisms → cellular organisms → Bacteria → Terrabacteria group690Open in IMG/M
3300000956|JGI10216J12902_100102376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300000956|JGI10216J12902_101412899All Organisms → cellular organisms → Bacteria1629Open in IMG/M
3300000956|JGI10216J12902_102843444All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria664Open in IMG/M
3300000956|JGI10216J12902_103673482All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1577Open in IMG/M
3300000956|JGI10216J12902_105885890All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1031Open in IMG/M
3300001431|F14TB_103889022All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria512Open in IMG/M
3300001535|A3PFW1_10583869All Organisms → cellular organisms → Bacteria2562Open in IMG/M
3300002568|C688J35102_118114895Not Available531Open in IMG/M
3300002568|C688J35102_118507061All Organisms → cellular organisms → Bacteria → Terrabacteria group566Open in IMG/M
3300002568|C688J35102_118841933All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium603Open in IMG/M
3300002568|C688J35102_120037471All Organisms → cellular organisms → Bacteria855Open in IMG/M
3300002568|C688J35102_120100005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes879Open in IMG/M
3300002568|C688J35102_120985440All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6180Open in IMG/M
3300003321|soilH1_10138931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2836Open in IMG/M
3300003321|soilH1_10254406All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1107Open in IMG/M
3300003324|soilH2_10233994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1113Open in IMG/M
3300004081|Ga0063454_100023994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2001Open in IMG/M
3300004081|Ga0063454_100731076All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300004081|Ga0063454_100767180All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300004081|Ga0063454_101149705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei638Open in IMG/M
3300004081|Ga0063454_101159087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300004081|Ga0063454_101188446All Organisms → cellular organisms → Bacteria630Open in IMG/M
3300004081|Ga0063454_101547801All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300004114|Ga0062593_100617099All Organisms → cellular organisms → Bacteria1038Open in IMG/M
3300004114|Ga0062593_101215396All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300004114|Ga0062593_102641566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia571Open in IMG/M
3300004153|Ga0063455_100359338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium835Open in IMG/M
3300004157|Ga0062590_101424187All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia691Open in IMG/M
3300004463|Ga0063356_101680478All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria948Open in IMG/M
3300004479|Ga0062595_100007887All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3286Open in IMG/M
3300004479|Ga0062595_100411563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium974Open in IMG/M
3300004479|Ga0062595_100545603All Organisms → cellular organisms → Bacteria886Open in IMG/M
3300004479|Ga0062595_101640583All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria602Open in IMG/M
3300004480|Ga0062592_100712445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria875Open in IMG/M
3300004643|Ga0062591_100056451All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2280Open in IMG/M
3300005093|Ga0062594_100033314All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales2403Open in IMG/M
3300005093|Ga0062594_100742819All Organisms → cellular organisms → Bacteria895Open in IMG/M
3300005093|Ga0062594_101889654All Organisms → cellular organisms → Bacteria633Open in IMG/M
3300005093|Ga0062594_102436606All Organisms → cellular organisms → Bacteria573Open in IMG/M
3300005166|Ga0066674_10375921All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300005166|Ga0066674_10567132All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300005171|Ga0066677_10205461All Organisms → cellular organisms → Bacteria1104Open in IMG/M
3300005176|Ga0066679_10042461All Organisms → cellular organisms → Bacteria2577Open in IMG/M
3300005179|Ga0066684_10040566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2609Open in IMG/M
3300005179|Ga0066684_10335532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1009Open in IMG/M
3300005180|Ga0066685_10243289All Organisms → cellular organisms → Bacteria1240Open in IMG/M
3300005181|Ga0066678_10703060All Organisms → cellular organisms → Bacteria673Open in IMG/M
3300005184|Ga0066671_10431573All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300005187|Ga0066675_10305213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1153Open in IMG/M
3300005327|Ga0070658_10037672All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3899Open in IMG/M
3300005327|Ga0070658_10249874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1504Open in IMG/M
3300005327|Ga0070658_10928000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300005327|Ga0070658_11459001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300005329|Ga0070683_100197242All Organisms → cellular organisms → Bacteria1912Open in IMG/M
3300005329|Ga0070683_101869921All Organisms → cellular organisms → Bacteria577Open in IMG/M
3300005332|Ga0066388_100819696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1520Open in IMG/M
3300005332|Ga0066388_101762654All Organisms → cellular organisms → Bacteria1099Open in IMG/M
3300005332|Ga0066388_102206247All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria994Open in IMG/M
3300005336|Ga0070680_100264087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia1457Open in IMG/M
3300005338|Ga0068868_101414394All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300005339|Ga0070660_100459750All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1057Open in IMG/M
3300005339|Ga0070660_101276736All Organisms → cellular organisms → Bacteria623Open in IMG/M
3300005339|Ga0070660_101647263Not Available546Open in IMG/M
3300005341|Ga0070691_10087602All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1531Open in IMG/M
3300005344|Ga0070661_100051932All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3001Open in IMG/M
3300005345|Ga0070692_11031180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria577Open in IMG/M
3300005355|Ga0070671_100069272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2942Open in IMG/M
3300005355|Ga0070671_100450834All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1104Open in IMG/M
3300005435|Ga0070714_100057537All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3329Open in IMG/M
3300005435|Ga0070714_102292141All Organisms → cellular organisms → Bacteria525Open in IMG/M
3300005436|Ga0070713_100460202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1196Open in IMG/M
3300005439|Ga0070711_100223110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1466Open in IMG/M
3300005439|Ga0070711_100978878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales725Open in IMG/M
3300005441|Ga0070700_100846976All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria740Open in IMG/M
3300005444|Ga0070694_100855013All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300005444|Ga0070694_100896092All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300005446|Ga0066686_10748698All Organisms → cellular organisms → Bacteria655Open in IMG/M
3300005458|Ga0070681_10591179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1024Open in IMG/M
3300005466|Ga0070685_10539730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria831Open in IMG/M
3300005471|Ga0070698_100060447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3824Open in IMG/M
3300005529|Ga0070741_10747266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria858Open in IMG/M
3300005532|Ga0070739_10000035All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria307957Open in IMG/M
3300005546|Ga0070696_100132308All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300005547|Ga0070693_100589334All Organisms → cellular organisms → Bacteria801Open in IMG/M
3300005549|Ga0070704_100627378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300005556|Ga0066707_10693603All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300005558|Ga0066698_10844194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300005561|Ga0066699_10329794All Organisms → cellular organisms → Bacteria1089Open in IMG/M
3300005563|Ga0068855_101035710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria861Open in IMG/M
3300005564|Ga0070664_100139511All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2134Open in IMG/M
3300005564|Ga0070664_100531780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1086Open in IMG/M
3300005566|Ga0066693_10058403All Organisms → cellular organisms → Bacteria1307Open in IMG/M
3300005576|Ga0066708_10435724All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium841Open in IMG/M
3300005576|Ga0066708_10864452All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300005587|Ga0066654_10163160All Organisms → cellular organisms → Bacteria1139Open in IMG/M
3300005713|Ga0066905_100726848All Organisms → cellular organisms → Bacteria854Open in IMG/M
3300005713|Ga0066905_102209017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria513Open in IMG/M
3300005841|Ga0068863_102202450All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria561Open in IMG/M
3300005981|Ga0081538_10119154All Organisms → cellular organisms → Bacteria1273Open in IMG/M
3300006028|Ga0070717_10130445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2161Open in IMG/M
3300006046|Ga0066652_100085471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2502Open in IMG/M
3300006046|Ga0066652_100251611All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1547Open in IMG/M
3300006046|Ga0066652_100800283All Organisms → cellular organisms → Bacteria901Open in IMG/M
3300006051|Ga0075364_10220200All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1288Open in IMG/M
3300006058|Ga0075432_10082809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1165Open in IMG/M
3300006791|Ga0066653_10135109All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1178Open in IMG/M
3300006800|Ga0066660_10311972All Organisms → cellular organisms → Bacteria1261Open in IMG/M
3300006800|Ga0066660_10528964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria990Open in IMG/M
3300006800|Ga0066660_11246043All Organisms → cellular organisms → Bacteria583Open in IMG/M
3300006800|Ga0066660_11569620All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300006844|Ga0075428_101218339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium793Open in IMG/M
3300006844|Ga0075428_102168612Not Available574Open in IMG/M
3300006845|Ga0075421_100545543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1371Open in IMG/M
3300006854|Ga0075425_100005968All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia12709Open in IMG/M
3300006854|Ga0075425_102248822All Organisms → cellular organisms → Bacteria607Open in IMG/M
3300006876|Ga0079217_10003465All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4536Open in IMG/M
3300006894|Ga0079215_11113240All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300006914|Ga0075436_100806399All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300006954|Ga0079219_10305383All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300006954|Ga0079219_10492149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria855Open in IMG/M
3300006969|Ga0075419_11336591All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria533Open in IMG/M
3300007004|Ga0079218_11719024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium697Open in IMG/M
3300007740|Ga0104326_130344All Organisms → cellular organisms → Bacteria2649Open in IMG/M
3300009012|Ga0066710_100183178All Organisms → cellular organisms → Bacteria2961Open in IMG/M
3300009012|Ga0066710_100647547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1607Open in IMG/M
3300009012|Ga0066710_103281965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria619Open in IMG/M
3300009093|Ga0105240_11077762All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300009093|Ga0105240_11895272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300009094|Ga0111539_11060085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria942Open in IMG/M
3300009094|Ga0111539_11815831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium707Open in IMG/M
3300009137|Ga0066709_100436983All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1826Open in IMG/M
3300009137|Ga0066709_100805429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1361Open in IMG/M
3300009137|Ga0066709_102491438All Organisms → cellular organisms → Bacteria → Terrabacteria group698Open in IMG/M
3300009137|Ga0066709_103269711All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300009147|Ga0114129_10423799All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1750Open in IMG/M
3300009147|Ga0114129_10571505All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1468Open in IMG/M
3300009147|Ga0114129_10883979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1133Open in IMG/M
3300009148|Ga0105243_10576295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1080Open in IMG/M
3300009162|Ga0075423_11054236All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria865Open in IMG/M
3300009176|Ga0105242_12955573Not Available526Open in IMG/M
3300009553|Ga0105249_12085536Not Available640Open in IMG/M
3300009789|Ga0126307_10031723All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4066Open in IMG/M
3300009789|Ga0126307_10360484All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1171Open in IMG/M
3300009789|Ga0126307_10382380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1135Open in IMG/M
3300009836|Ga0105068_1075854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria633Open in IMG/M
3300009840|Ga0126313_10000181All Organisms → cellular organisms → Bacteria27310Open in IMG/M
3300009840|Ga0126313_11743775All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium520Open in IMG/M
3300010036|Ga0126305_10007506All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia5336Open in IMG/M
3300010036|Ga0126305_10287553All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1065Open in IMG/M
3300010036|Ga0126305_10931738Not Available594Open in IMG/M
3300010037|Ga0126304_10056393All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2398Open in IMG/M
3300010039|Ga0126309_10059037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1863Open in IMG/M
3300010039|Ga0126309_10086495All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1586Open in IMG/M
3300010039|Ga0126309_10107763All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1445Open in IMG/M
3300010039|Ga0126309_10450545Not Available781Open in IMG/M
3300010039|Ga0126309_10579745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria703Open in IMG/M
3300010039|Ga0126309_10760834Not Available628Open in IMG/M
3300010039|Ga0126309_11207979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria520Open in IMG/M
3300010040|Ga0126308_10019396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3639Open in IMG/M
3300010040|Ga0126308_10251498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1149Open in IMG/M
3300010040|Ga0126308_10555516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria780Open in IMG/M
3300010041|Ga0126312_10187433All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1444Open in IMG/M
3300010041|Ga0126312_10247279All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1252Open in IMG/M
3300010042|Ga0126314_10116435All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1833Open in IMG/M
3300010042|Ga0126314_10461924All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium919Open in IMG/M
3300010043|Ga0126380_10700647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300010044|Ga0126310_10881280All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium695Open in IMG/M
3300010044|Ga0126310_10993633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium660Open in IMG/M
3300010044|Ga0126310_11166141All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria616Open in IMG/M
3300010045|Ga0126311_10403447All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1052Open in IMG/M
3300010045|Ga0126311_11746300Not Available526Open in IMG/M
3300010145|Ga0126321_1017244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300010145|Ga0126321_1240252All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium513Open in IMG/M
3300010145|Ga0126321_1284774All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1186Open in IMG/M
3300010145|Ga0126321_1349740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1635Open in IMG/M
3300010145|Ga0126321_1392815All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium908Open in IMG/M
3300010152|Ga0126318_10053303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria676Open in IMG/M
3300010152|Ga0126318_10062929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1038Open in IMG/M
3300010152|Ga0126318_10181565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria592Open in IMG/M
3300010152|Ga0126318_10183973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1113Open in IMG/M
3300010152|Ga0126318_10185315All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria998Open in IMG/M
3300010152|Ga0126318_10435264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria617Open in IMG/M
3300010152|Ga0126318_10481866Not Available505Open in IMG/M
3300010152|Ga0126318_11077650All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria689Open in IMG/M
3300010166|Ga0126306_10525573All Organisms → cellular organisms → Bacteria → Terrabacteria group938Open in IMG/M
3300010321|Ga0134067_10307154Not Available613Open in IMG/M
3300010322|Ga0134084_10408437All Organisms → cellular organisms → Bacteria531Open in IMG/M
3300010325|Ga0134064_10375164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300010329|Ga0134111_10134545All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria970Open in IMG/M
3300010337|Ga0134062_10511667All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria605Open in IMG/M
3300010362|Ga0126377_10309817Not Available1560Open in IMG/M
3300010364|Ga0134066_10315130Not Available567Open in IMG/M
3300010373|Ga0134128_10997772Not Available925Open in IMG/M
3300010396|Ga0134126_10410857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1571Open in IMG/M
3300010396|Ga0134126_12160640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria607Open in IMG/M
3300010397|Ga0134124_11038509All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria833Open in IMG/M
3300010399|Ga0134127_10808024All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium987Open in IMG/M
3300010399|Ga0134127_12476487All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia599Open in IMG/M
3300010403|Ga0134123_11043470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium837Open in IMG/M
3300011119|Ga0105246_10606661All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria947Open in IMG/M
3300011996|Ga0120156_1009726All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2016Open in IMG/M
3300012043|Ga0136631_10395833Not Available560Open in IMG/M
3300012091|Ga0136625_1194443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia690Open in IMG/M
3300012092|Ga0136621_1015257All Organisms → cellular organisms → Bacteria3162Open in IMG/M
3300012093|Ga0136632_10039390All Organisms → cellular organisms → Bacteria2161Open in IMG/M
3300012200|Ga0137382_11281544Not Available518Open in IMG/M
3300012204|Ga0137374_10766878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium718Open in IMG/M
3300012204|Ga0137374_10773011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium715Open in IMG/M
3300012206|Ga0137380_11197266All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria645Open in IMG/M
3300012208|Ga0137376_10398931All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1195Open in IMG/M
3300012212|Ga0150985_103575142All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium713Open in IMG/M
3300012212|Ga0150985_104667583Not Available617Open in IMG/M
3300012212|Ga0150985_104694904All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300012212|Ga0150985_107725342All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium994Open in IMG/M
3300012212|Ga0150985_107733372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium879Open in IMG/M
3300012212|Ga0150985_110764771All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1133Open in IMG/M
3300012212|Ga0150985_111961512All Organisms → cellular organisms → Bacteria → Terrabacteria group642Open in IMG/M
3300012212|Ga0150985_113798616All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria542Open in IMG/M
3300012212|Ga0150985_115335778All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium927Open in IMG/M
3300012212|Ga0150985_115865244All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300012212|Ga0150985_115912445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2204Open in IMG/M
3300012212|Ga0150985_118396031Not Available634Open in IMG/M
3300012212|Ga0150985_119769659All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2323Open in IMG/M
3300012354|Ga0137366_10138074All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1837Open in IMG/M
3300012355|Ga0137369_10352359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1075Open in IMG/M
3300012356|Ga0137371_11021361Not Available626Open in IMG/M
3300012356|Ga0137371_11351987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria525Open in IMG/M
3300012469|Ga0150984_102972696All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1320Open in IMG/M
3300012469|Ga0150984_103401191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium905Open in IMG/M
3300012469|Ga0150984_104032063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria579Open in IMG/M
3300012469|Ga0150984_104644379All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300012469|Ga0150984_107948194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium894Open in IMG/M
3300012469|Ga0150984_110659371All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium790Open in IMG/M
3300012469|Ga0150984_110669780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300012469|Ga0150984_110687829All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1968Open in IMG/M
3300012469|Ga0150984_111129854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium728Open in IMG/M
3300012469|Ga0150984_111179350All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2155Open in IMG/M
3300012469|Ga0150984_112414084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium779Open in IMG/M
3300012469|Ga0150984_119222050All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium1426Open in IMG/M
3300012469|Ga0150984_120734646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium922Open in IMG/M
3300012469|Ga0150984_120871847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1006Open in IMG/M
3300012469|Ga0150984_121468753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1305Open in IMG/M
3300012469|Ga0150984_122660470All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300012476|Ga0157344_1004294All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria842Open in IMG/M
3300012529|Ga0136630_1201994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium714Open in IMG/M
3300012681|Ga0136613_10063797All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2109Open in IMG/M
3300012684|Ga0136614_10005617All Organisms → cellular organisms → Bacteria8375Open in IMG/M
3300012685|Ga0137397_10452281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria957Open in IMG/M
3300012900|Ga0157292_10275457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300012902|Ga0157291_10224527All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300012908|Ga0157286_10254359All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria621Open in IMG/M
3300012922|Ga0137394_10872352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria752Open in IMG/M
3300012958|Ga0164299_10418411All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria867Open in IMG/M
3300012961|Ga0164302_10695075All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300012975|Ga0134110_10283992Not Available711Open in IMG/M
3300013045|Ga0154016_142845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria639Open in IMG/M
3300013100|Ga0157373_10963644Not Available635Open in IMG/M
3300013306|Ga0163162_11096373All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium902Open in IMG/M
3300013307|Ga0157372_12874396All Organisms → cellular organisms → Bacteria → Terrabacteria group552Open in IMG/M
3300014488|Ga0182001_10446227All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300014497|Ga0182008_10013002All Organisms → cellular organisms → Bacteria4380Open in IMG/M
3300014497|Ga0182008_10072588All Organisms → cellular organisms → Bacteria → Terrabacteria group1693Open in IMG/M
3300014497|Ga0182008_10174011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1088Open in IMG/M
3300014497|Ga0182008_10819318All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300015077|Ga0173483_10079459All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides panacis1322Open in IMG/M
3300015258|Ga0180093_1033912All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1103Open in IMG/M
3300015265|Ga0182005_1267052All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300015359|Ga0134085_10202708All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium854Open in IMG/M
3300015371|Ga0132258_10017392All Organisms → cellular organisms → Bacteria15530Open in IMG/M
3300015371|Ga0132258_10725882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2502Open in IMG/M
3300015374|Ga0132255_104466409All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium593Open in IMG/M
3300017789|Ga0136617_10011073All Organisms → cellular organisms → Bacteria8044Open in IMG/M
3300017792|Ga0163161_11739660Not Available553Open in IMG/M
3300017927|Ga0187824_10259967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium605Open in IMG/M
3300017965|Ga0190266_10011642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2277Open in IMG/M
3300017965|Ga0190266_10657103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium646Open in IMG/M
3300017966|Ga0187776_10002730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9002Open in IMG/M
3300018027|Ga0184605_10110783All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1217Open in IMG/M
3300018029|Ga0187787_10066928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1095Open in IMG/M
3300018066|Ga0184617_1219360All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia568Open in IMG/M
3300018071|Ga0184618_10007674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium3133Open in IMG/M
3300018071|Ga0184618_10275710All Organisms → cellular organisms → Bacteria714Open in IMG/M
3300018071|Ga0184618_10447105All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria544Open in IMG/M
3300018072|Ga0184635_10160843All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria897Open in IMG/M
3300018075|Ga0184632_10433883All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria547Open in IMG/M
3300018082|Ga0184639_10488608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium623Open in IMG/M
3300018083|Ga0184628_10246697All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia938Open in IMG/M
3300018422|Ga0190265_12271299All Organisms → cellular organisms → Bacteria → Terrabacteria group644Open in IMG/M
3300018429|Ga0190272_13276807Not Available505Open in IMG/M
3300018431|Ga0066655_10306838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1034Open in IMG/M
3300018431|Ga0066655_10760095All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria658Open in IMG/M
3300018433|Ga0066667_10431054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1073Open in IMG/M
3300018433|Ga0066667_10717443Not Available841Open in IMG/M
3300018466|Ga0190268_10014429All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2361Open in IMG/M
3300018466|Ga0190268_10169289All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1146Open in IMG/M
3300018468|Ga0066662_10289554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1368Open in IMG/M
3300018469|Ga0190270_10009538All Organisms → cellular organisms → Bacteria5403Open in IMG/M
3300018469|Ga0190270_10059557All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2711Open in IMG/M
3300018482|Ga0066669_10690437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria899Open in IMG/M
3300018482|Ga0066669_11048532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium736Open in IMG/M
3300018482|Ga0066669_12375736All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria507Open in IMG/M
3300019255|Ga0184643_1270199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium682Open in IMG/M
3300019255|Ga0184643_1457472All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria654Open in IMG/M
3300019279|Ga0184642_1102997All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium965Open in IMG/M
3300019361|Ga0173482_10539305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300019362|Ga0173479_10216490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia819Open in IMG/M
3300019767|Ga0190267_10036686All Organisms → cellular organisms → Bacteria1584Open in IMG/M
3300019868|Ga0193720_1002795All Organisms → cellular organisms → Bacteria2354Open in IMG/M
3300019884|Ga0193741_1060517All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium975Open in IMG/M
3300019887|Ga0193729_1147525All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria853Open in IMG/M
3300019890|Ga0193728_1056414All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1899Open in IMG/M
3300020006|Ga0193735_1072273Not Available995Open in IMG/M
3300020069|Ga0197907_10478301All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3698Open in IMG/M
3300020069|Ga0197907_10820005All Organisms → cellular organisms → Bacteria5897Open in IMG/M
3300020070|Ga0206356_10514806Not Available1088Open in IMG/M
3300020070|Ga0206356_10590513All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria9780Open in IMG/M
3300020070|Ga0206356_10859150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium1176Open in IMG/M
3300020077|Ga0206351_10069445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300020078|Ga0206352_11284839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria640Open in IMG/M
3300020082|Ga0206353_10807535All Organisms → cellular organisms → Bacteria → Terrabacteria group610Open in IMG/M
3300020082|Ga0206353_11043321All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1445Open in IMG/M
3300021445|Ga0182009_10347156All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300021445|Ga0182009_10530882All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria623Open in IMG/M
3300021951|Ga0222624_1169892All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria868Open in IMG/M
3300021951|Ga0222624_1289419All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium538Open in IMG/M
3300022195|Ga0222625_1814277All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria574Open in IMG/M
3300022467|Ga0224712_10068529All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1434Open in IMG/M
3300022467|Ga0224712_10105841Not Available1200Open in IMG/M
3300022467|Ga0224712_10233787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria845Open in IMG/M
3300022756|Ga0222622_10961594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium627Open in IMG/M
3300024310|Ga0247681_1005267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1634Open in IMG/M
3300025898|Ga0207692_10862674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium594Open in IMG/M
3300025907|Ga0207645_10879738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300025909|Ga0207705_10055237All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2863Open in IMG/M
3300025909|Ga0207705_10948646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria666Open in IMG/M
3300025909|Ga0207705_11186692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium586Open in IMG/M
3300025911|Ga0207654_10541477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium826Open in IMG/M
3300025912|Ga0207707_10581633All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium949Open in IMG/M
3300025915|Ga0207693_10246465All Organisms → cellular organisms → Bacteria1402Open in IMG/M
3300025915|Ga0207693_10494189All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales955Open in IMG/M
3300025916|Ga0207663_10793729All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria754Open in IMG/M
3300025916|Ga0207663_10872512All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300025919|Ga0207657_10365520All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1137Open in IMG/M
3300025919|Ga0207657_10419124All Organisms → cellular organisms → Bacteria1052Open in IMG/M
3300025919|Ga0207657_11404994Not Available524Open in IMG/M
3300025929|Ga0207664_10602260All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria987Open in IMG/M
3300025929|Ga0207664_10821624Not Available836Open in IMG/M
3300025931|Ga0207644_11065152All Organisms → cellular organisms → Bacteria → Terrabacteria group679Open in IMG/M
3300025931|Ga0207644_11213353All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium634Open in IMG/M
3300025931|Ga0207644_11521322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300025932|Ga0207690_11471033All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300025935|Ga0207709_10194740All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1443Open in IMG/M
3300025942|Ga0207689_10198515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1656Open in IMG/M
3300026078|Ga0207702_11757090All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300026121|Ga0207683_11047044All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria757Open in IMG/M
3300026312|Ga0209153_1012308All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2713Open in IMG/M
3300026312|Ga0209153_1104292All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1067Open in IMG/M
3300026330|Ga0209473_1028734All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2533Open in IMG/M
3300026538|Ga0209056_10327457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1030Open in IMG/M
3300026540|Ga0209376_1231503All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria807Open in IMG/M
3300026547|Ga0209156_10149329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1134Open in IMG/M
3300026550|Ga0209474_10169706All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1410Open in IMG/M
3300026550|Ga0209474_10327083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300027637|Ga0209818_1061515All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria930Open in IMG/M
3300027773|Ga0209810_1000015All Organisms → cellular organisms → Bacteria608252Open in IMG/M
3300027775|Ga0209177_10508864All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria503Open in IMG/M
3300027787|Ga0209074_10009348All Organisms → cellular organisms → Bacteria2379Open in IMG/M
3300027880|Ga0209481_10603045All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria569Open in IMG/M
3300027907|Ga0207428_10109935All Organisms → cellular organisms → Bacteria2123Open in IMG/M
3300027907|Ga0207428_10432709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium961Open in IMG/M
3300027907|Ga0207428_10500787All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria882Open in IMG/M
3300028104|Ga0247713_1025103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1551Open in IMG/M
3300028710|Ga0307322_10043341All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1086Open in IMG/M
3300028715|Ga0307313_10184191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria647Open in IMG/M
3300028717|Ga0307298_10105916Not Available801Open in IMG/M
3300028722|Ga0307319_10274138All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia557Open in IMG/M
3300028755|Ga0307316_10107404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria977Open in IMG/M
3300028784|Ga0307282_10126121All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1202Open in IMG/M
3300028784|Ga0307282_10285594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium795Open in IMG/M
3300028791|Ga0307290_10061921All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1355Open in IMG/M
3300028799|Ga0307284_10257906All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria695Open in IMG/M
3300028807|Ga0307305_10090710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1412Open in IMG/M
3300028807|Ga0307305_10151481All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1071Open in IMG/M
3300028807|Ga0307305_10221555All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium867Open in IMG/M
3300028811|Ga0307292_10232438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria763Open in IMG/M
3300028812|Ga0247825_11414063All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia510Open in IMG/M
3300028814|Ga0307302_10223927All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium920Open in IMG/M
3300028828|Ga0307312_10826164All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria614Open in IMG/M
3300028876|Ga0307286_10141615All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria858Open in IMG/M
3300028878|Ga0307278_10020118All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3088Open in IMG/M
3300028881|Ga0307277_10019685All Organisms → cellular organisms → Bacteria2637Open in IMG/M
3300028881|Ga0307277_10235606All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300028881|Ga0307277_10411594Not Available605Open in IMG/M
3300028884|Ga0307308_10582322All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium537Open in IMG/M
3300030006|Ga0299907_10133346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2049Open in IMG/M
3300030336|Ga0247826_11335818Not Available578Open in IMG/M
3300030783|Ga0102752_1555563All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium756Open in IMG/M
3300030829|Ga0308203_1011753All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1026Open in IMG/M
3300030902|Ga0308202_1029037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria921Open in IMG/M
3300031091|Ga0308201_10017856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1439Open in IMG/M
3300031091|Ga0308201_10071585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium931Open in IMG/M
3300031091|Ga0308201_10095032All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria849Open in IMG/M
3300031091|Ga0308201_10219208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium639Open in IMG/M
3300031091|Ga0308201_10220210Not Available638Open in IMG/M
3300031092|Ga0308204_10235242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria587Open in IMG/M
3300031093|Ga0308197_10050549All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1073Open in IMG/M
3300031114|Ga0308187_10107958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria874Open in IMG/M
3300031366|Ga0307506_10187438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium752Open in IMG/M
3300031548|Ga0307408_100296654All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1352Open in IMG/M
3300031548|Ga0307408_100315037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1316Open in IMG/M
3300031854|Ga0310904_10593260All Organisms → cellular organisms → Bacteria755Open in IMG/M
3300031903|Ga0307407_11093839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium619Open in IMG/M
3300031938|Ga0308175_100117332All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2488Open in IMG/M
3300031938|Ga0308175_100320690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1589Open in IMG/M
3300031938|Ga0308175_100610291Not Available1175Open in IMG/M
3300031938|Ga0308175_100681994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1114Open in IMG/M
3300031996|Ga0308176_11100725All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria840Open in IMG/M
3300031996|Ga0308176_11660793All Organisms → cellular organisms → Bacteria → Terrabacteria group681Open in IMG/M
3300032013|Ga0310906_11165858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria559Open in IMG/M
3300032074|Ga0308173_10327960All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1325Open in IMG/M
3300032074|Ga0308173_10984109Not Available783Open in IMG/M
3300032075|Ga0310890_10601358All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium851Open in IMG/M
3300032080|Ga0326721_10592665Not Available673Open in IMG/M
3300032828|Ga0335080_10290833All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1776Open in IMG/M
3300032828|Ga0335080_11407446Not Available693Open in IMG/M
3300032828|Ga0335080_12384994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria505Open in IMG/M
3300033475|Ga0310811_11358060All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria555Open in IMG/M
3300033551|Ga0247830_11366641All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium566Open in IMG/M
3300034113|Ga0364937_056516All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium740Open in IMG/M
3300034149|Ga0364929_0358835All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria506Open in IMG/M
3300034268|Ga0372943_0081646Not Available1868Open in IMG/M
3300034268|Ga0372943_1223871Not Available503Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil13.26%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil10.11%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil6.52%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.27%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.04%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere3.82%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil3.60%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere3.60%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.37%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.37%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil3.15%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.15%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.92%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.92%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.47%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.02%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.80%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.80%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.80%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.35%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.12%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.12%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.12%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.12%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.90%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.90%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.67%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.67%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.67%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.67%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.67%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.67%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.45%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.45%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.45%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.45%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.45%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.45%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.45%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.22%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.22%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.22%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.22%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.22%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.22%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.22%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere0.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.22%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere0.22%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere0.22%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.22%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.22%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.22%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2065487018Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
2067725004Soil microbial communities from Great Prairies - Kansas Corn soilEnvironmentalOpen in IMG/M
2070309009Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
2119805009Soil microbial communities from sample at FACE Site NTS_007 Nevada Test SiteEnvironmentalOpen in IMG/M
2170459019Litter degradation MG4EngineeredOpen in IMG/M
3300000033Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300001535Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-PF-15A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003321Sugarcane bulk soil Sample H1EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004081Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005166Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123EnvironmentalOpen in IMG/M
3300005171Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126EnvironmentalOpen in IMG/M
3300005176Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128EnvironmentalOpen in IMG/M
3300005179Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133EnvironmentalOpen in IMG/M
3300005180Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005338Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2Host-AssociatedOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005341Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaGEnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005355Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005441Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005466Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005532Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005547Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005558Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005576Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157EnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005981Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006051Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4Host-AssociatedOpen in IMG/M
3300006058Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1Host-AssociatedOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006894Agricultural soil microbial communities from Utah to study Nitrogen management - NC ControlEnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300007740Permafrost core soil microbial communities from Svalbard, Norway - sample 2-9-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009094Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009162Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2Host-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009836Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20EnvironmentalOpen in IMG/M
3300009840Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105AEnvironmentalOpen in IMG/M
3300010036Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26EnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010039Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56EnvironmentalOpen in IMG/M
3300010040Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010042Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105BEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010145Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010152Soil microbial communities from Oklahoma, USA to study soil gas exchange rates - GP-OK-ARM metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010166Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27EnvironmentalOpen in IMG/M
3300010321Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015EnvironmentalOpen in IMG/M
3300010322Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010325Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010337Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010364Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011996Permafrost microbial communities from Nunavut, Canada - A39_65cm_12MEnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012091Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ483 (23.06)EnvironmentalOpen in IMG/M
3300012092Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ445A (23.06)EnvironmentalOpen in IMG/M
3300012093Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ611 (21.06)EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012204Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaGEnvironmentalOpen in IMG/M
3300012206Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012476Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610Host-AssociatedOpen in IMG/M
3300012529Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ568 (21.06)EnvironmentalOpen in IMG/M
3300012681Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06)EnvironmentalOpen in IMG/M
3300012684Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06)EnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012900Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1EnvironmentalOpen in IMG/M
3300012902Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012961Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MGEnvironmentalOpen in IMG/M
3300012975Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015EnvironmentalOpen in IMG/M
3300013045Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300014488Bulk soil microbial communities from Mexico - San Felipe (SF) metaGEnvironmentalOpen in IMG/M
3300014497Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaGHost-AssociatedOpen in IMG/M
3300015077Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2)EnvironmentalOpen in IMG/M
3300015258Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1DaEnvironmentalOpen in IMG/M
3300015265Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaGHost-AssociatedOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017789Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06)EnvironmentalOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018066Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018075Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019255Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019279Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019362Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2)EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020006Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1m2EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020077Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020082Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300021445Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaGEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022195Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024310Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK22EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025907Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025919Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026312Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes)EnvironmentalOpen in IMG/M
3300026547Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes)EnvironmentalOpen in IMG/M
3300026550Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027773Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen14_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027787Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027907Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300028104Soil microbial communities from hillslope of Landscape Evolution Observatory, University of Arizona, Oracle, AZ, United States - 2-1-E_NEnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028715Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028722Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028807Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028812Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300030336Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1EnvironmentalOpen in IMG/M
3300030783Forest soil microbial communities from USA, for metatranscriptomics studies - Jemez Pines PI 3C (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030829Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_357 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030902Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_356 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031091Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_355 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031092Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_367 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031548Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3Host-AssociatedOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300031903Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1Host-AssociatedOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032075Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034113Sediment microbial communities from East River floodplain, Colorado, United States - 7_s17EnvironmentalOpen in IMG/M
3300034149Sediment microbial communities from East River floodplain, Colorado, United States - 20_j17EnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPINP_027042302065487018SoilMLRRLLWTGLYATVGALATLVARRVTTKIWNIVTGEDPPT
GPKC_064548102067725004SoilMLRKLLWTGLYAGIAALATIVARKVASKIWAVATGEAP
GPKNP_025578702070309009SoilNPTRMLRKAMWTGLYAGIGAAATIAARRVASKIWRIATGEEPPTKK
FNTS007_059890502119805009SoilMLRKVLWTSLYAGLGAAATIGARRLASKIYRVVTGEAPPT
4MG_039914702170459019Switchgrass, Maize And Mischanthus LitterMLRKLLWTGLYAGFGAAATIVARKAASSVYRIATGEEPPVKR
ICChiseqgaiiDRAFT_051739223300000033SoilMLLRKLLWTGLYAALAAAATMASRRAATRIWRIATGEAPPAKK*
ICChiseqgaiiFebDRAFT_1423209033300000363SoilMWTGLYAAIAAAATVAARTVASKIWRVTTGEAPPVKK*
INPhiseqgaiiFebDRAFT_10420783623300000364SoilMLRKLLWTGLYGAIAALATIVARKIATKIWNVATG
JGI10213J12805_1013507533300000858SoilMLRKLLWTGLYGAIAALATIVARRVASKIWGVATGETPPAKT*
JGI10216J12902_10010237623300000956SoilMLRRLIWTGLYASLAAAATLAARKTATKIWHVATGEEPPVKK*
JGI10216J12902_10141289913300000956SoilMLRKMLWTALYAGLGALATLLARKTAVRIWRIGTGEEPPRAT*
JGI10216J12902_10284344413300000956SoilGGKRAGMLLRKLLWTGLYAALAAAATMASRRAASRIWRIATGEAPPAKR*
JGI10216J12902_10367348223300000956SoilMVRKILWSGLYAGLAAAATMSARRAATSVWRLATGEEPPAKR*
JGI10216J12902_10588589023300000956SoilMLRRLIWTGLYASLAAAATLAARRTATKIWRIATGEEPPVKR*
F14TB_10388902223300001431SoilMLRKLLWTGLYGAIAALATIVARKIATKIWGVATGE
A3PFW1_1058386923300001535PermafrostMLRKLLWSGLYAGIGAAATIGARRAASSIWRIATGEEPPTKK*
C688J35102_11811489523300002568SoilMLRKALWSGLYAGVGAVMTMAAQRAASTVWRLSTGEAPPESR*
C688J35102_11850706113300002568SoilMLRKVMWTGLYATLGALATLASRRLSSRIWRIATGEEPPVK
C688J35102_11884193323300002568SoilMLRKILWSGLYAGAGAAATVASRRAATSIWRLATGEEPPAKR*
C688J35102_12003747123300002568SoilMVRKVLWSGLYAGLGAAATIGARRVASSVWRLATGEEPPAKR*
C688J35102_12010000523300002568SoilMVRKILWSALYAGLGAMATMGARRVASSVWRLATGEEPPAKR*
C688J35102_12098544043300002568SoilMLRKVLWSGLYAGVGAVMTMAAQRAASTVWRLSTGETPPESR*
soilH1_1013893173300003321Sugarcane Root And Bulk SoilMLRKLLWTGLYAGLGAVATMGARRTASSIWRIATGEEPPVKK*
soilH1_1025440643300003321Sugarcane Root And Bulk SoilMLRKLLWTGLYAGLGAAATVGARRTASSIWRLATGEEPPAKR*
soilH2_1023399423300003324Sugarcane Root And Bulk SoilMLRKAMWTGLYAGFGAASTLVARRLATKVWQVATGEDPPTKR*
Ga0063454_10002399423300004081SoilMLRKALWTGLYAGIGAAATVAARRVATKVWQVATGEDPPARK*
Ga0063454_10073107623300004081SoilVPGNPNAMLRKAMWTGLYAGLAAVSTLITRRIAAKIWYVATGEAPPTRK*
Ga0063454_10076718013300004081SoilMKRGNDPGMLRKLLWTSLYAGIAAVSTMVARRAASGIWRVAT
Ga0063454_10114970523300004081SoilMSMLRKFMWTGLYAGLGAAATLISRRAATSIWRLATGEQPPTAK*
Ga0063454_10115908723300004081SoilMLRKVMWTGLYATLGALATLASRRLSSRIWRIATGEEPPVRK*
Ga0063454_10118844613300004081SoilMLRKILWSGLYAGVGAAATLGARRVASSVWRLATGEEPPAKR*
Ga0063454_10154780113300004081SoilMLRKLLWTGLYAGFGAAATIVARRAAATVYRIATGEEPPTKR*
Ga0062593_10061709923300004114SoilMRTFPTHEVGKIGDTMVRKILWSGLYAGLAAAATMSARRAATSVWRLATGEEPPAKR*
Ga0062593_10121539613300004114SoilLAESPTGNDPGVLRKLLWLGLYAGLSAAATVVARKTATQVWRTATGEAPPVHK*
Ga0062593_10264156623300004114SoilLAESPTGNHPGVLRKLLWLGLYAGLSAAATLVARKTASQVWRAATGEAPPVKKK*
Ga0063455_10035933823300004153SoilMLRKGIWTVLYAGLGAAATLASRRLASRIWRIATGEEPPVKK*
Ga0062590_10142418723300004157SoilMLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK*
Ga0063356_10168047823300004463Arabidopsis Thaliana RhizosphereLAEIRSVMRGTMLRKLIWTGLYAALGAAAAVAARRLAASIWRIATGEEPPVKKA*
Ga0062595_10000788743300004479SoilMLRKILWTGLYSGLGAVATIGARRAASSIWRIATGEEPPTKK*
Ga0062595_10041156313300004479SoilMLRKAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR*
Ga0062595_10054560333300004479SoilMLRKLLWTALYAGFGAGATMVARKAASSVYRIATGEEPPVKR*
Ga0062595_10164058333300004479SoilLRKLLWTGLYAGLGAAATVGARRTASSIWRLATGEEPPAKR*
Ga0062592_10071244513300004480SoilVGKAGRMLRKLMWTGLYAAIAAAATVAARTVASKIWRVTTGEAPPVKK*
Ga0062591_10005645133300004643SoilMLRKLLWTGLYGAIAALATIVARKIATKIWGVATGEAPPAKT*
Ga0062594_10003331463300005093SoilMLRKLLWTGLYAAVGAAATVAARRVATKVWQIATGEEPPTKK*
Ga0062594_10074281933300005093SoilGNEPGMLRKLLWTGLLAGLSAAATIAARRAATQLWRTATGEAPPVRK*
Ga0062594_10188965423300005093SoilMLRKALWSGLYAAFGAIATLGARRTASSIWRLATGEEPPQKR*
Ga0062594_10243660623300005093SoilGNEPGMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK*
Ga0066674_1037592113300005166SoilMLLRKVLWSGLYAGLGAAATIAARRAASSLWRIATGEDPPAKR*
Ga0066674_1056713223300005166SoilMLRKLLWTGLYGGIAAGATVVARKTASKVWRLATGEEPPTTR*
Ga0066677_1020546113300005171SoilMLRKLLWTGLYAGFGAAATLVARRAASTVYRIATGEEPPVKR*
Ga0066679_1004246163300005176SoilMLRKLLWSALYAGLSAAATLGARRAASRIWRIATGEEPPTKK*
Ga0066684_1004056643300005179SoilMLRKLLWTALYAGFGAGATMVARKAASSVYRIATGEEPPTKR*
Ga0066684_1033553223300005179SoilMLRKLLWTGLYAGFGAAATIVARRAASTVYRIATGEEPPVKR*
Ga0066685_1024328923300005180SoilMLRKLLWTGLYAGFGAAATIVARRAASTVYRLATGEEPPVKR*
Ga0066678_1070306023300005181SoilVTGGQDPAMLRKLLWTALYAGFGAAATIVARKAASSVYRIATGEEPPTKK*
Ga0066671_1043157323300005184SoilMLRKLLWTALYAGFGAGATMVARKAASSVYRIAKGEEPPVKR*
Ga0066675_1030521343300005187SoilCRSAGAARAKEMLLRKVLWSGLYAGLGAAATIAARRAASSLWRIATGEDPPAKR*
Ga0070658_1003767253300005327Corn RhizosphereMLRKILWSGLYAGLGAAATVGARRVATSMWRLATGEEPPARR*
Ga0070658_1024987413300005327Corn RhizosphereMLRKILWSGLYAGLGAAATVGARRVASSVWRLATGEEPPAKR*
Ga0070658_1092800033300005327Corn RhizosphereMEGMLRKLLWSGLYAGLGAAATIGARRAASSIWRIATGEEPPTKK*
Ga0070658_1145900123300005327Corn RhizosphereMVRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR*
Ga0070683_10019724233300005329Corn RhizosphereMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK*
Ga0070683_10186992123300005329Corn RhizosphereVRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR*
Ga0066388_10081969633300005332Tropical Forest SoilVLRKLLWTGLYAGIAAGATIVARTLASRIWRLATGEEPPVKK*
Ga0066388_10176265433300005332Tropical Forest SoilMLRKLMWTGLYAAVSAGAALVARRTAASIWRIATGEEPPVKK*
Ga0066388_10220624723300005332Tropical Forest SoilMLRRLLWTGLYAAIGALATLVARRAATKIWNILTGEEPPTKR*
Ga0070680_10026408713300005336Corn RhizosphereMLRKAMWTGLYAGFGAASTMIARRLATKVWHVATGEDPPTKK*
Ga0068868_10141439423300005338Miscanthus RhizosphereLAESASGNEPGMLRKLLWTGLLAGLSAAATIAARRAATQLWRTATGEAPPVRK*
Ga0070660_10045975023300005339Corn RhizosphereMLRKALWSGLYAAFGAVATLGARRTASSIWRLATGEEPPQKR*
Ga0070660_10127673623300005339Corn RhizosphereMVRKILWSGLNAGFRAAASAGARRAATSVWRRAVGEEPPARR*
Ga0070660_10164726323300005339Corn RhizosphereMRSVLRKLLWSGLYAGIGAAATIGARRAASSIWRAATGEEPPTKR*
Ga0070691_1008760213300005341Corn, Switchgrass And Miscanthus RhizosphereAGLAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK*
Ga0070661_10005193223300005344Corn RhizosphereMLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR*
Ga0070692_1103118013300005345Corn, Switchgrass And Miscanthus RhizosphereMLRKLLWTGLYGAIAALATIVAKKIATKIWAVATGEAPPAKT*
Ga0070671_10006927253300005355Switchgrass RhizosphereLAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK*
Ga0070671_10045083423300005355Switchgrass RhizosphereLADSSSGNDPGMLRKLLWTGLYAGLVAGATMVARRAASGIWQAATGEEPPVKK*
Ga0070714_10005753763300005435Agricultural SoilMPPSAKSEQMARKLLWSGLYAALGAVATLGARRTATSIWRLATGEEPPQKR*
Ga0070714_10229214113300005435Agricultural SoilMLRKILWSGLYAGFGAAATIGARRVASSVWRLATGEEPPAKR*
Ga0070713_10046020233300005436Corn, Switchgrass And Miscanthus RhizosphereMTLPRKPLLRKALWTGLYAGLGALATLASRRLAARIWRTVTGEEPPTKK*
Ga0070711_10022311053300005439Corn, Switchgrass And Miscanthus RhizosphereLAESASGNEPGMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK*
Ga0070711_10097887833300005439Corn, Switchgrass And Miscanthus RhizospherePLLRKALWTGLYAGLGALATLASRRLAARIWRTVTGEEPPTKK*
Ga0070700_10084697633300005441Corn, Switchgrass And Miscanthus RhizosphereMLRKLLWTGLYGAIAALATIVAKKIATKIWNVATGEAPPAKT*
Ga0070694_10085501313300005444Corn, Switchgrass And Miscanthus RhizosphereEPGMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK*
Ga0070694_10089609223300005444Corn, Switchgrass And Miscanthus RhizosphereVRGGQDRAMLRKLLWTALYAGFGAGATMVARKAASSVYRIATGEEPPVKR*
Ga0066686_1074869823300005446SoilMLRKLLWTGLYAGLGAGATLAARRAASRIWRLATGEEPPTKK*
Ga0070681_1059117933300005458Corn RhizosphereMEAMLRKLLWSGLYAGIGAAATIGARRAASSIWRIATGEEPPTKK*
Ga0070685_1053973033300005466Switchgrass RhizosphereLAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVRK*
Ga0070698_10006044743300005471Corn, Switchgrass And Miscanthus RhizosphereLAKSASGKQTSVLRKLAWTGLSAGAVIAARRAAAKVWRIATGESPPTKA*
Ga0070741_1074726623300005529Surface SoilMLRKLLWSGLYAGLGAAATVGARRAATSIWRLATGEEPPAKR*
Ga0070739_100000351433300005532Surface SoilMWTGLYAGLGAASTMVSRRLASKIWRVMTGEEPPTKK*
Ga0070696_10013230823300005546Corn, Switchgrass And Miscanthus RhizosphereMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK*
Ga0070693_10058933423300005547Corn, Switchgrass And Miscanthus RhizosphereMLRKAMWTGLYAGFGAASTMIARRLATKVWHVATGEEPPTKK*
Ga0070704_10062737813300005549Corn, Switchgrass And Miscanthus RhizosphereMIRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPAKK*
Ga0066707_1069360313300005556SoilGNEGQDLSMLRKLLWTALYAGFGAAATIVARRGASTVYRIATGEEPPVKK*
Ga0066698_1084419413300005558SoilALWTGLYAGLGAVAAIGARAAASRIWRVTTGEEPPAKR*
Ga0066699_1032979423300005561SoilMLRKLLWSTLYAGLSAAATLGARRAASRIWRIATGEEPPTKK*
Ga0068855_10103571033300005563Corn RhizosphereGLAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK*
Ga0070664_10013951123300005564Corn RhizosphereMWTGLYAGLAAVSTLLTRRLASKIWRVATGEAPPTKR*
Ga0070664_10053178023300005564Corn RhizosphereMLRKAMWTGLYAGLGAASTIVARRLATKVWQVATGEEPPTKR*
Ga0066693_1005840333300005566SoilVLRKLLWTGLYSGLAAGATIAARRAASKIWTVATGEQPPTKR*
Ga0066708_1043572433300005576SoilMLRKLLWSGLYAGLSAAATMGARRAASRIWRIATGEEPPTKK*
Ga0066708_1086445223300005576SoilMLRKLMWTGLYAAIGAAATLVARRAATKIWNILTGEDPPTKK*
Ga0066654_1016316033300005587SoilMREFPVRATGKMGDAMVRKILWSGLYAGLGAAATLGARRAASSVWRLATGEEPPVKR*
Ga0066905_10072684823300005713Tropical Forest SoilMLRRLLWTGLYASLAAAATLAARRTATKIWRIATGEEPPVKR*
Ga0066905_10220901713300005713Tropical Forest SoilMWTGLYGALAAAATLAARRTATKIWHVATGEEPPVTKRR*
Ga0068863_10220245023300005841Switchgrass RhizosphereSGNDPGMLRKLLWTGLYAGLVAGATMVARRAASGIWQAATGEEPPVKK*
Ga0081538_1011915423300005981Tabebuia Heterophylla RhizosphereVIRKLIWTGLYAGLGALATLAARTVATRIWRIATGEEPPIKKK*
Ga0070717_1013044553300006028Corn, Switchgrass And Miscanthus RhizosphereMLRKAMWTGLYAGLAAVSAVVARRVATRVWWVATGEEPPSKK*
Ga0066652_10008547133300006046SoilMLRKLLWTGLYAGFGAAATVVARRAASQVYRIATGEEPPTRK*
Ga0066652_10025161153300006046SoilAARAEEMLLRKALWSALYAGFAAVAALGARRTASSIWRLATGEAPPPTR*
Ga0066652_10080028333300006046SoilMLLRKALWSALYAGFGAAAALGARRTASSIWRLATGEDPPTTR*
Ga0075364_1022020033300006051Populus EndosphereMWTGLYAALAAAATAGARKVAAKIWRTVTGEHPPVKAR*
Ga0075432_1008280933300006058Populus RhizosphereMLRKLLWTGLLAGLSAVAAIAARRTADQVWRVLTGEEPPAKK*
Ga0066653_1013510913300006791SoilMLLRKALWSALYAGFAAVAALGARRTASSIWRLATGEAPPPTR*
Ga0066660_1031197233300006800SoilMLRKLLWTGLYAGLSAGAAIAARRAAGRIWRIATGEEPPTKR*
Ga0066660_1052896423300006800SoilMLRKILWNGLYAGVGAAATVGARRVASSIWRIATGEEPPTKK*
Ga0066660_1124604323300006800SoilVLRKALWTGLYAGIGAASTIVARRVASKVWRIATGEEPPTKK*
Ga0066660_1156962023300006800SoilMLMRKAMWTGLYAGLGAVATMASRRLASRVWRATMHEEPPTKK*
Ga0075428_10121833923300006844Populus RhizosphereMLRKLLWTGLYAALGAAATIVARSVASRIWRIATGEAPPTKK*
Ga0075428_10216861223300006844Populus RhizosphereMLRKLLWTGLYGAIAALATIVARKIATKIWGVATGESPPAKT*
Ga0075421_10054554323300006845Populus RhizosphereLAESPTGNHPGVLRKVLWLGLYAGLSAAATLVARKTASQVWRAATGEQPPVHK*
Ga0075425_10000596843300006854Populus RhizosphereMLRKLMWTGLYAAVGAAATLVARRAATKIWHILTGEEPPTKK*
Ga0075425_10224882213300006854Populus RhizospherePMLRKALWTGLYAGIGAAATIAARRVATKVWQVATGEDPPTKK*
Ga0079217_1000346583300006876Agricultural SoilMLLRKLLWTGLYAALAAAATMASRRAASRIWRIATGEAPPAKK*
Ga0079215_1111324033300006894Agricultural SoilGLYAGLAAGASIGARRLASKIWRVTTGEAPPAKK*
Ga0075436_10080639923300006914Populus RhizosphereMVRKILWSGLYAGLAAAATMSARRAATSVWRLATGEDPPA
Ga0079219_1030538323300006954Agricultural SoilMLRKLLWTGLYAAIGAVATLVARRSATKIWNILTGEDPPTKR*
Ga0079219_1049214913300006954Agricultural SoilSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK*
Ga0075419_1133659123300006969Populus RhizosphereMLRKLLWKGLYGVIAALATIVAKKIATKIWNVATGEAPPAKT*
Ga0079218_1171902423300007004Agricultural SoilMLRKLLWTGLYAGLAAAATMGARRVASKVWRVVTGEAPPTKK*
Ga0104326_13034453300007740SoilMLRKLLWTGLYAALSAAATIAARRAASQIWRIATGETPPTKK*
Ga0066710_10018317833300009012Grasslands SoilMLRKLLWTGLYGGIAAGATVVARKTASTVWRIATGEQPPARQ
Ga0066710_10064754713300009012Grasslands SoilLLWTGLYASLGAAATIGARTVASRLWRVMTGEQPPVKK
Ga0066710_10328196523300009012Grasslands SoilVLRKALWSGLYAGFGAVATIAARRAASAVWRIGTGEEPPTKK
Ga0105240_1107776233300009093Corn RhizosphereMLRKILWNGLYAGVGAVATLGARRAASSIWRIATGEEPPTRK*
Ga0105240_1189527223300009093Corn RhizosphereMLRKAMWTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK*
Ga0111539_1106008533300009094Populus RhizosphereMIKRFLWTGLYAGIGAAATLGARKVATKIYRVLTGEPPPVKR*
Ga0111539_1181583113300009094Populus RhizosphereMLRKLMWTGLYAALAAAATAGARKVAAKIWRTVTGEHPPVKAR*
Ga0066709_10043698343300009137Grasslands SoilMLRKLLWTGLYAGLGAGATIAARRAASTIWRIATGEPPPTKR*
Ga0066709_10080542933300009137Grasslands SoilMLRKLLWTGLYGGIAAGATVIARKTASTVWRIATGEQPPARQ*
Ga0066709_10249143823300009137Grasslands SoilMLRKLMWTVLYGVIGAAATLVARRSATKIWNILTGEEPPTKR*
Ga0066709_10326971123300009137Grasslands SoilVLRKALWSGLYAGFGAVATIAARRAASAVWRIGTGEEPPTKK*
Ga0114129_1042379923300009147Populus RhizosphereMWTGLYTSLAAAATLVARRAARKIWVVATGEEPPEKK*
Ga0114129_1057150523300009147Populus RhizosphereLAESPTGNHPGVLRKVLWLGLYAGLSAAATLVARKTASQLWRAATGEQPPVHK*
Ga0114129_1088397933300009147Populus RhizosphereMLLRKALWTGLYALLAAIATMASRRAASRIWRIATGEAPPAKR*
Ga0105243_1057629513300009148Miscanthus RhizosphereGLAESASGNEPGMLRKLLWTGLLAGLSAAATIAARRAATQLWRTATGEAPPVRK*
Ga0075423_1105423623300009162Populus RhizosphereLAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASEIWHAATGEAPPVKK*
Ga0105242_1295557323300009176Miscanthus RhizosphereMWTGLSAGLAAVSTLVTRRLASKIWRVATGEAPPIKK*
Ga0105249_1208553623300009553Switchgrass RhizosphereMLRKLLWTGLYGAIAALATIIAKKIATKIWNVATGEAPPAKT*
Ga0126307_1003172373300009789Serpentine SoilMLRRVMWTGLYAGLGAAATLAARRVASRIWRIATGEEPPTKK*
Ga0126307_1036048423300009789Serpentine SoilMVRKAMWTGLYAALGAAATFAARTLASKIWRLTTGEPPPVKK*
Ga0126307_1038238023300009789Serpentine SoilMLRRLTWTGLYALFGAVATVAARRLSSRIWRIATGEEPPTKK*
Ga0105068_107585413300009836Groundwater SandGLYAGLGALATIAARTVASRVWRVATGETPPAKK*
Ga0126313_10000181313300009840Serpentine SoilMLRKLLWTGLYAGVGALATMLSRRVASRIWHVATGETPPTKK*
Ga0126313_1174377523300009840Serpentine SoilLLWTGLYASLGAAATIAARRVASRIWRIATGEAPPTKK*
Ga0126305_1000750673300010036Serpentine SoilMWTGLYAGLGAAATLAARRVASRIWRIATGEEPPTKK*
Ga0126305_1028755333300010036Serpentine SoilMVRKAMWTGLYAALGAAATFAARTLASKIWRVTTGEPPPVKK*
Ga0126305_1093173823300010036Serpentine SoilMLRRLTWTGLYAILGAVATVASRRLSSRIWRIATGEEPPTKK*
Ga0126304_1005639363300010037Serpentine SoilMLRKLFWTGLYAGLAAVASLAARRVASKIWRITTGEAPPAKK*
Ga0126309_1005903713300010039Serpentine SoilTGLYAGLGAAATLAARRLASRIWRIATGEEPPTRK*
Ga0126309_1008649533300010039Serpentine SoilMLRKLTWSALYAALGAAAAVGARAIASKIWRVTTGEEPPAKK*
Ga0126309_1010776323300010039Serpentine SoilMLRKLLWSGLYAALGAAAAIGARAAASKIWRATTGEEPPVKK*
Ga0126309_1045054533300010039Serpentine SoilMIRKAMWTGLYAGLGAAATIGARTVATRIWRVLTGEQPPVRR*
Ga0126309_1057974523300010039Serpentine SoilMLRKVLWTGLYSALGAAATLAARRLASRIWRIATGEDPPARK*
Ga0126309_1076083423300010039Serpentine SoilMLRKVMWTGLYASLGAAATLVARRLASRIWRIATGEEPPTRK*
Ga0126309_1120797923300010039Serpentine SoilMLRKLLWSGLYASLGAAATLAARRVASKIWRITTGEAPPVKK*
Ga0126308_1001939653300010040Serpentine SoilMLRRLTWTGLYALFGAVATVAARRLSSRIWRIATGEEPPTKR*
Ga0126308_1025149823300010040Serpentine SoilMLRKAMWTGLYASLGAAATLAARRLASRIWRIATGEEPPIKK*
Ga0126308_1055551623300010040Serpentine SoilMLRKLTWSTLYAVLGAAAAVGARAIASKIWRVTTGEEPPAKK*
Ga0126312_1018743333300010041Serpentine SoilMLRKLLWTGLYAGIGALATMLSRRVASRIWHVATGETPPTKK*
Ga0126312_1024727913300010041Serpentine SoilQPPRGKSWGMLRKLLWSGLYAALGAAAAVGARAAASKIWRATTGEEPPVKK*
Ga0126314_1011643523300010042Serpentine SoilMLRRLTWTGLYAILGAVATLASRRLSSRIWRIATGEEPPTKK*
Ga0126314_1046192423300010042Serpentine SoilMLRKFMWTGLYAALGAAATLITRRAATSIWRLATGEQPPTKK*
Ga0126380_1070064723300010043Tropical Forest SoilMLRRLVWTGLYASLAAAATLVARKTATKIWHVATGEEPPVKR*
Ga0126310_1088128033300010044Serpentine SoilMLRKVMWTGLYAGLGAASTLASRRLASRIWRVLTGEEPPTRK*
Ga0126310_1099363323300010044Serpentine SoilMLRRVTWTALYAVIAAASTLVARRVASRIWRIATGEEPP
Ga0126310_1116614123300010044Serpentine SoilMLRKVTWTALYASLGAAATLAARRLASRIWRIATGEEPPTRK*
Ga0126311_1040344733300010045Serpentine SoilMLRRVMWTGLYAGLGAAATIAARRVASRIWRIATGEAPPTKK*
Ga0126311_1174630013300010045Serpentine SoilMLRKLLWTGLYASLGAAATIAARRVASRIWRIATGEAPPTKK*
Ga0126321_101724413300010145SoilKLLWTGLYAALGAAATIAARTLASRIWRIATGERPPVKR*
Ga0126321_124025213300010145SoilGLYAGLGAAATIGARVVASRIWRIATGEKPPVKK*
Ga0126321_128477443300010145SoilKLLWTGLYAGLGAGATLAARRVASRIWRIATGEEPPTKK*
Ga0126321_134974013300010145SoilGLYAGLGAAATIGARAVASRVWRVATGEQPPVKK*
Ga0126321_139281543300010145SoilKLLWTGLYAGIAALATIVARTLASRIWRVATGEAPPVKK*
Ga0126318_1005330333300010152SoilGLYAGFGALSTMAARRLASKVWRVTTGEEPPTKR*
Ga0126318_1006292913300010152SoilGLYAGLGAAATIASRRLASKIWRVTTGEEPPTKK*
Ga0126318_1018156533300010152SoilGLYAGLGAASTMVTRRLAAKVWHVATGEEPPTRR*
Ga0126318_1018397313300010152SoilGIYAGVGAGATIAARTVASRIWRVAHGEEPPAKR*
Ga0126318_1018531543300010152SoilAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR*
Ga0126318_1043526413300010152SoilGLYAGLGAASTMITRRLATKIWRIATGEEPPTGR*
Ga0126318_1048186613300010152SoilTGLAAGLGAAASLASRRLASEIWRVATGEEPPTKK*
Ga0126318_1088241233300010152SoilLWSGLYAGFGAASSLVAYKFASTIWRVATGDEPPGTQ*
Ga0126318_1107765013300010152SoilALYAAIGAAATLTARKTASSIWRLATGEEPPAKR*
Ga0126306_1052557323300010166Serpentine SoilMWTGLYAGLGAAATLAARRVASRIWRIATGEEPPT
Ga0134067_1030715423300010321Grasslands SoilMLRKVLWSSLYAGLGAAATIGARRVASSVWRLATGEEPPAKR*
Ga0134084_1040843713300010322Grasslands SoilSLYAGLGAAATIGARRVASSVWRLATGEEPPAKR*
Ga0134064_1037516413300010325Grasslands SoilSISFLLAAAATLAARKTASTIWRVATGEEPPVRK*
Ga0134111_1013454513300010329Grasslands SoilLWTGLYGGIAAGATVVARKTASKVWRLATGEEPPTTR*
Ga0134062_1051166713300010337Grasslands SoilMLRKLLWTSLYGGIAAGATVVARKTASTVWRIATGEEPPARK*
Ga0126377_1030981723300010362Tropical Forest SoilMLRKLLWTGLFSALGAAAAMGAHRTAAGIWKLATGEEPPERK*
Ga0134066_1031513013300010364Grasslands SoilMLRKLMWTVLYGVIGAAATLVARRSATKIWNILTGEEPPTKK*
Ga0134128_1099777233300010373Terrestrial SoilMLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGDEPPQKR*
Ga0134126_1041085723300010396Terrestrial SoilMLRKILWTGLYAGISAIASLGARRTASSIWRLTTGEEPPTNK*
Ga0134126_1216064033300010396Terrestrial SoilGLYAGIAAGATVAARTLASRIWRVATGEEPPVKK*
Ga0134124_1103850933300010397Terrestrial SoilMGLYAGIAAGATFVARTLASRIWRVATGEEPPVKK*
Ga0134127_1080802433300010399Terrestrial SoilMLRKVMWTGLYAAIGAVATVAARTLASRIWRVTTGEQPPVKK*
Ga0134127_1247648713300010399Terrestrial SoilMLRQLLWTGLYGAIAALAPIVARKIATKIWGVATGEAPPAKT*
Ga0134123_1104347033300010403Terrestrial SoilMLRKVMWTGLYAAIGAVATVAARTLASRIWRVTTGEQPPMKK*
Ga0105246_1060666113300011119Miscanthus RhizosphereMWTGLYAGLGAASTIVARRLATKVWQVATGEEPPTKR*
Ga0120156_100972653300011996PermafrostMLRKLLWTGLYAALSAAATIAARRAASQIWRIATGETPPTK
Ga0136631_1039583323300012043Polar Desert SandMLRKLLWTGLYAGLGAAATIGARRVASKIWRVTTGEAPPVKK*
Ga0136625_119444323300012091Polar Desert SandMLRKLLWTGLYASLAAAATMASRRAASRIWRIATGEEPPAKK*
Ga0136621_101525763300012092Polar Desert SandMLRKLLWTGLYASLAAAATMASRRAASRIWRIATGEEPPAKT*
Ga0136632_1003939053300012093Polar Desert SandMLRKFLWSALYGALGAGATMVARRVASRVWRIATGEAPPAKR*
Ga0137382_1128154423300012200Vadose Zone SoilMLRKALWTGLYASIGAASTIVARRLASKVWRVTTGEEPPTKK*
Ga0137374_1076687823300012204Vadose Zone SoilMLRKAMWTGLYAGLGAAATLAARRLASRIWRIATGEEPPTKK*
Ga0137374_1077301133300012204Vadose Zone SoilMVLRKILWSGLYAGLGAAATIAARRAASSLWRIATGEEPPAKR*
Ga0137380_1119726623300012206Vadose Zone SoilMLRKLLWTGLYAGLGAGATIAARRAASTIWRITTGEAPPTKR*
Ga0137376_1039893143300012208Vadose Zone SoilMWNGLYGALAAAATLVARRTASKIWRVTTGEEPPVKRK*
Ga0150985_10357514213300012212Avena Fatua RhizosphereGLYAAVGAGATLAARRVSSTIWRVATGEEPPTRK*
Ga0150985_10466758333300012212Avena Fatua RhizosphereLWSGLYAGLGAAATVGARRVASSVWRLATGEEPPAKR*
Ga0150985_10469490413300012212Avena Fatua RhizosphereILWSSLYAGAGAAATVASRRAATSIWRLATGEEPPAKR*
Ga0150985_10772534213300012212Avena Fatua RhizosphereKLLWTGLYAAMGALATLAARRVSASIWRIATGEEPPTKR*
Ga0150985_10773337213300012212Avena Fatua RhizosphereKLLWTALYAGMRALATLAARRVSASLWRIMTGEEPPTKK*
Ga0150985_11076477143300012212Avena Fatua RhizosphereMLRKAMWTGLYAGFGAASTMVARRLAAKVWQVATGEAPPTKK*
Ga0150985_11196151223300012212Avena Fatua RhizosphereMLRKALWTGLYAAIGAATTILARRVASKVWRIVTGEEPPTKK*
Ga0150985_11379861623300012212Avena Fatua RhizosphereILWSALYAGLGAAATIGARRVASSVWRLATGEEPPAKR*
Ga0150985_11533577813300012212Avena Fatua RhizosphereKALWTGLYAGIGAAATVAARRVATKVWQGATGEDPPARK*
Ga0150985_11586524413300012212Avena Fatua RhizosphereKILWSGLYAGFGAAATIGARRVASSVWRLATGEEPPAKR*
Ga0150985_11591244513300012212Avena Fatua RhizosphereRRPREVVPMLRKVLWSGLYAGVGAVMTMAAQRAASTVWRLSTGETPPESR*
Ga0150985_11839603113300012212Avena Fatua RhizosphereLWSALYAGLGAMATMGARRVASSVWRLATGEEPPAKR*
Ga0150985_11976965963300012212Avena Fatua RhizosphereGLYAGAGAAATVASRRTATSIWRLATGEAPPAKR*
Ga0137366_1013807433300012354Vadose Zone SoilLPARAGGKAEDMVLRKILWSGLYAGLGAAATIAARRAASSLSRIATG*
Ga0137369_1035235933300012355Vadose Zone SoilVLRKLLWTGLYAGLGAAATIAARRLASRIWRILTGEEPPTKK*
Ga0137371_1102136123300012356Vadose Zone SoilMLRKLLWTGLYAGLGAGATIAARRAASTIWRIATGEAPPTKR*
Ga0137371_1135198723300012356Vadose Zone SoilMLRKAMWTGLYAAIGAAATLVARRLASKIWRIATGEAPPTKK*
Ga0150984_10297269653300012469Avena Fatua RhizosphereQTCALPISGLYAGLAAASTLATRRLASKIWRVATGEAPPTKR*
Ga0150984_10340119113300012469Avena Fatua RhizospherePMLRKVLWSGLYAGLGAAATVGARRVASSVWRLATGEEPPAKR*
Ga0150984_10403206333300012469Avena Fatua RhizosphereKVMWSGLSASLLAASRLVTRRLAARIWHVATGEAPPAKR*
Ga0150984_10464437913300012469Avena Fatua RhizosphereGLYAAVGAGATVVARLLATRIWRVATGEEPPSKR*
Ga0150984_10794819413300012469Avena Fatua RhizosphereAMWTGLYAGLAAVSTLITRRIAAKIWYVATGEAPPTKK*
Ga0150984_11065937133300012469Avena Fatua RhizosphereLWTGLYAAMGALATLAARRASASIWRIATGEDPPTKK*
Ga0150984_11066978023300012469Avena Fatua RhizosphereLWTGLYAAMGALATLAARRVSASIWRIATGEEPPTKR*
Ga0150984_11068782953300012469Avena Fatua RhizosphereLWTGLYAAMGALATLAARRVSASLWRVMTGEEPPTKK*
Ga0150984_11112985413300012469Avena Fatua RhizosphereILWSSLYAGVGAAATLASRRAATSIWRLATGEEPPAKR*
Ga0150984_11117935063300012469Avena Fatua RhizosphereLWTGLYAGIGAAATVAARRVATKVWQGATGEDPPARK*
Ga0150984_11241408413300012469Avena Fatua RhizosphereVCSSDLTGLYATLGAVATLASRRLSSRIWRIATGEEPPIKK*
Ga0150984_11922205023300012469Avena Fatua RhizosphereMVRKILWSALYAGLGAMATMGARRVASSVWRLTTGEEPPAKR*
Ga0150984_12073464613300012469Avena Fatua RhizosphereILWSGLYVGAGAAATLASRRAASSIWRLATGEEPPAKR*
Ga0150984_12087184743300012469Avena Fatua RhizosphereYTGGQMLRKGMWMGLYAGIGALATLVARRLASSIWRIATGEEPPTKK*
Ga0150984_12146875313300012469Avena Fatua RhizosphereNLRIGALAWTGLSGILVAVGTIAARRAAAGIWRIATGEHPPTKKT*
Ga0150984_12266047013300012469Avena Fatua RhizosphereAMWQGLRAGLAAASALVTRRLASRIWRVATGEPPPVKR*
Ga0157344_100429423300012476Arabidopsis RhizosphereMLRKLLWLGLYAGLSAAATLVARKTASQVWRAATGEAPPVHK*
Ga0136630_120199433300012529Polar Desert SandMLRKLLWTGLYASLAAAATIASRRAASRIWRIATGEEPPAKK*
Ga0136613_1006379723300012681Polar Desert SandMLRKLLWAGLYASLAAAATMASRRAASRIWRIATGEEPPAKT*
Ga0136614_10005617103300012684Polar Desert SandMLRRTLWTALFGLLGAVSTILSRRLASVIWRIATGETPPAKK*
Ga0137397_1045228123300012685Vadose Zone SoilMLRKALWTGLYAGIGAAATVAARRVASRIWRLMTGEEPPTKK*
Ga0157292_1027545713300012900SoilRAGMLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK*
Ga0157291_1022452713300012902SoilMLLRKALWTGLYALLAAVATMASRRAASRIWRIATGEAPPAKR*
Ga0157286_1025435933300012908SoilGKRAGMLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK*
Ga0137394_1087235213300012922Vadose Zone SoilMLRKALWTGLYAGIGAAATVAARRVASRIWRLMTGE
Ga0164299_1041841123300012958SoilMLRKLLWTGLYAGLAAGATMVARRTASKIWLVATGEAPPTKK*
Ga0164302_1069507523300012961SoilMLRKLLWTGLYAAVGAAATVAARRVATKVWQIATGEEPPTKT*
Ga0134110_1028399233300012975Grasslands SoilTGLYAGFGAAATIVARRAASTVYRLATGEEPPVKR*
Ga0154016_14284533300013045Corn, Switchgrass And Miscanthus RhizosphereTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK*
Ga0157373_1096364423300013100Corn RhizosphereMLRKVLWSGLYAAFGAAATLGARRTASSRWRRATGE
Ga0163162_1109637343300013306Switchgrass RhizosphereLLWTGLYAGIAAGATIVARTLASRIWRVATGEEPPVKK*
Ga0157372_1287439623300013307Corn RhizosphereMSMLRKMLWSGLYAVVGAVATLASRRAARSIWRLATGEQPPTTK*
Ga0182001_1044622723300014488SoilMLRKLLWTGLYAGLGAGATLAARRVASRVWRIATGEDPPTKK*
Ga0182008_1001300253300014497RhizosphereMLRKLLWTGLYAGLGAAATVGARRTASSIWRLATGEEPPTKK*
Ga0182008_1007258833300014497RhizosphereMLRKILWTGLYSGLGAVATIGARRAASSIWRIATGEEP
Ga0182008_1017401123300014497RhizosphereMLRKILWTGLYSGIGAVATLGARRAASSIWRLATGEEPPTKK*
Ga0182008_1081931823300014497RhizosphereMLRKLMWTGLYAGLAAAATMVARRTASQIWRIATGEEPPTKK*
Ga0173483_1007945933300015077SoilVLRKLLWTGLYAGIAAGATIVARTLASRIWRVATGEE
Ga0180093_103391233300015258SoilMLLRKALWAGLYAALAAVATMASRRAASRIWRIATGEAPPVKR*
Ga0182005_126705213300015265RhizosphereMLRKLLWTGLYAGLAAGATMVARRAASGIWQAATGEAPPVKK*
Ga0134085_1020270823300015359Grasslands SoilMLRKLLWTSLYGGIAAGATVVARKTASTVWRIATGEDPPARQ*
Ga0132258_1001739263300015371Arabidopsis RhizosphereMVRKILWSGLYAGIGAAATLGARRAATSIWRLATGEEPPAKR*
Ga0132258_1072588213300015371Arabidopsis RhizosphereMLRKLLWLGLYAGLSAAATLAAKKTATQLWQAATGEAPPVRK*
Ga0132255_10446640933300015374Arabidopsis RhizosphereWTGLYGAIAALATIVAKKIATKIWNVATGEAPPAKT*
Ga0136617_1001107373300017789Polar Desert SandMLRKLLWTGLYASLAAAATMASRRAASRIWRIATGEEPPAKK
Ga0163161_1173966013300017792Switchgrass RhizosphereLAESSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK
Ga0187824_1025996723300017927Freshwater SedimentMRGLVRKAMWTGLYAGLGALATMGSRRAASLIWRKTTGEEPPTKK
Ga0190266_1001164233300017965SoilMLLRKALWTGLYAALAAVATMASRRAASRIWRIATGEAPPAKR
Ga0190266_1065710323300017965SoilMLRKLLWTGLYAAIGAAATLAARRVASKIWRIATGEAPPAKR
Ga0187776_1000273033300017966Tropical PeatlandVLRKLLWTGLYTGLAAGATLAARRAASKIWTLATGEAPPAKR
Ga0184605_1011078323300018027Groundwater SedimentMLRKLLWTGLYAGLSAAAAIAARRVASQIWRIATGETPPTKK
Ga0187787_1006692823300018029Tropical PeatlandLAKSSSGKQPGLLQKLLWTGLAAGATLAAHRAASKIWTLATGEAPPKKR
Ga0184617_121936023300018066Groundwater SedimentMLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEEPPAKK
Ga0184618_1000767443300018071Groundwater SedimentMLRKLLWTGLYAGLSAAAAIVARRVASQIWRIASGETPPTKK
Ga0184618_1027571033300018071Groundwater SedimentMLRKALWTGLYAALAAAATMASRRAASRIWRIATGE
Ga0184618_1044710523300018071Groundwater SedimentMWNGLYGALAAAATLAARRAASKIWRVTTGEEPPVK
Ga0184635_1016084323300018072Groundwater SedimentMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK
Ga0184632_1043388313300018075Groundwater SedimentMWTGLYASLAAAATLAARKTATKIWQVTTGEDPPVKK
Ga0184639_1048860813300018082Groundwater SedimentTGLYAGIAAGATIVARTLASRIWRVATGEEPPVKK
Ga0184628_1024669723300018083Groundwater SedimentMLLRKALWAGLYAALAAVATMASRRAASRIWRIATGEAPPVKR
Ga0190265_1227129913300018422SoilMLLRKALWTGLYALLAAAATMASRRAASRIWRIATGEPPPAKK
Ga0190272_1327680723300018429SoilMLLRKALWTGLYELLTAAATMASRRAACRIWRIATGEAAPAKK
Ga0066655_1030683833300018431Grasslands SoilMLRKLLWTSLYGGIAAGATVVARKTASTVWRIATGEEP
Ga0066655_1076009523300018431Grasslands SoilMLRKLLWTGLYAGFGAAATIVARRAASTVYRIATGEEPPVKR
Ga0066667_1043105413300018433Grasslands SoilTGLYGGIAAGATVIARKTASTVWRIATGEQPPARQ
Ga0066667_1071744323300018433Grasslands SoilVVIRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPVKK
Ga0190268_1001442963300018466SoilMLRKLRWTGLYASLAAAATMASRRAASRIWRIATGEEPPAKK
Ga0190268_1016928913300018466SoilMLLRKLLWTGLYAALAAAATMASRRAASRIWRIATGEAPPAKR
Ga0066662_1028955423300018468Grasslands SoilVLRKALWTGLYAGIGAASTIVARRVASKVWRIATGEEPPTKK
Ga0190270_1000953883300018469SoilMASRYACTVVLRKLMWTGLYASLAAAATLAARKTATKIWQVTTGEEPPVKKK
Ga0190270_1005955753300018469SoilMLLRKLLWTGLYAALAAVATMASRRAASRIWRIATGEAPPAKK
Ga0066669_1069043713300018482Grasslands SoilDMREFPVRATGKMGDAMVRKILWSGLYAGLGAAATLGARRAASSVWRLATGEEPPVKR
Ga0066669_1104853233300018482Grasslands SoilWSGLYAGLSAAATMTARRAASRIWRIATGEEPPTKK
Ga0066669_1237573623300018482Grasslands SoilMLRKLLWTGLYGGIAAGATVVARKTASKVWRLATGEEPPTTR
Ga0184643_127019913300019255Groundwater SedimentLLWTGLYAGLAAAATIGARTVASRIWRIATGEQPPAKK
Ga0184643_145747233300019255Groundwater SedimentTGLYGGLAAAATLAARRAASKIWRVTTGEEPPVKK
Ga0184642_110299743300019279Groundwater SedimentNHKSMIRKLLWTGLYAGLAAAATIGARTVASRIWRIATGEQPPAKK
Ga0173482_1053930523300019361SoilMWTGLYAGISAGAAIAARRAATKIWMVVTGEEPPTKKT
Ga0173479_1021649023300019362SoilMLLRKALWTGLYALLAAAATMVSRRAASRIWRIATGEAPPAKK
Ga0190267_1003668633300019767SoilMLLRKLLWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK
Ga0193720_100279523300019868SoilMLRKLLWTGLYAGLSAGATIAARRAASQIWRIATGETPPTKK
Ga0193741_106051723300019884SoilMWTGLYASLAAAATLVARRAATKIWTVATGEEPPVKK
Ga0193729_114752533300019887SoilMLRKLLWTALYAGFGAAATIAARRAASTVYRIATGEEPPVKK
Ga0193728_105641423300019890SoilMLRKLLWTALYAGFGAAATIAARRAASTVYRIATGEEPPIKK
Ga0193735_107227313300020006SoilVGNLTSMLRKLLWTGLYAGLSAGATIAARRAASQIWRIATGETPPTKK
Ga0197907_1047830113300020069Corn, Switchgrass And Miscanthus RhizosphereKAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR
Ga0197907_1082000573300020069Corn, Switchgrass And Miscanthus RhizosphereMLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR
Ga0206356_1051480643300020070Corn, Switchgrass And Miscanthus RhizosphereVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR
Ga0206356_1059051383300020070Corn, Switchgrass And Miscanthus RhizosphereMVRKVLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR
Ga0206356_1085915033300020070Corn, Switchgrass And Miscanthus RhizosphereMLRKALWSGLYAAFGAIATLGARRTASSIWRLATGEEPPQKR
Ga0206351_1006944513300020077Corn, Switchgrass And Miscanthus RhizosphereRKAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR
Ga0206352_1128483933300020078Corn, Switchgrass And Miscanthus RhizosphereWTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK
Ga0206353_1080753523300020082Corn, Switchgrass And Miscanthus RhizosphereMLRKILWSGLYAGLGAAATVGARRVATSMWRLATGEEPPARR
Ga0206353_1104332123300020082Corn, Switchgrass And Miscanthus RhizosphereMLRKAMWTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK
Ga0182009_1034715623300021445SoilMLRKLLWTGLYAGLAAGATMVARRAASGIWQAATGEAPPVKK
Ga0182009_1053088223300021445SoilMLRKLAWTALYGILGAAATLAARRAAAGIWRIATGEQPPTKTR
Ga0222624_116989233300021951Groundwater SedimentSASGNEPGMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK
Ga0222624_128941913300021951Groundwater SedimentNDPGMLRKLLWTGLYAGLAAGATMLARRAASQLWRLATGEAPPVKK
Ga0222625_181427713300022195Groundwater SedimentNEPGMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVRK
Ga0224712_1006852913300022467Corn, Switchgrass And Miscanthus RhizosphereAMWTGLYAGLGAASTMVARRLASKIWRVTTGEEPPTKK
Ga0224712_1010584113300022467Corn, Switchgrass And Miscanthus RhizosphereLWSGLYAAFGAAATLGARRTASSIWRRATGEEPPQKR
Ga0224712_1023378733300022467Corn, Switchgrass And Miscanthus RhizosphereWTGLYAGLGAASTMMARRLASKIWRVTTGEEPPTKK
Ga0222622_1096159423300022756Groundwater SedimentMLRKLLWTGLYAGLAAGATMVARRAASQLWRIATGEAPPVKK
Ga0247681_100526743300024310SoilMLRKLLWTGLYAGLVAGATMVARRAASGIWQAATGEEPPVKK
Ga0207692_1086267413300025898Corn, Switchgrass And Miscanthus RhizosphereGERVDMLRKAMWTGLYAGLAAVSAVVARRDATRVWWVATGEEPPSKK
Ga0207645_1087973813300025907Miscanthus RhizosphereGNEPGMLRKLLWTGLLAGLSAAATIAARRAATQLWRTATGEAPPVRK
Ga0207705_1005523743300025909Corn RhizosphereMLRKILWSGLYAGLGAAATVGARRVASSVWRLATGEEPPAKR
Ga0207705_1094864623300025909Corn RhizosphereMWTGLYAGLAAVSTLLTRRLASKIWRVATGEAPPTKR
Ga0207705_1118669213300025909Corn RhizosphereMEGMLRKLLWSGLYAGLGAAATIGARRAASSIWRIATGEEPPTKK
Ga0207654_1054147723300025911Corn RhizosphereMLRKAMWTGLYAGFGAASTMIARRLATKVWHVATGEEPPTKK
Ga0207707_1058163323300025912Corn RhizosphereMLRKAMWTGLYAGFGAASTMIARRLATKVWHVATGEDPPTKK
Ga0207693_1024646523300025915Corn, Switchgrass And Miscanthus RhizosphereMLRKLLWTALYAGFGAAATIVARKAASSVYRIATGEEPPTKK
Ga0207693_1049418913300025915Corn, Switchgrass And Miscanthus RhizosphereTLPRKPLLRKALWTGLYAGLGALATLASRRLAARIWRTVTGEEPPTKK
Ga0207663_1079372933300025916Corn, Switchgrass And Miscanthus RhizosphereMTLPRKPLLRKALWTGLYAGLGALATLASRRLAARIWRTVTGEEPPTKK
Ga0207663_1087251213300025916Corn, Switchgrass And Miscanthus RhizosphereKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK
Ga0207657_1036552023300025919Corn RhizosphereMRSVLRKLLWSGLYAGIGAAATIGARRAASSIWRAATGEEPPTKR
Ga0207657_1041912423300025919Corn RhizosphereMEAMLRKLLWSGLYAGLGAAATIGARRVASSIWRIATGEQPPTKK
Ga0207657_1140499423300025919Corn RhizosphereMLRKILWSGLYAGLGAAATVGARRVATSMWRLATGEEP
Ga0207646_1143508623300025922Corn, Switchgrass And Miscanthus RhizosphereMLRKLLWSALYAGLSAAAALGTRRAASRIWPIATGEEPPTKK
Ga0207664_1060226033300025929Agricultural SoilMLRKAMWTGLYAGLAAVSAVVARRVATRVWWVATGEEPPSKK
Ga0207664_1082162413300025929Agricultural SoilMLRKILWSGLYAGFGAAATIGARRVASSVWRLATGEEPPAKR
Ga0207644_1106515223300025931Switchgrass RhizosphereMLRKLLWTGLYSAVGAAATVVARRVATKVWHIATGEEPPTKK
Ga0207644_1121335323300025931Switchgrass RhizosphereMLRKLLWTGLYAAVGAAATVAARRVATKVWQIATGEEPPTKK
Ga0207644_1152132213300025931Switchgrass RhizosphereELSSGNDPGMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK
Ga0207690_1147103313300025932Corn RhizosphereRKAMWTGLYAGLGAASTIVARRLATKVWQVATGEEPPTKR
Ga0207709_1019474053300025935Miscanthus RhizosphereSASGNEPGMLRKLLWTGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK
Ga0207689_1019851533300025942Miscanthus RhizosphereMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVRK
Ga0207702_1175709023300026078Corn RhizosphereMLRKAMWTGLYAGLGAASTMMARRLASKIWRVTTGEEPPTKK
Ga0207683_1104704433300026121Miscanthus RhizosphereKALWTGLYALLAAAATMASRRAASRIWRIATGEAPPAKK
Ga0209153_101230823300026312SoilMPGKGGVAVLRKALWSGLYAGFGAVATIVSRRAAAKVWEIGTGEEPPTKK
Ga0209153_110429213300026312SoilVLRKLLWTGLYSGLAAGATIAARRAASKIWTVATGEQPP
Ga0209473_102873433300026330SoilMLRKLLWTALYAGFGAGATMVARKAASSVYRIATGEEPPTKR
Ga0209056_1032745723300026538SoilMLRKLLWTGLYAGLGAGATVAARRAASRFWGLATGEEPPTKK
Ga0209376_123150323300026540SoilMLRKLLWTGLYAGFGAAATIVARRAASTVYRLATGEEPPVKR
Ga0209156_1014932913300026547SoilARAKEMLLRKVLWSGLYAGLGAAATIAARRAASSLWRIATGEDPPAKR
Ga0209474_1016970623300026550SoilVLRKALWTGLYASIGAASTIVARRIASKVWRIATGEEPPTKK
Ga0209474_1032708323300026550SoilMLRKALWTGLYAGVGAAATVAARRVSSKIWRLATGEEPPTKK
Ga0209818_106151533300027637Agricultural SoilMLLRKLLWTGLYAALAAAATMASRRAASRIWRIATGEAPPAKK
Ga0209810_10000153493300027773Surface SoilMWTGLYAGLGAASTMVSRRLASKIWRVMTGEEPPTKK
Ga0209177_1050886423300027775Agricultural SoilKIGSSMLRKILWAGLYAGLAAAATMTARRAATSIWRLATGEEPPQKR
Ga0209074_1000934853300027787Agricultural SoilMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKK
Ga0209481_1060304523300027880Populus RhizosphereMWTGLYAALAAAATAGARKVAAKIWRTVTGEHPPVKAR
Ga0207428_1010993533300027907Populus RhizosphereMLRKLLWTGLLAGLSAVAAIAARRTADQVWRVLTGEEPPAKK
Ga0207428_1043270933300027907Populus RhizosphereMLRKLLWTGLYGAIAALATIVARKIATKIWGVATGESPPAKT
Ga0207428_1050078723300027907Populus RhizosphereLAESPTGNHPGVLRKLLWLGLYAGLSAAATLVARKTASQVWRAATGEAPPVKKK
Ga0247713_102510333300028104SoilMRRLLWKGLYAGIAAGATIIARSVAAKVWRTATGERPPEK
Ga0307322_1004334143300028710SoilIRKLLWTGLYAGLAAAATIGARTVASRIWRIATGEQPPAKK
Ga0307313_1018419113300028715SoilAGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK
Ga0307298_1010591623300028717SoilMLRKLLWSGLYAGLSAAAAIAARRVASQIWRIATGETPPTKK
Ga0307319_1027413823300028722SoilMLLRKALWTGLYALLAAVATMASRRAASRIWRIATGEAPPAKK
Ga0307316_1010740433300028755SoilMLRKLLWAGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK
Ga0307282_1012612133300028784SoilVLRKLLWTGLYAGLSAAATIAARRAASQIWRIATGETPPTKK
Ga0307282_1028559423300028784SoilMLRKLLWTGLYASLSAGAAIAARRVASQIWRIATGETPPTKK
Ga0307290_1006192153300028791SoilGLAESASGNEPGMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK
Ga0307284_1025790633300028799SoilHPVLRKLMWTGLYGGLAAAATLAARRAASKIWRVTTGEEPPVKK
Ga0307305_1009071023300028807SoilMIRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPVKK
Ga0307305_1015148133300028807SoilMLRKLLWTGLYAGLSAGAAIAARRAASQIWRIATGETPPTKK
Ga0307305_1022155523300028807SoilMWNGLYGALAAAATLAARRAASKIWRVTTGEEPPLKRK
Ga0307292_1023243813300028811SoilLMWSGLYGTLAAAASMAARKTASKIWRVTTGEEPPVKKK
Ga0247825_1141406313300028812SoilMLRKLLWTGLYGAIAALATIVAKKIATKIWNVATGEAPPAKT
Ga0307302_1022392733300028814SoilMWTGLYAGIGAAATIAARRIASRIWRIATGEEPPTKK
Ga0307312_1082616423300028828SoilVLRKLMWTGLYGGLAAAATIAARRAASKIWRVTTGEEPPVKK
Ga0307286_1014161533300028876SoilLAESASGNEPGMLRKLLWAGLLAGLSAAATFAARRTAAQLWRTATGEAPPVKKK
Ga0307278_1002011883300028878SoilVIRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPVKK
Ga0307277_1001968533300028881SoilMLRKLLWTGLYGALGAAATLAARRAASQIWRIATGEEPPTKR
Ga0307277_1023560623300028881SoilMLRKLLWTGLYAGLGAAATIGARTVASRIWRIATGEQPPVKK
Ga0307277_1041159413300028881SoilRKILWSGLYAGIGAAATIGARRAASSIWRLATGEEPPAKR
Ga0307308_1058232223300028884SoilMLRKLLWTGLYASLSAVAAIAARRVASQIWRIATGETPPTKK
Ga0299907_1013334633300030006SoilVLRKLLWTGLYAGLGAAATIGARKVASRIWRVTTGEEPPVKK
Ga0247826_1133581823300030336SoilVLRKLLWTGLLAGFTAAAALAAKKSAAQVWRLLTGEEPPAKK
Ga0102752_155556313300030783SoilPGLYAGLGAAATIGVRRVASKVWRVATGEAPPTKK
Ga0308203_101175313300030829SoilLLWTGLYAGIAAGATIVARTLASRIWRVATGEEPPVKK
Ga0308202_102903713300030902SoilGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK
Ga0308201_1001785613300031091SoilKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVKKK
Ga0308201_1007158513300031091SoilLLWTGLYAGIAAGATVVARTLASRIWRVATGEEPPVKK
Ga0308201_1009503233300031091SoilSASGNEPGMLRKLLWTGLLAGLTAAATFAARRTAAQLWRTATGEAPPVKKK
Ga0308201_1021920813300031091SoilLLWTGLYAGLAAGATMVARRAASQLWRIATGEAPPVKK
Ga0308201_1022021013300031091SoilRASGLYAGLSAGATIAARRAASQIWRIATGETPPTKK
Ga0308204_1023524233300031092SoilDSASGNEPGMLRKLLWTGLLAGLTAAATFAARRTAAQLWRTATGEAPPVKKK
Ga0308197_1005054913300031093SoilMLLWTGLYAGIAAGATIVARTLASRIWRVATGEEPPVKK
Ga0308187_1010795833300031114SoilASGNEPGMLRKLLWTGLLAGLSAAATVAARRAATQLWRTATGEAPPVRK
Ga0307506_1018743813300031366SoilMWTGLYAGLAAISTLATRRLASTIWRVATGEAPPIKK
Ga0307408_10029665423300031548RhizosphereMLRKAMWTGLYASLGAAATLAARRLASRIWRIATGEEPPIKK
Ga0307408_10031503743300031548RhizosphereMLRKAMWTGLYAALGAAATFAARTLASKIWRLTTGEPPPVKK
Ga0310904_1059326033300031854SoilMLLRKALWTGLYALLAAIATMASRRAASRIWRIATGEAPPAKR
Ga0307407_1109383913300031903RhizosphereWTGLYASLGAAATLAARRLASRIWRIATGEEPPIKK
Ga0308175_10011733223300031938SoilMLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGGEPPQKR
Ga0308175_10032069033300031938SoilMLRKLLWTGLYAGLAAGATMVARRAASGIWHAATGEAPPVKKK
Ga0308175_10061029133300031938SoilMLRKILWSGLYAGVGAAATVGARRVASSVWRLATGEEPPAKR
Ga0308175_10068199423300031938SoilMLRKILWNGLYAGMSAVASLGARRAASSVWRLATGEEPPTKK
Ga0308175_10226586613300031938SoilMLRKALWSGLYAGVGAVSSLVAYRFASTVWRAATGDEPPGEQ
Ga0308176_1110072513300031996SoilLRKVLWSGLYAAFGAAATLGARRTASSIWRRATGGEPPQKR
Ga0308176_1166079323300031996SoilMLRKILWSGLYAGLGAAATIGARRVASSVWRLATGEEPPAKR
Ga0310906_1116585813300032013SoilVLRKLLWTGLYAGIAAGATIAARTLASRIWRVATG
Ga0308173_1032796043300032074SoilMVRKILWSALYAGLGAAATIGARRVASSVWRLATGEEPPAKR
Ga0308173_1098410933300032074SoilMVRKVLWSGLYAGLGAAATIGARRVATSVWRLATGEEPPAKR
Ga0310890_1060135823300032075SoilMLRKLMWTGLYAAIAAAATVAARTVASKIWRAATGEPPPVK
Ga0326721_1059266523300032080SoilMLRKLMWTGLYAALGAAATIAARTVASRIWRVVTGEQPPVKK
Ga0335080_1029083333300032828SoilVLRKLLWTGLYTGLAAGATLAAHRAASKIWTLATGEAPPRKR
Ga0335080_1140744623300032828SoilVLQKLLWTGLYSGLAAGATLAAHRTAAKIWTLATGEPPPKKKR
Ga0335080_1238499423300032828SoilALYGIFGALATLVARRAAAGVWRIATGEQPPVKKR
Ga0335069_1192848223300032893SoilMHRKLVHKLAWTGLYAGVSALATVAARRVASRLWRAGTGEAPPAPR
Ga0310811_1135806023300033475SoilHMLRKAMWTGLYAGLGAASTMVTRRLAAKIWHVATGEEPPTKR
Ga0247830_1136664133300033551SoilKLMYTGLYAAIAAAATVAARTVASKIWRVTTGEPPPVKK
Ga0364937_056516_213_3413300034113SedimentMLRKLLWAGLYAAIGAAATIAARQVASRVWRILTGEEPPTKK
Ga0364929_0358835_82_2133300034149SedimentMLRKLLWTGLYGSLAAAASLVARRTATKIWRVTTGEEPPVKKK
Ga0372943_0081646_1670_17983300034268SoilMLRKILWSGLYVGFGAVATIGARRVASSVWRLTTGEEPPAKR
Ga0372943_1223871_169_2973300034268SoilMLRKLLWTGLYAVFGALATLAARRAATGIWRMATGEEPPAKR


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.