Basic Information | |
---|---|
Family ID | F004207 |
Family Type | Metagenome |
Number of Sequences | 448 |
Average Sequence Length | 36 residues |
Representative Sequence | LSVTLFEKTPILQALQASDSDTDLLDPGNQLILFDF |
Number of Associated Samples | 267 |
Number of Associated Scaffolds | 448 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.67 % |
% of genes near scaffold ends (potentially truncated) | 98.44 % |
% of genes from short scaffolds (< 2000 bps) | 67.86 % |
Associated GOLD sequencing projects | 252 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.28 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (66.518 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog (8.036 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.250 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.759 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 25.00% β-sheet: 0.00% Coil/Unstructured: 75.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.28 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 448 Family Scaffolds |
---|---|---|
PF00589 | Phage_integrase | 1.34 |
PF14294 | DUF4372 | 1.12 |
PF12728 | HTH_17 | 0.89 |
PF01850 | PIN | 0.67 |
PF08241 | Methyltransf_11 | 0.67 |
PF00171 | Aldedh | 0.67 |
PF13470 | PIN_3 | 0.67 |
PF08281 | Sigma70_r4_2 | 0.67 |
PF00535 | Glycos_transf_2 | 0.67 |
PF13683 | rve_3 | 0.67 |
PF13620 | CarboxypepD_reg | 0.67 |
PF13692 | Glyco_trans_1_4 | 0.67 |
PF01381 | HTH_3 | 0.67 |
PF01610 | DDE_Tnp_ISL3 | 0.67 |
PF13649 | Methyltransf_25 | 0.67 |
PF01609 | DDE_Tnp_1 | 0.67 |
PF01436 | NHL | 0.45 |
PF14659 | Phage_int_SAM_3 | 0.45 |
PF00837 | T4_deiodinase | 0.45 |
PF00005 | ABC_tran | 0.45 |
PF16640 | Big_3_5 | 0.45 |
PF02321 | OEP | 0.45 |
PF02518 | HATPase_c | 0.45 |
PF13638 | PIN_4 | 0.45 |
PF01370 | Epimerase | 0.45 |
PF01425 | Amidase | 0.45 |
PF02397 | Bac_transf | 0.45 |
PF00270 | DEAD | 0.45 |
PF13517 | FG-GAP_3 | 0.45 |
PF07592 | DDE_Tnp_ISAZ013 | 0.45 |
PF12543 | DUF3738 | 0.45 |
PF13546 | DDE_5 | 0.45 |
PF00328 | His_Phos_2 | 0.45 |
PF07729 | FCD | 0.45 |
PF13088 | BNR_2 | 0.45 |
PF04365 | BrnT_toxin | 0.45 |
PF00872 | Transposase_mut | 0.45 |
PF03992 | ABM | 0.45 |
PF13676 | TIR_2 | 0.45 |
PF13340 | DUF4096 | 0.45 |
PF00483 | NTP_transferase | 0.45 |
PF00106 | adh_short | 0.45 |
PF00665 | rve | 0.45 |
PF14522 | Cytochrome_C7 | 0.45 |
PF07494 | Reg_prop | 0.45 |
PF13450 | NAD_binding_8 | 0.22 |
PF00753 | Lactamase_B | 0.22 |
PF06739 | SBBP | 0.22 |
PF07690 | MFS_1 | 0.22 |
PF08447 | PAS_3 | 0.22 |
PF01814 | Hemerythrin | 0.22 |
PF05853 | BKACE | 0.22 |
PF06155 | GBBH-like_N | 0.22 |
PF13490 | zf-HC2 | 0.22 |
PF01790 | LGT | 0.22 |
PF02604 | PhdYeFM_antitox | 0.22 |
PF12831 | FAD_oxidored | 0.22 |
PF13682 | CZB | 0.22 |
PF13091 | PLDc_2 | 0.22 |
PF00923 | TAL_FSA | 0.22 |
PF01112 | Asparaginase_2 | 0.22 |
PF01116 | F_bP_aldolase | 0.22 |
PF14509 | GH97_C | 0.22 |
PF13476 | AAA_23 | 0.22 |
PF00195 | Chal_sti_synt_N | 0.22 |
PF13180 | PDZ_2 | 0.22 |
PF01966 | HD | 0.22 |
PF00135 | COesterase | 0.22 |
PF13701 | DDE_Tnp_1_4 | 0.22 |
PF01435 | Peptidase_M48 | 0.22 |
PF13431 | TPR_17 | 0.22 |
PF02661 | Fic | 0.22 |
PF03235 | DUF262 | 0.22 |
PF14478 | DUF4430 | 0.22 |
PF00877 | NLPC_P60 | 0.22 |
PF10067 | DUF2306 | 0.22 |
PF02449 | Glyco_hydro_42 | 0.22 |
PF08448 | PAS_4 | 0.22 |
PF01695 | IstB_IS21 | 0.22 |
PF00154 | RecA | 0.22 |
PF13655 | RVT_N | 0.22 |
PF14748 | P5CR_dimer | 0.22 |
PF01261 | AP_endonuc_2 | 0.22 |
PF00593 | TonB_dep_Rec | 0.22 |
PF07676 | PD40 | 0.22 |
PF13751 | DDE_Tnp_1_6 | 0.22 |
PF00082 | Peptidase_S8 | 0.22 |
PF00295 | Glyco_hydro_28 | 0.22 |
PF05711 | TylF | 0.22 |
PF10042 | DUF2278 | 0.22 |
PF03466 | LysR_substrate | 0.22 |
PF13365 | Trypsin_2 | 0.22 |
PF00702 | Hydrolase | 0.22 |
PF08543 | Phos_pyr_kin | 0.22 |
PF13356 | Arm-DNA-bind_3 | 0.22 |
PF05193 | Peptidase_M16_C | 0.22 |
PF13421 | Band_7_1 | 0.22 |
PF13561 | adh_short_C2 | 0.22 |
PF00873 | ACR_tran | 0.22 |
PF00149 | Metallophos | 0.22 |
PF07728 | AAA_5 | 0.22 |
PF01979 | Amidohydro_1 | 0.22 |
PF13610 | DDE_Tnp_IS240 | 0.22 |
PF13439 | Glyco_transf_4 | 0.22 |
PF13578 | Methyltransf_24 | 0.22 |
PF13472 | Lipase_GDSL_2 | 0.22 |
PF13602 | ADH_zinc_N_2 | 0.22 |
PF00578 | AhpC-TSA | 0.22 |
PF01593 | Amino_oxidase | 0.22 |
PF01522 | Polysacc_deac_1 | 0.22 |
PF13565 | HTH_32 | 0.22 |
PF07075 | DUF1343 | 0.22 |
PF12631 | MnmE_helical | 0.22 |
PF00970 | FAD_binding_6 | 0.22 |
PF12770 | CHAT | 0.22 |
PF02371 | Transposase_20 | 0.22 |
PF14559 | TPR_19 | 0.22 |
PF13385 | Laminin_G_3 | 0.22 |
PF01909 | NTP_transf_2 | 0.22 |
PF16347 | DUF4976 | 0.22 |
PF04389 | Peptidase_M28 | 0.22 |
PF02195 | ParBc | 0.22 |
PF04796 | RepA_C | 0.22 |
PF07313 | DUF1460 | 0.22 |
PF06067 | DUF932 | 0.22 |
PF00144 | Beta-lactamase | 0.22 |
PF10091 | Glycoamylase | 0.22 |
PF13005 | zf-IS66 | 0.22 |
PF04008 | Adenosine_kin | 0.22 |
PF02223 | Thymidylate_kin | 0.22 |
PF00675 | Peptidase_M16 | 0.22 |
PF01833 | TIG | 0.22 |
PF03706 | LPG_synthase_TM | 0.22 |
PF13271 | DUF4062 | 0.22 |
PF01053 | Cys_Met_Meta_PP | 0.22 |
PF00480 | ROK | 0.22 |
PF00348 | polyprenyl_synt | 0.22 |
PF02574 | S-methyl_trans | 0.22 |
PF01204 | Trehalase | 0.22 |
PF01548 | DEDD_Tnp_IS110 | 0.22 |
PF13231 | PMT_2 | 0.22 |
PF01098 | FTSW_RODA_SPOVE | 0.22 |
PF01797 | Y1_Tnp | 0.22 |
PF13411 | MerR_1 | 0.22 |
PF05239 | PRC | 0.22 |
PF00078 | RVT_1 | 0.22 |
PF13493 | DUF4118 | 0.22 |
PF01641 | SelR | 0.22 |
PF00148 | Oxidored_nitro | 0.22 |
PF02470 | MlaD | 0.22 |
PF03332 | PMM | 0.22 |
PF14319 | Zn_Tnp_IS91 | 0.22 |
PF01184 | Gpr1_Fun34_YaaH | 0.22 |
PF08483 | Obsolete Pfam Family | 0.22 |
PF07238 | PilZ | 0.22 |
PF13175 | AAA_15 | 0.22 |
PF13384 | HTH_23 | 0.22 |
PF07642 | BBP2 | 0.22 |
PF01526 | DDE_Tnp_Tn3 | 0.22 |
PF05128 | DUF697 | 0.22 |
PF14602 | Hexapep_2 | 0.22 |
PF12840 | HTH_20 | 0.22 |
PF12704 | MacB_PCD | 0.22 |
PF02591 | zf-RING_7 | 0.22 |
PF00881 | Nitroreductase | 0.22 |
PF03400 | DDE_Tnp_IS1 | 0.22 |
PF06250 | YhcG_C | 0.22 |
PF00083 | Sugar_tr | 0.22 |
PF03441 | FAD_binding_7 | 0.22 |
PF03720 | UDPG_MGDP_dh_C | 0.22 |
PF01637 | ATPase_2 | 0.22 |
PF02685 | Glucokinase | 0.22 |
PF08808 | RES | 0.22 |
PF00072 | Response_reg | 0.22 |
PF09957 | VapB_antitoxin | 0.22 |
PF02511 | Thy1 | 0.22 |
PF01555 | N6_N4_Mtase | 0.22 |
PF06736 | TMEM175 | 0.22 |
PF00962 | A_deaminase | 0.22 |
PF01523 | PmbA_TldD | 0.22 |
PF09721 | Exosortase_EpsH | 0.22 |
PF13646 | HEAT_2 | 0.22 |
PF00255 | GSHPx | 0.22 |
PF00486 | Trans_reg_C | 0.22 |
PF05168 | HEPN | 0.22 |
PF02880 | PGM_PMM_III | 0.22 |
PF13466 | STAS_2 | 0.22 |
PF04972 | BON | 0.22 |
PF11154 | DUF2934 | 0.22 |
PF08450 | SGL | 0.22 |
PF00528 | BPD_transp_1 | 0.22 |
PF01408 | GFO_IDH_MocA | 0.22 |
PF13614 | AAA_31 | 0.22 |
PF00430 | ATP-synt_B | 0.22 |
PF00239 | Resolvase | 0.22 |
PF13484 | Fer4_16 | 0.22 |
PF01757 | Acyl_transf_3 | 0.22 |
PF01208 | URO-D | 0.22 |
PF02357 | NusG | 0.22 |
PF07638 | Sigma70_ECF | 0.22 |
COG ID | Name | Functional Category | % Frequency in 448 Family Scaffolds |
---|---|---|---|
COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.89 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 0.67 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.67 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.67 |
COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 0.67 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.67 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.67 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.67 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 0.67 |
COG1802 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.45 |
COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 0.45 |
COG2148 | Sugar transferase involved in LPS biosynthesis (colanic, teichoic acid) | Cell wall/membrane/envelope biogenesis [M] | 0.45 |
COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.45 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.45 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.45 |
COG2929 | Ribonuclease BrnT, toxin component of the BrnT-BrnA toxin-antitoxin system | Defense mechanisms [V] | 0.45 |
COG3292 | Periplasmic ligand-binding sensor domain | Signal transduction mechanisms [T] | 0.45 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.45 |
COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.45 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.45 |
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.45 |
COG0711 | FoF1-type ATP synthase, membrane subunit b or b' | Energy production and conversion [C] | 0.22 |
COG0726 | Peptidoglycan/xylan/chitin deacetylase, PgdA/NodB/CDA1 family | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0772 | Peptodoglycan polymerase FtsW/RodA/SpoVE | Cell cycle control, cell division, chromosome partitioning [D] | 0.22 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0837 | Glucokinase | Carbohydrate transport and metabolism [G] | 0.22 |
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.22 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG1109 | Phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.22 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.22 |
COG1373 | Predicted ATPase, AAA+ superfamily | General function prediction only [R] | 0.22 |
COG1446 | Isoaspartyl peptidase or L-asparaginase, Ntn-hydrolase superfamily | Amino acid transport and metabolism [E] | 0.22 |
COG1479 | DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domains | Defense mechanisms [V] | 0.22 |
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 0.22 |
COG1579 | Predicted nucleic acid-binding protein DR0291, contains C4-type Zn-ribbon domain | General function prediction only [R] | 0.22 |
COG1584 | Succinate-acetate transporter SatP | Energy production and conversion [C] | 0.22 |
COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.22 |
COG1626 | Neutral trehalase | Carbohydrate transport and metabolism [G] | 0.22 |
COG1662 | Transposase and inactivated derivatives, IS1 family | Mobilome: prophages, transposons [X] | 0.22 |
COG1672 | Predicted ATPase, archaeal AAA+ ATPase superfamily | General function prediction only [R] | 0.22 |
COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.22 |
COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG1816 | Adenosine/6-amino-6-deoxyfutalosine deaminase | Nucleotide transport and metabolism [F] | 0.22 |
COG1839 | Adenosine/AMP kinase | Nucleotide transport and metabolism [F] | 0.22 |
COG1874 | Beta-galactosidase GanA | Carbohydrate transport and metabolism [G] | 0.22 |
COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.22 |
COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.22 |
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.22 |
COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.22 |
COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.22 |
COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.22 |
COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.22 |
COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 0.22 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.22 |
COG2240 | Pyridoxal/pyridoxine/pyridoxamine kinase | Coenzyme transport and metabolism [H] | 0.22 |
COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.22 |
COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.22 |
COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.22 |
COG2452 | Predicted site-specific integrase-resolvase | Mobilome: prophages, transposons [X] | 0.22 |
COG2710 | Nitrogenase Mo-Fe protein NifD/coenzyme F430 biosynthesis subunit CfbD | Coenzyme transport and metabolism [H] | 0.22 |
COG2870 | ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.22 |
COG3246 | Uncharacterized conserved protein, DUF849 family | Function unknown [S] | 0.22 |
COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.22 |
COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.22 |
COG3424 | Predicted naringenin-chalcone synthase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.22 |
COG3536 | Uncharacterized conserved protein, DUF971 family | Function unknown [S] | 0.22 |
COG3548 | Uncharacterized membrane protein | Function unknown [S] | 0.22 |
COG3768 | Uncharacterized membrane protein YcjF, UPF0283 family | Function unknown [S] | 0.22 |
COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.22 |
COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 0.22 |
COG4644 | Transposase and inactivated derivatives, TnpA family | Mobilome: prophages, transposons [X] | 0.22 |
COG4804 | Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 family | General function prediction only [R] | 0.22 |
COG5434 | Polygalacturonase | Carbohydrate transport and metabolism [G] | 0.22 |
COG5654 | Predicted toxin component of a toxin-antitoxin system, contains RES domain | Defense mechanisms [V] | 0.22 |
COG0033 | Phosphoglucomutase/phosphomannomutase | Carbohydrate transport and metabolism [G] | 0.22 |
COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.22 |
COG0125 | Thymidylate kinase | Nucleotide transport and metabolism [F] | 0.22 |
COG0142 | Geranylgeranyl pyrophosphate synthase | Coenzyme transport and metabolism [H] | 0.22 |
COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.22 |
COG0176 | Transaldolase/fructose-6-phosphate aldolase | Carbohydrate transport and metabolism [G] | 0.22 |
COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.22 |
COG0229 | Peptide methionine sulfoxide reductase MsrB | Posttranslational modification, protein turnover, chaperones [O] | 0.22 |
COG0250 | Transcription termination/antitermination protein NusG | Transcription [K] | 0.22 |
COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.22 |
COG0332 | 3-oxoacyl-[acyl-carrier-protein] synthase III | Lipid transport and metabolism [I] | 0.22 |
COG0351 | Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase | Coenzyme transport and metabolism [H] | 0.22 |
COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.22 |
COG0392 | Predicted membrane flippase AglD2/YbhN, UPF0104 family | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.22 |
COG0415 | Deoxyribodipyrimidine photolyase | Replication, recombination and repair [L] | 0.22 |
COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.22 |
COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.22 |
COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.22 |
COG0524 | Sugar or nucleoside kinase, ribokinase family | Carbohydrate transport and metabolism [G] | 0.22 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.22 |
COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.22 |
COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.22 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.22 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 66.74 % |
Unclassified | root | N/A | 33.26 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908004|PBDC3_FUFP16391_g1 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300001213|JGIcombinedJ13530_104288586 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
3300001534|A15PFW1_10203130 | Not Available | 761 | Open in IMG/M |
3300004091|Ga0062387_101768020 | Not Available | 504 | Open in IMG/M |
3300004092|Ga0062389_102109403 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300005447|Ga0066689_10912526 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 543 | Open in IMG/M |
3300005531|Ga0070738_10012485 | All Organisms → cellular organisms → Bacteria | 7289 | Open in IMG/M |
3300005531|Ga0070738_10045241 | All Organisms → cellular organisms → Bacteria | 2830 | Open in IMG/M |
3300005602|Ga0070762_11047205 | Not Available | 561 | Open in IMG/M |
3300005764|Ga0066903_102968499 | Not Available | 919 | Open in IMG/M |
3300005830|Ga0074473_10853379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
3300005938|Ga0066795_10055311 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1171 | Open in IMG/M |
3300005995|Ga0066790_10310766 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300006055|Ga0097691_1001005 | All Organisms → cellular organisms → Bacteria | 21968 | Open in IMG/M |
3300006057|Ga0075026_100913639 | Not Available | 540 | Open in IMG/M |
3300006059|Ga0075017_100053317 | All Organisms → cellular organisms → Bacteria | 2723 | Open in IMG/M |
3300006059|Ga0075017_100232411 | All Organisms → cellular organisms → Bacteria | 1343 | Open in IMG/M |
3300006162|Ga0075030_100212187 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
3300006162|Ga0075030_100512578 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300006638|Ga0075522_10020419 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4183 | Open in IMG/M |
3300006638|Ga0075522_10029826 | All Organisms → cellular organisms → Bacteria | 3325 | Open in IMG/M |
3300006638|Ga0075522_10395931 | Not Available | 653 | Open in IMG/M |
3300006642|Ga0075521_10078455 | All Organisms → cellular organisms → Bacteria | 1488 | Open in IMG/M |
3300006795|Ga0075520_1001663 | All Organisms → cellular organisms → Bacteria | 10804 | Open in IMG/M |
3300006795|Ga0075520_1051144 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
3300006864|Ga0066797_1010722 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 3112 | Open in IMG/M |
3300006893|Ga0073928_10003333 | All Organisms → cellular organisms → Bacteria | 25594 | Open in IMG/M |
3300006950|Ga0075524_10296444 | Not Available | 709 | Open in IMG/M |
3300009012|Ga0066710_104397916 | Not Available | 526 | Open in IMG/M |
3300009012|Ga0066710_104676521 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 512 | Open in IMG/M |
3300009029|Ga0066793_10063155 | Not Available | 2112 | Open in IMG/M |
3300009029|Ga0066793_10469216 | Not Available | 721 | Open in IMG/M |
3300009029|Ga0066793_10722720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300009032|Ga0105048_10096520 | All Organisms → cellular organisms → Bacteria | 3933 | Open in IMG/M |
3300009175|Ga0073936_10074510 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2931 | Open in IMG/M |
3300009175|Ga0073936_10164184 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1641 | Open in IMG/M |
3300009524|Ga0116225_1543252 | Not Available | 516 | Open in IMG/M |
3300009547|Ga0116136_1089539 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 808 | Open in IMG/M |
3300009552|Ga0116138_1065114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 1029 | Open in IMG/M |
3300009614|Ga0116104_1011570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2725 | Open in IMG/M |
3300009618|Ga0116127_1095959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 783 | Open in IMG/M |
3300009629|Ga0116119_1109365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 693 | Open in IMG/M |
3300009630|Ga0116114_1053785 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1129 | Open in IMG/M |
3300009633|Ga0116129_1003560 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7435 | Open in IMG/M |
3300009633|Ga0116129_1010191 | Not Available | 3696 | Open in IMG/M |
3300009633|Ga0116129_1102326 | Not Available | 829 | Open in IMG/M |
3300009633|Ga0116129_1138993 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
3300009640|Ga0116126_1075408 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300009700|Ga0116217_10880442 | Not Available | 550 | Open in IMG/M |
3300009760|Ga0116131_1091540 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 920 | Open in IMG/M |
3300009760|Ga0116131_1206814 | Not Available | 547 | Open in IMG/M |
3300009762|Ga0116130_1254454 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
3300009868|Ga0130016_10128846 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2097 | Open in IMG/M |
3300010341|Ga0074045_10022656 | All Organisms → cellular organisms → Bacteria | 4881 | Open in IMG/M |
3300010341|Ga0074045_10255928 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1157 | Open in IMG/M |
3300010346|Ga0116239_10618267 | Not Available | 701 | Open in IMG/M |
3300010357|Ga0116249_10884713 | Not Available | 811 | Open in IMG/M |
3300010366|Ga0126379_10751329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1072 | Open in IMG/M |
3300010366|Ga0126379_11154395 | Not Available | 881 | Open in IMG/M |
3300010379|Ga0136449_100028629 | All Organisms → cellular organisms → Bacteria | 13625 | Open in IMG/M |
3300010379|Ga0136449_100253934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3262 | Open in IMG/M |
3300010379|Ga0136449_100319877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2813 | Open in IMG/M |
3300010379|Ga0136449_100516438 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2068 | Open in IMG/M |
3300010379|Ga0136449_100887956 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
3300010379|Ga0136449_103006787 | Not Available | 658 | Open in IMG/M |
3300010379|Ga0136449_104280487 | Not Available | 528 | Open in IMG/M |
3300010379|Ga0136449_104367903 | Not Available | 522 | Open in IMG/M |
3300010396|Ga0134126_12169864 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
3300010398|Ga0126383_11115835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3 | 878 | Open in IMG/M |
3300010429|Ga0116241_10029263 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes → unclassified Candidatus Hydrogenedentes → Hydrogenedentes bacterium JGI 0000077-D07 | 5480 | Open in IMG/M |
3300011270|Ga0137391_10676176 | Not Available | 860 | Open in IMG/M |
3300011271|Ga0137393_10913285 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300011420|Ga0137314_1111993 | Not Available | 671 | Open in IMG/M |
3300012209|Ga0137379_10000075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 78333 | Open in IMG/M |
3300012209|Ga0137379_10000097 | All Organisms → cellular organisms → Bacteria | 69845 | Open in IMG/M |
3300012210|Ga0137378_10258983 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
3300012353|Ga0137367_10048053 | All Organisms → cellular organisms → Bacteria | 3221 | Open in IMG/M |
3300012353|Ga0137367_10186027 | Not Available | 1508 | Open in IMG/M |
3300012353|Ga0137367_10536060 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
3300012532|Ga0137373_11257518 | Not Available | 518 | Open in IMG/M |
3300012923|Ga0137359_10234283 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1639 | Open in IMG/M |
3300012923|Ga0137359_10657880 | Not Available | 915 | Open in IMG/M |
3300012925|Ga0137419_11287320 | Not Available | 614 | Open in IMG/M |
(restricted) 3300013130|Ga0172363_10645363 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 667 | Open in IMG/M |
3300014152|Ga0181533_1001114 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 35122 | Open in IMG/M |
3300014152|Ga0181533_1013578 | All Organisms → cellular organisms → Bacteria | 5861 | Open in IMG/M |
3300014152|Ga0181533_1339931 | Not Available | 537 | Open in IMG/M |
3300014153|Ga0181527_1009469 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 7311 | Open in IMG/M |
3300014156|Ga0181518_10392633 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
3300014160|Ga0181517_10001531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 25503 | Open in IMG/M |
3300014160|Ga0181517_10001729 | All Organisms → cellular organisms → Bacteria | 23549 | Open in IMG/M |
3300014160|Ga0181517_10028166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 3716 | Open in IMG/M |
3300014160|Ga0181517_10042787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2842 | Open in IMG/M |
3300014160|Ga0181517_10115707 | Not Available | 1543 | Open in IMG/M |
3300014160|Ga0181517_10366483 | All Organisms → cellular organisms → Bacteria | 745 | Open in IMG/M |
3300014160|Ga0181517_10497976 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300014161|Ga0181529_10193641 | Not Available | 1198 | Open in IMG/M |
3300014167|Ga0181528_10078351 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1808 | Open in IMG/M |
3300014167|Ga0181528_10368270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 781 | Open in IMG/M |
3300014199|Ga0181535_10597288 | Not Available | 633 | Open in IMG/M |
3300014489|Ga0182018_10000271 | All Organisms → cellular organisms → Bacteria | 68851 | Open in IMG/M |
3300014489|Ga0182018_10119827 | Not Available | 1525 | Open in IMG/M |
3300014489|Ga0182018_10453563 | Not Available | 682 | Open in IMG/M |
3300014490|Ga0182010_10223746 | All Organisms → cellular organisms → Bacteria | 993 | Open in IMG/M |
3300014490|Ga0182010_10714695 | Not Available | 564 | Open in IMG/M |
3300014490|Ga0182010_10799817 | Not Available | 534 | Open in IMG/M |
3300014491|Ga0182014_10000177 | All Organisms → cellular organisms → Bacteria | 77828 | Open in IMG/M |
3300014491|Ga0182014_10000765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 43517 | Open in IMG/M |
3300014491|Ga0182014_10004449 | All Organisms → cellular organisms → Bacteria | 16075 | Open in IMG/M |
3300014491|Ga0182014_10005520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 14012 | Open in IMG/M |
3300014491|Ga0182014_10007509 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11407 | Open in IMG/M |
3300014491|Ga0182014_10040985 | All Organisms → cellular organisms → Bacteria | 3354 | Open in IMG/M |
3300014491|Ga0182014_10050384 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2878 | Open in IMG/M |
3300014491|Ga0182014_10104614 | Not Available | 1694 | Open in IMG/M |
3300014491|Ga0182014_10125269 | Not Available | 1493 | Open in IMG/M |
3300014491|Ga0182014_10159272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1263 | Open in IMG/M |
3300014491|Ga0182014_10256237 | Not Available | 916 | Open in IMG/M |
3300014491|Ga0182014_10380340 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 708 | Open in IMG/M |
3300014492|Ga0182013_10026753 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4966 | Open in IMG/M |
3300014492|Ga0182013_10105330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 1890 | Open in IMG/M |
3300014492|Ga0182013_10227319 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300014493|Ga0182016_10018938 | All Organisms → cellular organisms → Bacteria | 6234 | Open in IMG/M |
3300014493|Ga0182016_10036545 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4042 | Open in IMG/M |
3300014493|Ga0182016_10670025 | Not Available | 585 | Open in IMG/M |
3300014494|Ga0182017_10269469 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
3300014494|Ga0182017_10274113 | Not Available | 1061 | Open in IMG/M |
3300014494|Ga0182017_10350276 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
3300014494|Ga0182017_10590975 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300014494|Ga0182017_10608111 | Not Available | 665 | Open in IMG/M |
3300014494|Ga0182017_10966690 | Not Available | 511 | Open in IMG/M |
3300014496|Ga0182011_10049270 | All Organisms → cellular organisms → Bacteria | 2989 | Open in IMG/M |
3300014496|Ga0182011_10559917 | Not Available | 731 | Open in IMG/M |
3300014499|Ga0182012_10010216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 9104 | Open in IMG/M |
3300014499|Ga0182012_10287990 | Not Available | 1112 | Open in IMG/M |
3300014499|Ga0182012_10373970 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 945 | Open in IMG/M |
3300014501|Ga0182024_10007858 | All Organisms → cellular organisms → Bacteria | 22840 | Open in IMG/M |
3300014501|Ga0182024_10014425 | All Organisms → cellular organisms → Bacteria | 15274 | Open in IMG/M |
3300014501|Ga0182024_10035285 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Rhodanobacteraceae → Rhodanobacter → unclassified Rhodanobacter → Rhodanobacter sp. OK091 | 8414 | Open in IMG/M |
3300014501|Ga0182024_10046518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella rosea | 6977 | Open in IMG/M |
3300014501|Ga0182024_10663862 | Not Available | 1293 | Open in IMG/M |
3300014501|Ga0182024_10833286 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
3300014501|Ga0182024_11982643 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
3300014502|Ga0182021_11098785 | All Organisms → cellular organisms → Bacteria | 958 | Open in IMG/M |
3300014638|Ga0181536_10300958 | Not Available | 746 | Open in IMG/M |
3300014655|Ga0181516_10044617 | Not Available | 2247 | Open in IMG/M |
3300014655|Ga0181516_10179653 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1073 | Open in IMG/M |
3300014745|Ga0157377_10766997 | Not Available | 707 | Open in IMG/M |
3300014838|Ga0182030_10406321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1415 | Open in IMG/M |
3300014838|Ga0182030_10652139 | Not Available | 1000 | Open in IMG/M |
3300014838|Ga0182030_10764694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 891 | Open in IMG/M |
3300014838|Ga0182030_10872555 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
3300014838|Ga0182030_11001115 | Not Available | 736 | Open in IMG/M |
3300014839|Ga0182027_10008472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 14959 | Open in IMG/M |
3300014839|Ga0182027_10100480 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3486 | Open in IMG/M |
3300014839|Ga0182027_10155364 | All Organisms → cellular organisms → Bacteria | 2691 | Open in IMG/M |
3300014839|Ga0182027_10186235 | All Organisms → cellular organisms → Bacteria | 2418 | Open in IMG/M |
3300014839|Ga0182027_10214694 | All Organisms → cellular organisms → Bacteria | 2222 | Open in IMG/M |
3300014839|Ga0182027_10232571 | All Organisms → cellular organisms → Bacteria | 2118 | Open in IMG/M |
3300014839|Ga0182027_10338095 | Not Available | 1691 | Open in IMG/M |
3300014839|Ga0182027_10340824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1683 | Open in IMG/M |
3300014839|Ga0182027_10358755 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6 | 1632 | Open in IMG/M |
3300014839|Ga0182027_10435225 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Puniceicoccales → Puniceicoccaceae → unclassified Puniceicoccaceae → Puniceicoccaceae bacterium | 1448 | Open in IMG/M |
3300014839|Ga0182027_10602498 | Not Available | 1180 | Open in IMG/M |
3300014839|Ga0182027_10609335 | Not Available | 1172 | Open in IMG/M |
3300014839|Ga0182027_10659660 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1114 | Open in IMG/M |
3300014839|Ga0182027_10782118 | Not Available | 1001 | Open in IMG/M |
3300014839|Ga0182027_11184895 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
3300014839|Ga0182027_11680166 | Not Available | 618 | Open in IMG/M |
3300014839|Ga0182027_11817645 | Not Available | 589 | Open in IMG/M |
3300014839|Ga0182027_12103098 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
3300014839|Ga0182027_12158487 | Not Available | 530 | Open in IMG/M |
3300014873|Ga0180066_1127328 | Not Available | 525 | Open in IMG/M |
3300015082|Ga0167662_1034483 | Not Available | 647 | Open in IMG/M |
3300015252|Ga0180075_1020515 | Not Available | 933 | Open in IMG/M |
3300015360|Ga0163144_10045572 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 7921 | Open in IMG/M |
3300016270|Ga0182036_11450645 | Not Available | 575 | Open in IMG/M |
3300016357|Ga0182032_10382645 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300017925|Ga0187856_1004891 | All Organisms → cellular organisms → Bacteria | 8745 | Open in IMG/M |
3300017935|Ga0187848_10275556 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
3300017941|Ga0187850_10282052 | Not Available | 740 | Open in IMG/M |
3300017941|Ga0187850_10360594 | Not Available | 637 | Open in IMG/M |
3300017943|Ga0187819_10486047 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300017946|Ga0187879_10106726 | All Organisms → cellular organisms → Bacteria | 1603 | Open in IMG/M |
3300017975|Ga0187782_10559002 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
3300017988|Ga0181520_10000047 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 219957 | Open in IMG/M |
3300017988|Ga0181520_10004296 | All Organisms → cellular organisms → Bacteria | 23999 | Open in IMG/M |
3300017988|Ga0181520_10004422 | All Organisms → cellular organisms → Bacteria | 23549 | Open in IMG/M |
3300017988|Ga0181520_10004775 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22297 | Open in IMG/M |
3300017988|Ga0181520_10023506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 83 | 6862 | Open in IMG/M |
3300017988|Ga0181520_10046297 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4212 | Open in IMG/M |
3300017988|Ga0181520_10169982 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
3300017988|Ga0181520_10294433 | All Organisms → cellular organisms → Bacteria | 1218 | Open in IMG/M |
3300017996|Ga0187891_1119616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 970 | Open in IMG/M |
3300017996|Ga0187891_1281544 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
3300018003|Ga0187876_1222257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
3300018004|Ga0187865_1002633 | All Organisms → cellular organisms → Bacteria | 16562 | Open in IMG/M |
3300018004|Ga0187865_1006452 | All Organisms → cellular organisms → Bacteria | 7593 | Open in IMG/M |
3300018009|Ga0187884_10055884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1824 | Open in IMG/M |
3300018009|Ga0187884_10114173 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium | 1163 | Open in IMG/M |
3300018015|Ga0187866_1083763 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1351 | Open in IMG/M |
3300018017|Ga0187872_10049842 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2245 | Open in IMG/M |
3300018023|Ga0187889_10014621 | All Organisms → cellular organisms → Bacteria | 4984 | Open in IMG/M |
3300018034|Ga0187863_10846290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
3300018035|Ga0187875_10041019 | All Organisms → cellular organisms → Bacteria | 2733 | Open in IMG/M |
3300018035|Ga0187875_10398777 | Not Available | 735 | Open in IMG/M |
3300018035|Ga0187875_10582954 | Not Available | 590 | Open in IMG/M |
3300018038|Ga0187855_10361805 | Not Available | 847 | Open in IMG/M |
3300018043|Ga0187887_10208341 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
3300018053|Ga0184626_10214056 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 814 | Open in IMG/M |
3300018059|Ga0184615_10103890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 1600 | Open in IMG/M |
3300019487|Ga0187893_10165385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1767 | Open in IMG/M |
3300019788|Ga0182028_1351043 | Not Available | 2029 | Open in IMG/M |
3300019888|Ga0193751_1148417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 844 | Open in IMG/M |
3300020021|Ga0193726_1247038 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
3300020083|Ga0194111_10331615 | Not Available | 1033 | Open in IMG/M |
3300020192|Ga0163147_10401792 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
3300020201|Ga0163154_10481357 | Not Available | 541 | Open in IMG/M |
3300020203|Ga0163148_10493732 | Not Available | 563 | Open in IMG/M |
3300020203|Ga0163148_10514139 | Not Available | 545 | Open in IMG/M |
3300020582|Ga0210395_10599821 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 827 | Open in IMG/M |
3300021168|Ga0210406_10308783 | All Organisms → cellular organisms → Bacteria | 1285 | Open in IMG/M |
3300021407|Ga0210383_11407295 | Not Available | 580 | Open in IMG/M |
3300021474|Ga0210390_10522222 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
3300021477|Ga0210398_11206894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 597 | Open in IMG/M |
3300021559|Ga0210409_11588709 | Not Available | 530 | Open in IMG/M |
3300021560|Ga0126371_12637315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 609 | Open in IMG/M |
3300022222|Ga0226658_10419709 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 598 | Open in IMG/M |
3300022524|Ga0224534_1018839 | Not Available | 1869 | Open in IMG/M |
3300022524|Ga0224534_1032971 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1218 | Open in IMG/M |
3300022526|Ga0224533_1038402 | Not Available | 807 | Open in IMG/M |
3300022553|Ga0212124_10407325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 714 | Open in IMG/M |
3300022849|Ga0224531_1000385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 23013 | Open in IMG/M |
3300022861|Ga0224528_1003097 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8665 | Open in IMG/M |
3300022861|Ga0224528_1006949 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 4180 | Open in IMG/M |
3300022861|Ga0224528_1018451 | Not Available | 1715 | Open in IMG/M |
3300022861|Ga0224528_1029973 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
3300022872|Ga0224526_1073627 | Not Available | 636 | Open in IMG/M |
3300022872|Ga0224526_1088316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300023075|Ga0224520_1084841 | Not Available | 709 | Open in IMG/M |
3300023088|Ga0224555_1003450 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 16099 | Open in IMG/M |
3300023090|Ga0224558_1062990 | All Organisms → cellular organisms → Bacteria | 1439 | Open in IMG/M |
3300023090|Ga0224558_1083908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 1160 | Open in IMG/M |
3300023090|Ga0224558_1146798 | Not Available | 761 | Open in IMG/M |
3300023090|Ga0224558_1174352 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
3300023101|Ga0224557_1016682 | All Organisms → cellular organisms → Bacteria | 4074 | Open in IMG/M |
3300023247|Ga0224529_1005071 | Not Available | 4494 | Open in IMG/M |
3300023247|Ga0224529_1006850 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3433 | Open in IMG/M |
3300023247|Ga0224529_1042585 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
3300023250|Ga0224544_1012193 | Not Available | 1164 | Open in IMG/M |
3300023258|Ga0224535_1127810 | Not Available | 536 | Open in IMG/M |
3300024233|Ga0224521_1053228 | Not Available | 900 | Open in IMG/M |
3300024233|Ga0224521_1124422 | Not Available | 549 | Open in IMG/M |
3300025404|Ga0208936_1014416 | Not Available | 992 | Open in IMG/M |
3300025409|Ga0208321_1024757 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
3300025409|Ga0208321_1043642 | Not Available | 697 | Open in IMG/M |
3300025444|Ga0208189_1030243 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
3300025448|Ga0208037_1021878 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.Bin141 | 1485 | Open in IMG/M |
3300025463|Ga0208193_1003257 | All Organisms → cellular organisms → Bacteria | 6214 | Open in IMG/M |
3300025506|Ga0208937_1014313 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2032 | Open in IMG/M |
3300025506|Ga0208937_1064930 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
3300025576|Ga0208820_1034878 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
3300025650|Ga0209385_1018591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2823 | Open in IMG/M |
3300025650|Ga0209385_1117914 | Not Available | 833 | Open in IMG/M |
3300025650|Ga0209385_1144856 | Not Available | 712 | Open in IMG/M |
3300025679|Ga0207933_1007716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5478 | Open in IMG/M |
3300025706|Ga0209507_1155283 | All Organisms → cellular organisms → Bacteria → FCB group → Candidatus Hydrogenedentes | 616 | Open in IMG/M |
3300025829|Ga0209484_10149487 | Not Available | 565 | Open in IMG/M |
3300025862|Ga0209483_1051293 | All Organisms → cellular organisms → Bacteria | 1943 | Open in IMG/M |
3300025878|Ga0209584_10272836 | Not Available | 649 | Open in IMG/M |
3300025888|Ga0209540_10070196 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
3300025903|Ga0207680_10712315 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
3300025910|Ga0207684_11102939 | Not Available | 660 | Open in IMG/M |
3300025944|Ga0207661_10000334 | All Organisms → cellular organisms → Bacteria | 30010 | Open in IMG/M |
3300026223|Ga0209840_1101120 | Not Available | 622 | Open in IMG/M |
3300026451|Ga0247845_1061576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 615 | Open in IMG/M |
3300026467|Ga0257154_1058464 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 602 | Open in IMG/M |
3300026489|Ga0257160_1006833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1514 | Open in IMG/M |
3300026502|Ga0255350_1003383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5303 | Open in IMG/M |
3300026502|Ga0255350_1091875 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium AB60 | 667 | Open in IMG/M |
3300026515|Ga0257158_1122524 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
3300026538|Ga0209056_10486149 | Not Available | 658 | Open in IMG/M |
3300026551|Ga0209648_10260100 | Not Available | 1278 | Open in IMG/M |
3300026551|Ga0209648_10296946 | Not Available | 1159 | Open in IMG/M |
3300027641|Ga0208827_1033456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1820 | Open in IMG/M |
3300027641|Ga0208827_1058487 | Not Available | 1260 | Open in IMG/M |
3300027706|Ga0209581_1000184 | All Organisms → cellular organisms → Bacteria | 195345 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10339036 | Not Available | 518 | Open in IMG/M |
3300027812|Ga0209656_10447068 | Not Available | 572 | Open in IMG/M |
3300027840|Ga0209683_10453160 | Not Available | 588 | Open in IMG/M |
3300027842|Ga0209580_10523692 | Not Available | 590 | Open in IMG/M |
3300027846|Ga0209180_10405493 | Not Available | 772 | Open in IMG/M |
3300027853|Ga0209274_10345588 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
3300027854|Ga0209517_10156829 | All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Methanomicrobia → Methanosarcinales → Methanosarcinales incertae sedis → GOM Arc I cluster → Candidatus Argoarchaeum → Candidatus Argoarchaeum ethanivorans | 1450 | Open in IMG/M |
3300027854|Ga0209517_10160169 | Not Available | 1430 | Open in IMG/M |
3300027854|Ga0209517_10566723 | Not Available | 607 | Open in IMG/M |
3300027875|Ga0209283_10136942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Alphaproteobacteria incertae sedis → Micavibrio → Micavibrio aeruginosavorus | 1620 | Open in IMG/M |
3300027875|Ga0209283_10909044 | Not Available | 532 | Open in IMG/M |
3300027878|Ga0209181_10987206 | Not Available | 546 | Open in IMG/M |
3300027882|Ga0209590_10114823 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1629 | Open in IMG/M |
3300027885|Ga0209450_10053460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → unclassified Desulfobacteraceae → Desulfobacteraceae bacterium | 2508 | Open in IMG/M |
3300027896|Ga0209777_10051655 | All Organisms → cellular organisms → Bacteria | 3716 | Open in IMG/M |
3300027898|Ga0209067_10688220 | Not Available | 592 | Open in IMG/M |
3300027984|Ga0209629_11004600 | Not Available | 527 | Open in IMG/M |
(restricted) 3300027995|Ga0233418_10101420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
3300028028|Ga0265292_1005563 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 6636 | Open in IMG/M |
3300028032|Ga0265296_1024567 | All Organisms → cellular organisms → Bacteria | 3206 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10001636 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7400 | Open in IMG/M |
(restricted) 3300028043|Ga0233417_10398389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 634 | Open in IMG/M |
3300028068|Ga0255355_1012728 | Not Available | 1938 | Open in IMG/M |
3300028070|Ga0255353_1005817 | Not Available | 4630 | Open in IMG/M |
3300028552|Ga0302149_1005284 | All Organisms → cellular organisms → Bacteria | 3575 | Open in IMG/M |
3300028560|Ga0302144_10126721 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
(restricted) 3300028593|Ga0255347_1343845 | Not Available | 604 | Open in IMG/M |
3300028649|Ga0302162_10086766 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
3300028653|Ga0265323_10063256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Bryocella → Bryocella elongata | 1282 | Open in IMG/M |
3300028673|Ga0257175_1110143 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas → Pseudomonas fluorescens group | 544 | Open in IMG/M |
3300028745|Ga0302267_10000127 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 96098 | Open in IMG/M |
3300028745|Ga0302267_10000727 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 43922 | Open in IMG/M |
3300028745|Ga0302267_10002358 | All Organisms → cellular organisms → Bacteria | 22959 | Open in IMG/M |
3300028765|Ga0302198_10001827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 22947 | Open in IMG/M |
3300028765|Ga0302198_10099044 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 1596 | Open in IMG/M |
3300028785|Ga0302201_10021726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3613 | Open in IMG/M |
3300028785|Ga0302201_10109035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 1236 | Open in IMG/M |
3300028785|Ga0302201_10119704 | Not Available | 1163 | Open in IMG/M |
3300028800|Ga0265338_10379612 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4 | 1011 | Open in IMG/M |
3300028800|Ga0265338_10429527 | Not Available | 938 | Open in IMG/M |
3300028813|Ga0302157_10125074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1566 | Open in IMG/M |
3300028860|Ga0302199_1007563 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 4631 | Open in IMG/M |
3300028882|Ga0302154_10408247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 654 | Open in IMG/M |
3300029907|Ga0311329_10836529 | Not Available | 584 | Open in IMG/M |
3300029911|Ga0311361_10023841 | All Organisms → cellular organisms → Bacteria | 11067 | Open in IMG/M |
3300029911|Ga0311361_10120138 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3607 | Open in IMG/M |
3300029911|Ga0311361_10351198 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1599 | Open in IMG/M |
3300029913|Ga0311362_10003011 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 34395 | Open in IMG/M |
3300029913|Ga0311362_10088518 | All Organisms → cellular organisms → Bacteria | 4214 | Open in IMG/M |
3300029914|Ga0311359_10756716 | Not Available | 687 | Open in IMG/M |
3300029915|Ga0311358_10015728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10317 | Open in IMG/M |
3300029922|Ga0311363_10036074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8108 | Open in IMG/M |
3300029952|Ga0311346_11318246 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 553 | Open in IMG/M |
3300029954|Ga0311331_10842814 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
3300029982|Ga0302277_1112294 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
3300029999|Ga0311339_10542154 | Not Available | 1172 | Open in IMG/M |
3300030020|Ga0311344_10362501 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300030043|Ga0302306_10355574 | Not Available | 561 | Open in IMG/M |
3300030056|Ga0302181_10285352 | Not Available | 737 | Open in IMG/M |
3300030057|Ga0302176_10085290 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
3300030508|Ga0302185_10120522 | Not Available | 929 | Open in IMG/M |
3300030580|Ga0311355_10508673 | All Organisms → cellular organisms → Bacteria | 1154 | Open in IMG/M |
3300030618|Ga0311354_10884865 | Not Available | 834 | Open in IMG/M |
3300030659|Ga0316363_10020951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3539 | Open in IMG/M |
3300031057|Ga0170834_100519761 | Not Available | 956 | Open in IMG/M |
3300031122|Ga0170822_11608926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 525 | Open in IMG/M |
3300031128|Ga0170823_15645123 | Not Available | 680 | Open in IMG/M |
3300031231|Ga0170824_116938620 | Not Available | 516 | Open in IMG/M |
3300031232|Ga0302323_100614212 | Not Available | 1179 | Open in IMG/M |
3300031233|Ga0302307_10586414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium | 562 | Open in IMG/M |
3300031234|Ga0302325_10007556 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 24094 | Open in IMG/M |
3300031234|Ga0302325_10321678 | All Organisms → cellular organisms → Bacteria | 2487 | Open in IMG/M |
3300031234|Ga0302325_10994218 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300031236|Ga0302324_100025233 | All Organisms → cellular organisms → Bacteria | 11415 | Open in IMG/M |
3300031236|Ga0302324_100400836 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → unclassified Granulicella → Granulicella sp. GAS466 | 2046 | Open in IMG/M |
3300031236|Ga0302324_101835963 | Not Available | 769 | Open in IMG/M |
3300031259|Ga0302187_10030598 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3596 | Open in IMG/M |
3300031261|Ga0302140_10121089 | All Organisms → cellular organisms → Bacteria | 2561 | Open in IMG/M |
3300031261|Ga0302140_11036030 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 561 | Open in IMG/M |
3300031344|Ga0265316_10344236 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
3300031524|Ga0302320_10026095 | All Organisms → cellular organisms → Bacteria | 11328 | Open in IMG/M |
3300031524|Ga0302320_10341428 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella sibirica | 1943 | Open in IMG/M |
3300031524|Ga0302320_10880142 | Not Available | 974 | Open in IMG/M |
3300031524|Ga0302320_10970278 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Cupriavidus | 907 | Open in IMG/M |
3300031525|Ga0302326_10334959 | Not Available | 2391 | Open in IMG/M |
3300031525|Ga0302326_11621228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus | 859 | Open in IMG/M |
3300031525|Ga0302326_12465759 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 654 | Open in IMG/M |
3300031525|Ga0302326_13084611 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300031525|Ga0302326_13398522 | Not Available | 532 | Open in IMG/M |
3300031576|Ga0247727_10031012 | All Organisms → cellular organisms → Bacteria | 7383 | Open in IMG/M |
3300031595|Ga0265313_10074249 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1560 | Open in IMG/M |
3300031670|Ga0307374_10033728 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5835 | Open in IMG/M |
3300031670|Ga0307374_10070816 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3316 | Open in IMG/M |
3300031670|Ga0307374_10159749 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
3300031672|Ga0307373_10033980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5836 | Open in IMG/M |
3300031707|Ga0315291_10106654 | All Organisms → cellular organisms → Bacteria | 3010 | Open in IMG/M |
3300031707|Ga0315291_10454491 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
3300031707|Ga0315291_10990958 | Not Available | 708 | Open in IMG/M |
3300031708|Ga0310686_100976466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 573 | Open in IMG/M |
3300031708|Ga0310686_118779297 | Not Available | 985 | Open in IMG/M |
3300031708|Ga0310686_119608840 | Not Available | 584 | Open in IMG/M |
3300031746|Ga0315293_10838043 | Not Available | 670 | Open in IMG/M |
3300031746|Ga0315293_10884119 | Not Available | 646 | Open in IMG/M |
3300031772|Ga0315288_10165103 | All Organisms → cellular organisms → Bacteria | 2446 | Open in IMG/M |
3300031788|Ga0302319_10229654 | All Organisms → cellular organisms → Bacteria | 2288 | Open in IMG/M |
3300031788|Ga0302319_10389634 | All Organisms → cellular organisms → Bacteria | 1562 | Open in IMG/M |
3300031788|Ga0302319_11218515 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
3300031801|Ga0310121_10445908 | Not Available | 726 | Open in IMG/M |
3300031801|Ga0310121_10567357 | Not Available | 619 | Open in IMG/M |
3300031802|Ga0310123_10010569 | All Organisms → cellular organisms → Bacteria | 6658 | Open in IMG/M |
3300031802|Ga0310123_10046507 | All Organisms → cellular organisms → Bacteria | 3064 | Open in IMG/M |
3300031802|Ga0310123_10081754 | All Organisms → cellular organisms → Bacteria | 2255 | Open in IMG/M |
3300031802|Ga0310123_10130910 | Not Available | 1727 | Open in IMG/M |
3300031803|Ga0310120_10049843 | All Organisms → cellular organisms → Bacteria | 2471 | Open in IMG/M |
3300031803|Ga0310120_10064578 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 2137 | Open in IMG/M |
3300031803|Ga0310120_10096151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1699 | Open in IMG/M |
3300031813|Ga0316217_10021318 | All Organisms → cellular organisms → Bacteria | 4508 | Open in IMG/M |
3300031862|Ga0315280_10012836 | All Organisms → cellular organisms → Bacteria | 10050 | Open in IMG/M |
(restricted) 3300031877|Ga0315314_1091581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 1301 | Open in IMG/M |
3300031885|Ga0315285_10124029 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
3300031885|Ga0315285_10345344 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
3300031902|Ga0302322_103112402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 570 | Open in IMG/M |
3300032046|Ga0315289_10004799 | All Organisms → cellular organisms → Bacteria | 20124 | Open in IMG/M |
3300032046|Ga0315289_10005532 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 18669 | Open in IMG/M |
3300032046|Ga0315289_10119073 | All Organisms → cellular organisms → Bacteria | 3052 | Open in IMG/M |
3300032046|Ga0315289_10236768 | All Organisms → cellular organisms → Bacteria | 1951 | Open in IMG/M |
3300032053|Ga0315284_10212269 | All Organisms → cellular organisms → Bacteria | 2495 | Open in IMG/M |
3300032059|Ga0318533_10524284 | Not Available | 869 | Open in IMG/M |
3300032070|Ga0315279_10023341 | All Organisms → cellular organisms → Bacteria | 6503 | Open in IMG/M |
3300032070|Ga0315279_10298419 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 1169 | Open in IMG/M |
3300032118|Ga0315277_10107603 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aerophobetes → unclassified Aerophobetes → Candidatus Aerophobetes bacterium Ae_b3b | 3136 | Open in IMG/M |
3300032156|Ga0315295_11646679 | Not Available | 614 | Open in IMG/M |
3300032160|Ga0311301_10219957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3205 | Open in IMG/M |
3300032160|Ga0311301_10440641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium | 1968 | Open in IMG/M |
3300032160|Ga0311301_10992272 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1112 | Open in IMG/M |
3300032160|Ga0311301_11861498 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
3300032261|Ga0306920_102027528 | Not Available | 805 | Open in IMG/M |
3300032561|Ga0316222_1006965 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8968 | Open in IMG/M |
3300032782|Ga0335082_10521673 | Not Available | 1050 | Open in IMG/M |
3300032783|Ga0335079_10984869 | Not Available | 861 | Open in IMG/M |
3300032783|Ga0335079_11890057 | Not Available | 578 | Open in IMG/M |
3300032783|Ga0335079_12028092 | Not Available | 553 | Open in IMG/M |
3300032805|Ga0335078_12420716 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
3300032829|Ga0335070_12019373 | Not Available | 519 | Open in IMG/M |
3300032893|Ga0335069_11908577 | Not Available | 628 | Open in IMG/M |
3300032893|Ga0335069_12227534 | Not Available | 573 | Open in IMG/M |
3300032895|Ga0335074_10788403 | All Organisms → cellular organisms → Bacteria | 890 | Open in IMG/M |
3300033233|Ga0334722_10113471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2049 | Open in IMG/M |
3300033402|Ga0326728_10000418 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 166564 | Open in IMG/M |
3300033402|Ga0326728_10032370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8708 | Open in IMG/M |
3300033402|Ga0326728_10162202 | All Organisms → cellular organisms → Bacteria | 2380 | Open in IMG/M |
3300033405|Ga0326727_10999133 | Not Available | 610 | Open in IMG/M |
3300033485|Ga0316626_11913989 | Not Available | 537 | Open in IMG/M |
3300033513|Ga0316628_103949704 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp. | 530 | Open in IMG/M |
3300033822|Ga0334828_011919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae | 2967 | Open in IMG/M |
3300033822|Ga0334828_042908 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella aggregans | 1278 | Open in IMG/M |
3300033887|Ga0334790_015320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Occallatibacter → Occallatibacter savannae | 3693 | Open in IMG/M |
3300033887|Ga0334790_056154 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1439 | Open in IMG/M |
3300033887|Ga0334790_130528 | Not Available | 776 | Open in IMG/M |
3300033983|Ga0371488_0491814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidipila → Acidipila rosea | 556 | Open in IMG/M |
3300034178|Ga0364934_0024368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2200 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 8.04% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 7.59% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 7.14% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.03% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 6.03% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 5.58% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 5.13% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.69% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 4.46% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.02% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.57% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 3.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.46% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 2.01% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.56% |
Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.34% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.34% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.12% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.12% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.12% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.89% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.89% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.89% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.89% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.89% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.89% |
Anaerobic Digestor Sludge | Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge | 0.89% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.67% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.67% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.67% |
Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.67% |
Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater | 0.45% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.45% |
Freshwater Lake Hypolimnion | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.45% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.45% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.45% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.45% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.45% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 0.22% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.22% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.22% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.22% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.22% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.22% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.22% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.22% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.22% |
Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.22% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.22% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.22% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.22% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.22% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.22% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.22% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.22% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.22% |
Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.22% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.22% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.22% |
Landfill Leachate | Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate | 0.22% |
Poplar Biomass Bioreactor | Engineered → Solid Waste → Wood → Composting → Bioreactor → Poplar Biomass Bioreactor | 0.22% |
Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.22% |
Wastewater | Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater | 0.22% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908004 | Poplar biomass bioreactor microbial communities from Brookhaven National Lab, NY - total biomass decay community | Engineered | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001534 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A15-PF-7A)- 1 week illumina | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005531 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen12_06102014_R2 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005830 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.178_YBM | Environmental | Open in IMG/M |
3300005938 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-191 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006055 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012 | Environmental | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
3300006795 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B | Environmental | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006950 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
3300009175 | Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaG | Environmental | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009614 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 | Environmental | Open in IMG/M |
3300009618 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_100 | Environmental | Open in IMG/M |
3300009629 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_100 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009633 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
3300009762 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40 | Environmental | Open in IMG/M |
3300009868 | Activated sludge microbial diversity in wastewater treatment plant from Tai Wan - Bali plant Bali plant | Engineered | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010346 | AD_USMOca | Engineered | Open in IMG/M |
3300010357 | AD_USSTca | Engineered | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010429 | AD_USRAca | Engineered | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300011420 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT199_2 | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300013130 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2 | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
3300014160 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaG | Environmental | Open in IMG/M |
3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
3300014490 | Permafrost microbial communities from Stordalen Mire, Sweden - 611E1M metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
3300014494 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaG | Environmental | Open in IMG/M |
3300014496 | Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaG | Environmental | Open in IMG/M |
3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300015082 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11c, vegetated hydrological feature) | Environmental | Open in IMG/M |
3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017935 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020192 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP6.G1 | Environmental | Open in IMG/M |
3300020201 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP9.P1 | Environmental | Open in IMG/M |
3300020203 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica- Oligotrophic Lake LV.19.MP7.P2 | Environmental | Open in IMG/M |
3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300022222 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 (v2) | Environmental | Open in IMG/M |
3300022524 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 20-24 | Environmental | Open in IMG/M |
3300022526 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14 | Environmental | Open in IMG/M |
3300022553 | Powell_combined assembly | Environmental | Open in IMG/M |
3300022849 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T100 | Environmental | Open in IMG/M |
3300022861 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T25 | Environmental | Open in IMG/M |
3300022872 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T-25 | Environmental | Open in IMG/M |
3300023075 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T-25 | Environmental | Open in IMG/M |
3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
3300023090 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24 | Environmental | Open in IMG/M |
3300023101 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14 | Environmental | Open in IMG/M |
3300023247 | Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50 | Environmental | Open in IMG/M |
3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
3300023258 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34 | Environmental | Open in IMG/M |
3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
3300025404 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 (SPAdes) | Environmental | Open in IMG/M |
3300025409 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_150 (SPAdes) | Environmental | Open in IMG/M |
3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
3300025448 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 (SPAdes) | Environmental | Open in IMG/M |
3300025463 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_10 (SPAdes) | Environmental | Open in IMG/M |
3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
3300025650 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-B (SPAdes) | Environmental | Open in IMG/M |
3300025679 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-3 deep-092012 (SPAdes) | Environmental | Open in IMG/M |
3300025706 | Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaG (SPAdes) | Engineered | Open in IMG/M |
3300025829 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16B (SPAdes) | Environmental | Open in IMG/M |
3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300026223 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes) | Environmental | Open in IMG/M |
3300026451 | Peat soil microbial communities from Stordalen Mire, Sweden - P.F.S.T-25 | Environmental | Open in IMG/M |
3300026467 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-16-A | Environmental | Open in IMG/M |
3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
3300026502 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T-25.r1 | Environmental | Open in IMG/M |
3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027840 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare2Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027878 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027885 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - LWP11 LW (SPAdes) | Environmental | Open in IMG/M |
3300027896 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes) | Environmental | Open in IMG/M |
3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027984 | Cubitermes ugandensis P5 segment gut microbial communities from Kakamega Forest, Kenya - Cu122 P5 (SPAdes) | Host-Associated | Open in IMG/M |
3300027995 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_1_MG | Environmental | Open in IMG/M |
3300028028 | Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 296A | Engineered | Open in IMG/M |
3300028032 | Groundwater microbial communities from a municipal landfill in Southern Ontario, Canada - Pumphouse #1 | Environmental | Open in IMG/M |
3300028043 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0.5_MG | Environmental | Open in IMG/M |
3300028068 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T75 | Environmental | Open in IMG/M |
3300028070 | Peat soil microbial communities from Stordalen Mire, Sweden - H.B.S.T25 | Environmental | Open in IMG/M |
3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
3300028560 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2 | Environmental | Open in IMG/M |
3300028593 (restricted) | Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24 | Engineered | Open in IMG/M |
3300028649 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_2 | Environmental | Open in IMG/M |
3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Host-Associated | Open in IMG/M |
3300028673 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-B | Environmental | Open in IMG/M |
3300028745 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_3 | Environmental | Open in IMG/M |
3300028765 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2 | Environmental | Open in IMG/M |
3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
3300028813 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3 | Environmental | Open in IMG/M |
3300028860 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_3 | Environmental | Open in IMG/M |
3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029914 | III_Bog_E2 coassembly | Environmental | Open in IMG/M |
3300029915 | III_Bog_E1 coassembly | Environmental | Open in IMG/M |
3300029922 | III_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029954 | I_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300029982 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_1 | Environmental | Open in IMG/M |
3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030020 | II_Bog_N1 coassembly | Environmental | Open in IMG/M |
3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030057 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1 | Environmental | Open in IMG/M |
3300030508 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_2 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031259 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E1_3 | Environmental | Open in IMG/M |
3300031261 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_1 | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Host-Associated | Open in IMG/M |
3300031670 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-3 | Environmental | Open in IMG/M |
3300031672 | Soil microbial communities from Risofladan, Vaasa, Finland - OX-2 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031801 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986 | Environmental | Open in IMG/M |
3300031802 | Marine microbial communities from Western Arctic Ocean, Canada - CB6_AW_1057 | Environmental | Open in IMG/M |
3300031803 | Marine microbial communities from Western Arctic Ocean, Canada - CB27_AW_983 | Environmental | Open in IMG/M |
3300031813 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - 1anoA | Environmental | Open in IMG/M |
3300031862 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40 | Environmental | Open in IMG/M |
3300031877 (restricted) | Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9 | Environmental | Open in IMG/M |
3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
3300031902 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2 | Environmental | Open in IMG/M |
3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032561 | Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033485 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D5_A | Environmental | Open in IMG/M |
3300033513 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_C | Environmental | Open in IMG/M |
3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
3300033887 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
PBDC3_07378010 | 2124908004 | Poplar Biomass Bioreactor | STLEDPTTLFEKTPILQALQASGSNNNLLDPGKQLILFDF |
JGIcombinedJ13530_1042885865 | 3300001213 | Wetland | SVTLFEKSPILQALQTFGSQDESSASGNQLILFDF* |
A15PFW1_102031302 | 3300001534 | Permafrost | LTLFEKTPILQALQPSDSEPDLQDPGSQLILFDF* |
Ga0062387_1017680201 | 3300004091 | Bog Forest Soil | ILQILSVTLFEKTPILRALQACDSDYDLFDIGNQLILFNF* |
Ga0062389_1021094032 | 3300004092 | Bog Forest Soil | SVTLFEKTPILQALYPSDSQADLFDDPNQLNLFTLPDSSVGI* |
Ga0066689_109125261 | 3300005447 | Soil | ILQILSVTLFEKMPILQALQSPDSRNDLLDQGNQLILFDF* |
Ga0070738_1001248512 | 3300005531 | Surface Soil | VTLFEKTPIFRALQEPCSQEHLGDLGNQLILFDF* |
Ga0070738_100452414 | 3300005531 | Surface Soil | VTLFEKTPILRALQASDSEIELLDSGNQLILFDF* |
Ga0070762_110472053 | 3300005602 | Soil | SVTLFEKTPILQALCPSDSQNDPFDDHNQLSLFTL* |
Ga0066903_1029684991 | 3300005764 | Tropical Forest Soil | VTLFEKTPVLRALQPPVSTNELLDFPNQLNLFGL* |
Ga0074473_108533792 | 3300005830 | Sediment (Intertidal) | VTLFEKTPILRALQASNSKTDLLDSGNQLILFDF* |
Ga0066795_100553111 | 3300005938 | Soil | VTLFEKTPILRALQDDNSQSDLLDYSNQLILFGL* |
Ga0066790_103107662 | 3300005995 | Soil | LSLTLFEKTPLLQALQPFDSQEYLVDSGNQLNLFGL* |
Ga0097691_100100522 | 3300006055 | Arctic Peat Soil | LSVTLFEKTPILRALQNSNSQSDLLDYSNQLILFNL* |
Ga0075026_1009136391 | 3300006057 | Watersheds | LTLFEKTPILQALQSSDSQEELLDPGNQLILFDS* |
Ga0075017_1000533171 | 3300006059 | Watersheds | ILSVTLFEKTPILRALQASDFENDPLDAGNQLVLFDF* |
Ga0075017_1002324112 | 3300006059 | Watersheds | VTLFEKTPILQALQASDSQADLLDPGNQLILFDF* |
Ga0075030_1002121874 | 3300006162 | Watersheds | ITLFEKVPILQALQASDSQPDLPDPCNQLNLFDF* |
Ga0075030_1005125781 | 3300006162 | Watersheds | VTLFEKTPILQALQPPDSQDDLLASANQLNLFEL* |
Ga0075522_100204191 | 3300006638 | Arctic Peat Soil | LTLFEKTPILRALQTSDYDNDLGDIGNQLILFDL* |
Ga0075522_100298263 | 3300006638 | Arctic Peat Soil | VLLDPFEEKTPILQALQPTDSEELLPDFSNQLNLFNL* |
Ga0075522_103959312 | 3300006638 | Arctic Peat Soil | LSLFEKMPILQALQPPNSESDLPDPGNQLILFSL* |
Ga0075521_100784552 | 3300006642 | Arctic Peat Soil | VTLFEKTPILRALQNSNSQSDLLDYSNQLILFNL* |
Ga0075520_10016631 | 3300006795 | Arctic Peat Soil | SVTLFEKTPILRALQNSNSQSDLLDYSNQLILFNL* |
Ga0075520_10511441 | 3300006795 | Arctic Peat Soil | SLTLFEKAPILWALQAPDFNNDLVDSGNQFNLFDF* |
Ga0066797_10107224 | 3300006864 | Soil | SVTLFEKTPILRALQDDNSQSDLLDYSNQLILFGL* |
Ga0073928_100033331 | 3300006893 | Iron-Sulfur Acid Spring | SVTLFEKTPILQALQTFDVEENLLQDANQLILFNL* |
Ga0075524_102964441 | 3300006950 | Arctic Peat Soil | TLGCGPLFEKTPVLQALQSFDPHNDLLYASNQLILFDF* |
Ga0066710_1043979162 | 3300009012 | Grasslands Soil | IFSVTLFKNTPILHALHAPDSGTDLLDPGNQLILSDF |
Ga0066710_1046765211 | 3300009012 | Grasslands Soil | QILQILSLTLFEKTPILQALQSPDSQDDLLVSANQLNLFDL |
Ga0066793_100631551 | 3300009029 | Prmafrost Soil | SLTLFEKTPILQALQASDSQEELLDPGNQLILFDF* |
Ga0066793_104692161 | 3300009029 | Prmafrost Soil | SITLFEKTPILRALQNSNSQSDLLDYSNQLILFNL* |
Ga0066793_107227202 | 3300009029 | Prmafrost Soil | LSTTLFEKTPILRALQNSIAQSFLLDYSNHLILFNL* |
Ga0105048_100965206 | 3300009032 | Freshwater | SVTLFEKTPILQALQMPDSQNNLLDSGNQLNLWDF* |
Ga0073936_100745101 | 3300009175 | Freshwater Lake Hypolimnion | LTLFEKTPILQALQTSGCYKDSCDIGNQLILFDL* |
Ga0073936_101641841 | 3300009175 | Freshwater Lake Hypolimnion | SLTLFEKTPILQALQTSGCYKDSCDIGNQLILFDL* |
Ga0116225_15432522 | 3300009524 | Peatlands Soil | SLTLFEKTPILQALQAPDSREESLDPGNQLILFEF* |
Ga0116136_10895392 | 3300009547 | Peatland | SVTLFEKTPILQALQPPDSQADLLISANQLILFPL* |
Ga0116138_10651143 | 3300009552 | Peatland | SVTLFEKTPVLRALQATDSENDLVDSGNQLILFDF* |
Ga0116104_10115705 | 3300009614 | Peatland | QILSVTLFEKTPVLRALQATDSENDLVDSGNQLILFDF* |
Ga0116127_10959591 | 3300009618 | Peatland | SVTLFEKTPILRALQPSDSDSDLFDIGNQLILFSL* |
Ga0116119_11093652 | 3300009629 | Peatland | SVTLFEKTPILRALQASDFENDLGDPGNQLILFDF* |
Ga0116114_10537851 | 3300009630 | Peatland | SVTLFEKTPILRTLQRDGFQEELSYPPNQLILFDL* |
Ga0116129_100356010 | 3300009633 | Peatland | SLTLFEKTPILQALQASDSQEELIDPGNQLILFDF* |
Ga0116129_10101911 | 3300009633 | Peatland | VTLFEKTPILQALQPPDSQEELFSSANQLILFDL* |
Ga0116129_11023262 | 3300009633 | Peatland | LSVTLFEKTPILQALQPPDSQEKLFSSANQLILFDL* |
Ga0116129_11389931 | 3300009633 | Peatland | LTLFEKTPILQALQASDSQEELIDPGNQLILFDF* |
Ga0116126_10754083 | 3300009640 | Peatland | SVTLFEKTPILQALQAPNSDSDLFDIGNQLILFDF* |
Ga0116217_108804422 | 3300009700 | Peatlands Soil | SVMLFEKTPILQALQPPDSQNDLLGSANQMILFDL* |
Ga0116131_10915403 | 3300009760 | Peatland | SVTLFEKTPIPRALEASDSQDDPYENSNQLILFDL* |
Ga0116131_12068142 | 3300009760 | Peatland | VTLFEKTPILRALQPSDSDSDLFDIGNQLILFSL* |
Ga0116130_12544542 | 3300009762 | Peatland | VTLFEKTPILQALQPPDSQDNLSHSANQLNLFDL* |
Ga0130016_101288461 | 3300009868 | Wastewater | LSVTLFEKTPLLRALQASDFEKDLVDPGNQLILFDF* |
Ga0074045_100226566 | 3300010341 | Bog Forest Soil | SVSLFEKTPILRALEAYTSQDDLAENSNQLILFDL* |
Ga0074045_102559281 | 3300010341 | Bog Forest Soil | SVSLFEKTPILRDLEAYTSQDDLAENSNQLILFDL* |
Ga0116239_106182672 | 3300010346 | Anaerobic Digestor Sludge | SVTLFEKVPISRAFQASNSQGDLPCPDNQLILFDF* |
Ga0116249_108847132 | 3300010357 | Anaerobic Digestor Sludge | FSVTLFEKVPISRAFQASNSQGDLPCPDNQLILFDF* |
Ga0126379_107513291 | 3300010366 | Tropical Forest Soil | QILSLTLFEKTPISRKLQASDSEIDLIDLDDQLILFDL* |
Ga0126379_111543951 | 3300010366 | Tropical Forest Soil | SLMLFEKVPILQALQPSDSQNESSEDSNQLILFDF* |
Ga0136449_10002862911 | 3300010379 | Peatlands Soil | SVTLFEKTPILQALQASTSQDDLMVSGNQLILFDL* |
Ga0136449_1002539341 | 3300010379 | Peatlands Soil | SVTLFEKTPILQALQAPNSDSDLFDISNQLILFDF* |
Ga0136449_1003198771 | 3300010379 | Peatlands Soil | SLTLFERTPILQVLQTSDSEDDSGDFANQLILFDL* |
Ga0136449_1005164384 | 3300010379 | Peatlands Soil | SVNLFEKTPILRALQASYSENDLLDTDNQLILFDF* |
Ga0136449_1008879561 | 3300010379 | Peatlands Soil | QILSVTLFEKTPILQALQAPNSDNDLFDISNQLILFDF* |
Ga0136449_1030067873 | 3300010379 | Peatlands Soil | SVMLFEKTPILQALQPSDYQDDLLTSTDQLILFDL* |
Ga0136449_1042804872 | 3300010379 | Peatlands Soil | YQILQILSVTLFEKTPILRALQVSNSECNFVGIDNQLILFNI* |
Ga0136449_1043679032 | 3300010379 | Peatlands Soil | SVTLFEKTPILQALQASTSQDDLLVSGNQLILFDL* |
Ga0134126_121698642 | 3300010396 | Terrestrial Soil | LSLFEKVPILQALQPSDSQSDLLDPSNQLILFDL* |
Ga0126383_111158352 | 3300010398 | Tropical Forest Soil | VTLFEKTPILRALQPPVSTNELLDFPNQLNLFGL* |
Ga0116241_100292635 | 3300010429 | Anaerobic Digestor Sludge | LSVTLFEKTPILQVLSQHNGKDLEDEGPNQLELFD* |
Ga0137391_106761764 | 3300011270 | Vadose Zone Soil | SITLFEKVPILQALQASDSQSDLLNPGNQLNLFDS* |
Ga0137393_109132852 | 3300011271 | Vadose Zone Soil | ILQILSVTLFEKTPILQAFQAFDSRGDLVDCGSQLNLFDF* |
Ga0137314_11119931 | 3300011420 | Soil | SVTLFEKTLVLQALQPIDSQDPLADSDNQLNLFDL* |
Ga0137379_1000007576 | 3300012209 | Vadose Zone Soil | LTLFEKTPILQALQASDACTDLHDPSNQLILFDF* |
Ga0137379_100000971 | 3300012209 | Vadose Zone Soil | SLTLFEKTPILQALQASDACTDLHDPSNQLILFDF* |
Ga0137378_102589833 | 3300012210 | Vadose Zone Soil | SVTLFEKTPILQAFQAFDSQDNLVDCGNQLNLFDF* |
Ga0137367_100480534 | 3300012353 | Vadose Zone Soil | SVTLFEKTPILQALQACDSDSNLVDIGNQLILFNF* |
Ga0137367_101860273 | 3300012353 | Vadose Zone Soil | VTLFEKTPILRALQACDSDTNLVDIGNQLILFNF* |
Ga0137367_105360601 | 3300012353 | Vadose Zone Soil | SVTLFEKTPILRALQACDSDTNLVDIGNQLILFNF* |
Ga0137373_112575181 | 3300012532 | Vadose Zone Soil | ILSVTLFEKTPILQALQASDSQEESSDPGNQLILFDF* |
Ga0137359_102342831 | 3300012923 | Vadose Zone Soil | SLTLFEKTPILQALQASDSEEELLDPGNQLILFDF* |
Ga0137359_106578801 | 3300012923 | Vadose Zone Soil | SVTLFEKTPILQAFQDIDSQSNLLMNANQLILFDF* |
Ga0137419_112873202 | 3300012925 | Vadose Zone Soil | ILQILSLTLFEKTPILQALQASDSQGESFDHGNQLILFEF* |
(restricted) Ga0172363_106453631 | 3300013130 | Sediment | SVTLFEKTPILQALQASDSDSNLVDVGNQLILFDF* |
Ga0181533_100111431 | 3300014152 | Bog | SVTLFEKTPILQALQIENSQNDLYDSCNQLNLFDF* |
Ga0181533_10135787 | 3300014152 | Bog | SITLFEKVPILQALQASDSQPDLLDPGNQLNLFDF* |
Ga0181533_13399311 | 3300014152 | Bog | SLTLFEKTPILRALQASDFENEIADSGNQLSLFDL* |
Ga0181527_10094691 | 3300014153 | Bog | ITLFEKVPILQALQASDSQPDLLDPGNQLNLFDF* |
Ga0181518_103926331 | 3300014156 | Bog | SVTLFEKTPILRALQASDFANDSVDSGNQLILFDL* |
Ga0181517_100015311 | 3300014160 | Bog | SITLFEKTPILQALQPSNSDSNLYDSDNQLILFDF* |
Ga0181517_100017291 | 3300014160 | Bog | SVTLFEKTPILQVLQPGDFHFDLYDSRNQLNLFDF* |
Ga0181517_100281664 | 3300014160 | Bog | SITLFEKTPILQALQACDSQTEPLDPGNQLILFDF* |
Ga0181517_100427871 | 3300014160 | Bog | LTLFEKTRILRALQQIDSQDDLPFFSNQLNLFGL* |
Ga0181517_101157073 | 3300014160 | Bog | SLTLFEKTPILQALQRFDSQEELQNHSNQLILFDF* |
Ga0181517_103664833 | 3300014160 | Bog | SLTLFEKTPILRALQQINSKDDLPCSDNQLILFN* |
Ga0181517_104979762 | 3300014160 | Bog | SVTLFEKTPILRALQASDFENDLGDSGNQLILFDF* |
Ga0181529_101936411 | 3300014161 | Bog | SLTLFEKTRILRALQQIDSQDDLPFFSNQLNLFGL* |
Ga0181528_100783511 | 3300014167 | Bog | STLFEKTPLLQALQPSDSDLNSMDSGNQLNLFDF* |
Ga0181528_103682701 | 3300014167 | Bog | SLTLFEKTPILRALQSIDSQDKLPCFANQMNLFNL* |
Ga0181535_105972881 | 3300014199 | Bog | SLTLFEKTPILQALQPSDSENDLLDSSNQLILFDF* |
Ga0182018_1000027177 | 3300014489 | Palsa | SVTLFEKTPILQVLQPPDSQEDLLSSANQLILFEL* |
Ga0182018_101198274 | 3300014489 | Palsa | SITLFEKVPILQALQASDPHPDLLDQGNQLNLFDF* |
Ga0182018_104535631 | 3300014489 | Palsa | SVTLFEKTPILQALQASDSDNDLLDVSNQLILFDF* |
Ga0182010_102237463 | 3300014490 | Fen | SVTLFEKTPILRALQASDFENELGDSGNQLILFDF* |
Ga0182010_107146952 | 3300014490 | Fen | SVTLFEKTPILRALQASDFEDNLDDSGNQLILFDF* |
Ga0182010_107998171 | 3300014490 | Fen | VTLFEKTPILRALQASDFENELGDSGNQLILFDF* |
Ga0182014_100001771 | 3300014491 | Bog | VTLFEKTPILQALHAPASDTDLLDPGNQLILFDF* |
Ga0182014_100007651 | 3300014491 | Bog | SLTLFEKTPILQALQTSDPDNDLGDNGNQLNLFDL* |
Ga0182014_1000444914 | 3300014491 | Bog | LTQFEKTPILRALQQIDSQDDLPCFSNQLNLFSL* |
Ga0182014_1000552011 | 3300014491 | Bog | VTLFEKTPILQPLQRDGFQEELSCHPNQLILFDF* |
Ga0182014_100075097 | 3300014491 | Bog | SVTLFEKTPILRALQRFDSQDELLTHSNQLILFDF* |
Ga0182014_100409851 | 3300014491 | Bog | SVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF* |
Ga0182014_100503841 | 3300014491 | Bog | SLTQFEKTPILRALQQIDSQDDLPCFSNQLNLFSL* |
Ga0182014_101046142 | 3300014491 | Bog | SVTLFEKTPILRTLQEIDSDSDLYDPSNQLNLFSL* |
Ga0182014_101252691 | 3300014491 | Bog | SLTQFEKTPILQALQAPNSDTDLDDIDNQLILFDL* |
Ga0182014_101592721 | 3300014491 | Bog | SVTLFEKTPILQALQACDSGNDLSDPGNQLILFDF* |
Ga0182014_102562373 | 3300014491 | Bog | SVTLFEKTPILRALQRFDSQDELQTTSNQLILFDF* |
Ga0182014_102669871 | 3300014491 | Bog | LSVTLFEKVPVLQAFQASDSQIDLLDDGNQLILFD |
Ga0182014_103803401 | 3300014491 | Bog | VTLFEKTPILRTLQEIDSDSDLYDPSNQLNLFSL* |
Ga0182013_100267537 | 3300014492 | Bog | VTLFEKTPILRALQRFDSQDELLTHSNQLILFDF* |
Ga0182013_101053301 | 3300014492 | Bog | SLTLFEKTPILQALQAPSSQEILPDSGKQLILFDL* |
Ga0182013_102273195 | 3300014492 | Bog | SVTLFEKTPILQALQPPDSQEDSPDDSNQLNLFTL* |
Ga0182016_100189386 | 3300014493 | Bog | LTLFEKTPILQALQTADCENDLYNTGNQLILFDF* |
Ga0182016_100365454 | 3300014493 | Bog | ITLFEKTTILQALQASDSQPDLPDQGNQLILFDF* |
Ga0182016_106700252 | 3300014493 | Bog | SLTLFEKTPVLRALHAFDSCNDLPDPGNQLILFDF* |
Ga0182017_102694693 | 3300014494 | Fen | VTLFEKTPILRALQAPDFENELGDSGNQLILFDF* |
Ga0182017_102741132 | 3300014494 | Fen | VTLFEKTPILRALQRYNSQDELEQSSNQLILFDF* |
Ga0182017_103502762 | 3300014494 | Fen | VTLFEKTPILRALQASDFENDLGDSGNQLILFDF* |
Ga0182017_105909751 | 3300014494 | Fen | SVTLFETTPILRALQAPDFENDLGDSGNQLILFDF* |
Ga0182017_106081112 | 3300014494 | Fen | SLTLFEKTPILRALQAISCDNDLDDLGNQLNLFGL* |
Ga0182017_109666901 | 3300014494 | Fen | SLTLFEKTPILRALQQIDSQLELPCPVNQLNLFGL* |
Ga0182011_100492701 | 3300014496 | Fen | SVTLFEKTPILRALQAPDFENELGDSGNQLILFDF* |
Ga0182011_105599171 | 3300014496 | Fen | SVTLFEKTPILRALQAPDSDSDLFDVGNQLILFDF* |
Ga0182012_100102161 | 3300014499 | Bog | SLTIFEKTPVLRALHAFDSCNDLPDPGNQLILFDF* |
Ga0182012_102879901 | 3300014499 | Bog | SVTLFEKTPILKALQQIYSQDDSPGSQNQMILFDF* |
Ga0182012_103739703 | 3300014499 | Bog | SVTLFEKTPILQALQASNSEEDLADSGNQLILFDF* |
Ga0182024_100078581 | 3300014501 | Permafrost | LSLFEKMPILQALQPSESEIDFIDPGKQLILFDL* |
Ga0182024_100144251 | 3300014501 | Permafrost | SLSLFEKMPILQALQPSESEIDFIDPGKQLILFDL* |
Ga0182024_100352851 | 3300014501 | Permafrost | SLTLFEKTPILQALQTSNSENDLGDLSNQLILFDL* |
Ga0182024_100465187 | 3300014501 | Permafrost | SVTLFEKTPILRALQTTDPQFDLPNSDNQLNLFSL* |
Ga0182024_106638622 | 3300014501 | Permafrost | SITLFEKTPILQAPQTSDSDNDLGDISNQLILFDL* |
Ga0182024_108332861 | 3300014501 | Permafrost | VTLFEKTPILQVLQPPDSQEDLLSSANQLILFEL* |
Ga0182024_119826432 | 3300014501 | Permafrost | SVTLFEKTPLLEALQAPDSENDSPNTGNQLILFDF* |
Ga0182021_110987851 | 3300014502 | Fen | LTLFEKTPILRALQQIDSQLELPCPVNQLNLFGL* |
Ga0181536_103009582 | 3300014638 | Bog | LTLFEKTPILRALQRIASQDELPCLGNQLNLFSL* |
Ga0181516_100446171 | 3300014655 | Bog | LTLFEKTPISQALQTSNSDHNLDDIGNQLILFDL* |
Ga0181516_101796531 | 3300014655 | Bog | SLTQFEKTPILQALQPSNSETDLPDPENQLILFDL* |
Ga0157377_107669971 | 3300014745 | Miscanthus Rhizosphere | ILSVTLFEKTPILRALQASDYENEPGDPGNQLILFNL* |
Ga0182030_104063211 | 3300014838 | Bog | SVTLFEKTAILRALQACDSDSDLVDIGNQLILFNF* |
Ga0182030_106521391 | 3300014838 | Bog | LTQFEKTPILQALQISDYDSNLDGSGNQLILFNF* |
Ga0182030_107646942 | 3300014838 | Bog | SLTLFEKTPILQALHPSDSENDLHDSSNQLILFDF* |
Ga0182030_108725552 | 3300014838 | Bog | VTLFEKTPILQALQACDSGNDLSDPGNQLILFDF* |
Ga0182030_110011152 | 3300014838 | Bog | SLTQFEKTPILQALQISDYDSNLDGSGNQLILFNF* |
Ga0182027_100084721 | 3300014839 | Fen | SVTLFEKTPILQALQRFDSQEELLTHPNQLILFDF* |
Ga0182027_101004807 | 3300014839 | Fen | SVTLFEKTPILQALQPSDSQDDLPAFANQLNLFEL* |
Ga0182027_101553641 | 3300014839 | Fen | VTLFEKTPILRALQASDFENELANPGNQLILFDF* |
Ga0182027_101862351 | 3300014839 | Fen | SLTLFEKTPILRALQQINSQDDSSLPANQLNLFNL* |
Ga0182027_102146944 | 3300014839 | Fen | SVTLFEKTPVLQALQAPDFENDLGDSANQLILFDF* |
Ga0182027_102325711 | 3300014839 | Fen | SVTLFEKTPILRALQASDFENELGDPGNQLILFDF* |
Ga0182027_103380951 | 3300014839 | Fen | SVTLFEKTPILQALHASDSENDLSDAGNQLILFDF* |
Ga0182027_103408243 | 3300014839 | Fen | LSVTLFEKTPILRALQASDFENELGDSGNQLILFDF* |
Ga0182027_103587554 | 3300014839 | Fen | LSVTLFETTPILRALQAPDFENDLGDSGNQLILFDF* |
Ga0182027_104352252 | 3300014839 | Fen | SVTLFEKTPILRALQAPDFENEIDDPGNQLILFDF* |
Ga0182027_106024981 | 3300014839 | Fen | LSRRTKTPILQAVQMSGYDYDLPDSGNQLILFDF* |
Ga0182027_106093351 | 3300014839 | Fen | SVTLFEKTPILQALQPSDSRDDLFDFANQLNLFDL* |
Ga0182027_106596601 | 3300014839 | Fen | SVTLFEKTPILRALQASDFANELSDPGNQLILFDF* |
Ga0182027_107821182 | 3300014839 | Fen | SVTLFEKTPILRALQPSDSENDLHQSGNQLILFNF* |
Ga0182027_111848951 | 3300014839 | Fen | QIFSVTLFEKTPILQALQPPDSQDDSLDFANQLNLFDL* |
Ga0182027_116801662 | 3300014839 | Fen | SVTLFEKTPILRALQASDFNRGLDESGNQLILFDL* |
Ga0182027_118176451 | 3300014839 | Fen | LTLFEKTPILRALQAISCDNDLDDLGNQLNLFGL* |
Ga0182027_121030981 | 3300014839 | Fen | SVTLFEKTPILRALQASDFENELANPGNQLILFDF* |
Ga0182027_121584871 | 3300014839 | Fen | LSLTLFEKTPILQALQQIDSQLELPCPANQLNLFGL* |
Ga0180066_11273282 | 3300014873 | Soil | LTLFEKTPILQALQASDSQEELLDPGNQLILFDF* |
Ga0167662_10344832 | 3300015082 | Glacier Forefield Soil | LSLTLFEKTPILQALQPPDSQDDSLGSPNQLNLFGL* |
Ga0180075_10205152 | 3300015252 | Soil | LSVTLFEKVPVLQAFQASDYQDELLDDGNQLILFDF* |
Ga0163144_100455721 | 3300015360 | Freshwater Microbial Mat | SVTLFEKTPILRAFQNLDSEDELDPHANQLNLFNL* |
Ga0182036_114506451 | 3300016270 | Soil | VLSVTLFEKTPILRALQEPCFNDDLHGLGNQLILFDF |
Ga0182032_103826453 | 3300016357 | Soil | SLTLFERVPILQALQPPVFENESGDDPNQLILFDF |
Ga0187856_10048911 | 3300017925 | Peatland | SLTLFEKTPILQALQTSDCGKDLYDIGNQLILFDL |
Ga0187848_102755563 | 3300017935 | Peatland | SVTLFEKTPILRALQASDFENDLGDPGNQLILFDF |
Ga0187850_102820522 | 3300017941 | Peatland | SVTLFEKTPVLRALQATDSENDLVDSGNQLILFDF |
Ga0187850_103605941 | 3300017941 | Peatland | RIPRLSLTLFEKTPILQALQATDSQSDLNDSSNQLILFDF |
Ga0187819_104860472 | 3300017943 | Freshwater Sediment | SITLFEKVPILQALQASDSQPDLPGSGNQLILFDF |
Ga0187879_101067262 | 3300017946 | Peatland | SLTLFEKTPILQALQPSDSEIDLFDSSNQLILFDF |
Ga0187782_105590023 | 3300017975 | Tropical Peatland | SVTIFEKTPILQALQASDSEIELVDPGNQLILFDF |
Ga0181520_100000471 | 3300017988 | Bog | SITLFEKTPILQALQPSNSDSNLYDSDNQLILFDF |
Ga0181520_100042961 | 3300017988 | Bog | SLTLFEKTPISQALQTSNSDHNLDDIGNQLILFDL |
Ga0181520_100044221 | 3300017988 | Bog | SVTLFEKTPILQVLQPGDFHFDLYDSRNQLNLFDF |
Ga0181520_1000477530 | 3300017988 | Bog | SLTLFEKTPILQALQRFDSQEELQNHSNQLILFDF |
Ga0181520_100235067 | 3300017988 | Bog | SITQFEKTPILQALQETDNDNDLDDIGNQLILFDF |
Ga0181520_100462971 | 3300017988 | Bog | SLTLFEKTPILRALQTSDYDSNLGDTGNQLILFDL |
Ga0181520_101699823 | 3300017988 | Bog | SVTLFEKTPILRTLQEIDCNSDLYDTGNQLNLFSL |
Ga0181520_102944332 | 3300017988 | Bog | SLTQFEKTPILQALQKLGYESDLDDSGNQLILFNF |
Ga0187891_11196161 | 3300017996 | Peatland | SVTLFEKTPILQALQPPDSQADLLISANQLILFPL |
Ga0187891_12815441 | 3300017996 | Peatland | SVTLFEKTPILRALQPSDSDSDLFDIGNQLILFSL |
Ga0187876_12222572 | 3300018003 | Peatland | SVTLFEKTPILRALRASDSCPGLLDPGNQLILFDF |
Ga0187865_10026331 | 3300018004 | Peatland | SVTLFEKTPIVRALRPSDSCPDLPDPGNQLILFDF |
Ga0187865_10064528 | 3300018004 | Peatland | SVTLFEKTPIPRALEASDSQDDPYENSNQLILFDL |
Ga0187884_100558843 | 3300018009 | Peatland | LSVTLFEKTPILQALQASDSENAPIDTGNQLILFD |
Ga0187884_101141732 | 3300018009 | Peatland | MLSLTLLEKTPILQALQPFDSESDLQGDSKQLVLFNF |
Ga0187866_10837633 | 3300018015 | Peatland | VLSVTLFEKTPILQALQASDSESDLLDVGNQLILFDF |
Ga0187872_100498421 | 3300018017 | Peatland | SVTLFEKTPILQALQAPNSDSDLFDIGNQLILFDF |
Ga0187889_100146219 | 3300018023 | Peatland | LSVTLFEKTPILQALQPPDSQDDLPAFANQLNLFEL |
Ga0187863_108462901 | 3300018034 | Peatland | ILSVTLFEKTPILQALQLYDSQYESDDNSKQLNLFDL |
Ga0187875_100410196 | 3300018035 | Peatland | SVTLFEKTPILQALQPSDSRDDLLDFANQLNLFDL |
Ga0187875_103987771 | 3300018035 | Peatland | ILSLTLFEKTPILQALQPSDSEIDLFDSSNQLILFDF |
Ga0187875_105829542 | 3300018035 | Peatland | SLTLFEKTPILRTLQRLDANLELDDDDKQLILFTL |
Ga0187855_103618053 | 3300018038 | Peatland | LSVTLFEKTPILQALQPPDSQDDLLSSANQLILFPL |
Ga0187887_102083412 | 3300018043 | Peatland | SVTLFEKTPILQALQLDNSQNELYDSCNQLNLFNF |
Ga0184626_102140562 | 3300018053 | Groundwater Sediment | SVTLFEKTPILQAFQAFDSQDNLVDCGNQLNLFDF |
Ga0184615_101038901 | 3300018059 | Groundwater Sediment | QILSVTLFEKVPVLQAFQASDSQDELHDDGNQLILFDF |
Ga0187893_101653851 | 3300019487 | Microbial Mat On Rocks | SVTLFEKVPILRAFQTSDSQSDLLDSNNQLILFDF |
Ga0182028_13510431 | 3300019788 | Fen | SVTLFEKTPILRALEASSYQDDPSENINQLILFDLVAGQ |
Ga0193751_11484172 | 3300019888 | Soil | LSVTLFEKTPILQALQTCDSDSNLVDIGNQLILFNF |
Ga0193726_12470382 | 3300020021 | Soil | LSLSLFEKTPILQAFQSSDSQSHLPDLSNQLILFDL |
Ga0194111_103316152 | 3300020083 | Freshwater Lake | LSVTLFEKTPILRALQAPDSESDLRNVGNQLILFDF |
Ga0163147_104017923 | 3300020192 | Freshwater Microbial Mat | LSVTLFEKTPILQALQMPDSQNNLLDSGNQLNLWDF |
Ga0163154_104813572 | 3300020201 | Freshwater Microbial Mat | LSITLFEKMPILQALQASDSEFQLYEDPNQLTLFDF |
Ga0163148_104937322 | 3300020203 | Freshwater Microbial Mat | VSVTLFEKTPILRAFQNLDSEDELDPHANQLNLFNL |
Ga0163148_105141391 | 3300020203 | Freshwater Microbial Mat | SVTLFEKTPILRAFQNLDSEDELDPHANQLNLLNL |
Ga0210395_105998211 | 3300020582 | Soil | LQILSVTLFEKTPLLQALQPSDSQEDSFDYSNQLSLFTL |
Ga0210406_103087831 | 3300021168 | Soil | SVTLFEKTPILRALQACDSDNDLVDSGNQLILFNF |
Ga0210383_114072951 | 3300021407 | Soil | LSLSLFEKMPILQALQPSDSQPELPDPGNQLILFDL |
Ga0210390_105222223 | 3300021474 | Soil | LSLTLFEKTPILQALQKDHSQDELYAAPNQLILFDF |
Ga0210398_112068941 | 3300021477 | Soil | LSVTLFEKTPILQALQPCDSQDFLADFSNQLNLFTL |
Ga0210409_115887091 | 3300021559 | Soil | LSVTLFEKTPILRALQADDSQSDLLDHANQFMLFDL |
Ga0126371_126373152 | 3300021560 | Tropical Forest Soil | ILSVTLFEKTPVLRALQPPVSTNELLDFPNQLNLFSL |
Ga0226658_104197092 | 3300022222 | Freshwater Microbial Mat | SVSLFEKTPILQALQPPGSESDLLDTGKQLILFDF |
Ga0224534_10188391 | 3300022524 | Soil | LSVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF |
Ga0224534_10329712 | 3300022524 | Soil | ILSVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF |
Ga0224533_10384021 | 3300022526 | Soil | LSLTQFEKTPILRALQQIDSQDDLPCFSNQLNLFSL |
Ga0212124_104073251 | 3300022553 | Freshwater | VSITLFEKTPILRALQGPDSRSDSLDPGNQLNLFDF |
Ga0224531_10003851 | 3300022849 | Soil | FSVTLFEKTPILRALQNFDSQDELLPFHNQLILFDF |
Ga0224528_10030979 | 3300022861 | Soil | LSLTLFEKTPILQALQTADCENDLYNTGNQLILFDF |
Ga0224528_10069491 | 3300022861 | Soil | ILSLTLFEKTPILQALQTADCENDLYNTGNQLILFDF |
Ga0224528_10184513 | 3300022861 | Soil | ILSLTLFEKTPILRALQTSDSDNDLGDNGNQLNLFNL |
Ga0224528_10299733 | 3300022861 | Soil | SVTLFEKTPILRALQNFDSQDELLPFHNQLILFDF |
Ga0224526_10736271 | 3300022872 | Soil | SVTLFEKTPILRALQRFDSNDELQPSPNQLILFDF |
Ga0224526_10883161 | 3300022872 | Soil | LSLTLFEKTPILRALQQINSQDDSSLPANQLNLFNL |
Ga0224520_10848412 | 3300023075 | Soil | LSLTLFEKTPILRALQQIDSQLELPCPVNQLNLFGL |
Ga0224555_10034501 | 3300023088 | Soil | SVTLFEKTPILQALHAPASDTDLLDPGNQLILFDF |
Ga0224558_10629902 | 3300023090 | Soil | FSLTLFEKTPILQVLQRFTSQEELQDSSNQLILFDF |
Ga0224558_10839081 | 3300023090 | Soil | FSVTLFEKTPILRALQRFDSQDELLTHSNQLILFDF |
Ga0224558_11467982 | 3300023090 | Soil | LSLTLFEKTPILRALQTFDVDEDLAENHNQLILFDF |
Ga0224558_11743521 | 3300023090 | Soil | IFSVTLFEKTPILRALQRFDSQDELQTTSNQLILFDF |
Ga0224557_10166825 | 3300023101 | Soil | FSVTLFEKTPILRALQRFDSNDELQPSPNQLILFDF |
Ga0224529_10050713 | 3300023247 | Soil | IFSVTLFEKTPILQALQPDDFHIDLYDSGNQLNLFDF |
Ga0224529_10068501 | 3300023247 | Soil | LSLTLFEKTPILRALQTSDSDNDLGDNGNQLNLFNL |
Ga0224529_10425853 | 3300023247 | Soil | SLTLFEKTPVLRALHAFDSCNDLPDPGNQLILFDF |
Ga0224544_10121931 | 3300023250 | Soil | LSVTLFEKTPILQALQASNSEDDLVDSGNQLILFDF |
Ga0224535_11278101 | 3300023258 | Soil | LSLTLFEKTPILRALQTSDSDNDLGGNGNQLNLFNL |
Ga0224521_10532281 | 3300024233 | Soil | FSVTLFEKTPILRALQRYNSQDELEQSSNQLILFDF |
Ga0224521_11244221 | 3300024233 | Soil | LSVTLFEKTPILRALQASDFENELGDSGNQLILFDF |
Ga0208936_10144164 | 3300025404 | Peatland | FSMTLFEKTPILRALQQLDSYDNLPLDDNQLNLFDF |
Ga0208321_10247571 | 3300025409 | Peatland | QILQVLSVILFEKTPILQALQASDSESDLLDVGNQLILFDF |
Ga0208321_10436422 | 3300025409 | Peatland | LSVTLFEKTPVLRALQATDSENDLVDSGNQLILFDF |
Ga0208189_10302433 | 3300025444 | Peatland | FSVTLFEKTPILRTLQRDGFQEELSYPPNQLILFDL |
Ga0208037_10218782 | 3300025448 | Peatland | LSVTLFEKTPILRALRASDSCPGLLDPGNQLILFDF |
Ga0208193_10032571 | 3300025463 | Peatland | LSVTLFEKTPILQALQPPDSQEELFSSANQLILFDL |
Ga0208937_10143133 | 3300025506 | Peatland | LSVTLFEKTPILRALQASDFENDLGDPGNQLILFDF |
Ga0208937_10649302 | 3300025506 | Peatland | LSVTLFEKTPILQALQASDSQGELLDHGNQLILFDF |
Ga0208820_10348782 | 3300025576 | Peatland | ILSVTLFEKTPILRALQASDFENDLGDPGNQLILFDF |
Ga0209385_10185911 | 3300025650 | Arctic Peat Soil | LSVTLFEKTPILRALQNSNSQSDLLDYSNQLILFNL |
Ga0209385_11179142 | 3300025650 | Arctic Peat Soil | QILQILSLTLFEKPPILQALQASDSQEEFLDSGNQLILFDF |
Ga0209385_11448562 | 3300025650 | Arctic Peat Soil | LSLTLFEKMPILQALQASDSDNILVDDGNQLILFDF |
Ga0207933_10077163 | 3300025679 | Arctic Peat Soil | VLLDPFEEKTPILQALQPTDSEELLPDFSNQLNLFNL |
Ga0209507_11552832 | 3300025706 | Anaerobic Digestor Sludge | LSVTLFEKTPILQVLSQHNGKDLEDEGPNQLELFD |
Ga0209484_101494872 | 3300025829 | Arctic Peat Soil | LSLTLFEKTPILQALQASDSENSLLDDGNQLILFDF |
Ga0209483_10512932 | 3300025862 | Arctic Peat Soil | LSLTLFEKTPILQALQPSDSESDLSDQGNQLILFDF |
Ga0209584_102728362 | 3300025878 | Arctic Peat Soil | LSVTLFEKTPILQALQAHDSQSDLLDHANQFILFDL |
Ga0209540_100701964 | 3300025888 | Arctic Peat Soil | LSVTLFEKTPILRALQASDSENDLPDTGNQLILFDF |
Ga0207680_107123152 | 3300025903 | Switchgrass Rhizosphere | LSVTLFEKTPILQALQTFDMEENLLQDANQLILFNL |
Ga0207684_111029392 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LSVTLFEKTPILQALQPSDSQEDLLNNSNQLNLFTL |
Ga0207661_100003341 | 3300025944 | Corn Rhizosphere | ILSLTLFEKTPILRALQASDSENDLGDSGNQLILFDF |
Ga0209840_11011202 | 3300026223 | Soil | LSVTLFEKTPILQALRVSDSDNDLLDVSNQLILFDF |
Ga0247845_10615761 | 3300026451 | Soil | FSVTLFEKTPILQALQPPDSQDDSLDFANQLNLFGL |
Ga0257154_10584641 | 3300026467 | Soil | LSVTLFEKAPILQALQTFDMEENLLQDANQLILFNL |
Ga0257160_10068331 | 3300026489 | Soil | LSVTLFEKTPILQALQTFDIDDNLLQDANQLILFNL |
Ga0255350_10033834 | 3300026502 | Soil | SLTLFEKTPILQALQTADCENDLYNTGNQLILFDF |
Ga0255350_10918751 | 3300026502 | Soil | LSITLFEKTPILQALQPTDSESNLYDSTNQLILFDF |
Ga0257158_11225241 | 3300026515 | Soil | LSVTLFEKTPILQALQTFDMEENLLPDANQLILFNL |
Ga0209056_104861491 | 3300026538 | Soil | LQILSITLFEKTPILQAFQAFDSRDDLVNCGNQLNLFDF |
Ga0209648_102601003 | 3300026551 | Grasslands Soil | LSVTLFEKTPILQALQASDSREELADPGNQLILFDF |
Ga0209648_102969461 | 3300026551 | Grasslands Soil | LSVTLFEKTPILQALQASDSDTDLLDPGNQLILFDF |
Ga0208827_10334561 | 3300027641 | Peatlands Soil | ILSGTLFEKTPILQALQASDSDFEVLHSGNQLILFDF |
Ga0208827_10584872 | 3300027641 | Peatlands Soil | LSLTLFEKTPILQALQAPDSREESLDPGNQLILFEF |
Ga0209581_1000184163 | 3300027706 | Surface Soil | ILSVTLFEKTPIFRALQEPCSQEHLGDLGNQLILFDF |
(restricted) Ga0233416_103390361 | 3300027799 | Sediment | LSLTLFEQTPILQALQASEPEIDLADSGNQLILFDL |
Ga0209656_104470682 | 3300027812 | Bog Forest Soil | LSLSLFEKMPILQALQPSDSELNLPDPGNQLILFNL |
Ga0209683_104531602 | 3300027840 | Wetland Sediment | LSVTLFEKTPVWRAFQARDSESDLGESRNQLNLFTL |
Ga0209580_105236922 | 3300027842 | Surface Soil | LSLTLFEKTPILQALQAYDSQEELLDLGNQLILFDI |
Ga0209180_104054932 | 3300027846 | Vadose Zone Soil | LSVTLFEKTPILQALQTFDIDHNLLQDANQLILFNL |
Ga0209274_103455882 | 3300027853 | Soil | LSVTLFEKTPILQALQPLDSQQDLLSSANQLILFD |
Ga0209517_101568292 | 3300027854 | Peatlands Soil | ILSVTLFEKTPILQALQASTSQDDLLVSGNQLILFDL |
Ga0209517_101601691 | 3300027854 | Peatlands Soil | ILSLTLFEKTPILQALQAPDSQEESLDPGNQLILFEF |
Ga0209517_105667231 | 3300027854 | Peatlands Soil | ILSLTLFEKTPILQALQAPDSREESLDPGNQLILFEF |
Ga0209283_101369424 | 3300027875 | Vadose Zone Soil | LSLTLFEKTPILQALQASDSQEELLGPSNQLNLFDF |
Ga0209283_109090442 | 3300027875 | Vadose Zone Soil | LSVTLFEKTPILQAFQAFDSQGDLVDCGSQLNLFDF |
Ga0209181_109872061 | 3300027878 | Freshwater | QTLQVLSVSLFEKTPILQALQPPDSGSDLMDTGKQLILFDF |
Ga0209590_101148232 | 3300027882 | Vadose Zone Soil | LSVTLFEKTPILQAFQAFGSQPDLVDSGNQLTLFDF |
Ga0209450_100534604 | 3300027885 | Freshwater Lake Sediment | LSVTLFEKTPILRALAKADYTDPNYYTSNQLQLFD |
Ga0209777_100516551 | 3300027896 | Freshwater Lake Sediment | LSVTLFEKTPILRALQAPDSDSDLFDVGNQLILFDF |
Ga0209067_106882202 | 3300027898 | Watersheds | LSVTLFEKTPILQALQPFDSQEDFIDPANQLNLFDL |
Ga0209629_110046001 | 3300027984 | Termite Gut | LSVTLFEKTPILQALQQDHSQNELCNSGNQLILFDF |
(restricted) Ga0233418_101014201 | 3300027995 | Sediment | LSVTLFEKTPILRALQASDSEDDLPTLGNQLILFDF |
Ga0265292_10055637 | 3300028028 | Landfill Leachate | LSVTLFEKTPILQALEGDDDDANITTIANQLNLFN |
Ga0265296_10245671 | 3300028032 | Groundwater | VLSVTLFEKTPILQALEGDDDDANITTIANQLNLFN |
(restricted) Ga0233417_100016361 | 3300028043 | Sediment | SVTLLEKTPILRALQASDSEDDLPTLGNQLILFDF |
(restricted) Ga0233417_103983892 | 3300028043 | Sediment | SVTLFEKTPILRALQASDSEDDLPTLGNQLILFDF |
Ga0255355_10127282 | 3300028068 | Soil | FSVTLFEKTPILQVLQPDDFHVDLYDSGNQLNLFDF |
Ga0255353_10058173 | 3300028070 | Soil | SVTLFEKTPILQALQPDDFHIDLYDSGNQLNLFDF |
Ga0302149_10052845 | 3300028552 | Bog | LSVTLFEKTPILQALQLDNSQNELYDSCNQLNLFNF |
Ga0302144_101267212 | 3300028560 | Bog | LSVTLFEKTPILQALQLYDSQYESDDNSKQLNLFDL |
(restricted) Ga0255347_13438451 | 3300028593 | Wastewater | FSVTLFEKVPISRAFQASNSQGDLPCPDNQLILFDF |
Ga0302162_100867661 | 3300028649 | Fen | LSVTLFEKTPILRALDASDSENDLGVPGNQLILFDF |
Ga0265323_100632561 | 3300028653 | Rhizosphere | LSLTQFEKTPILQALQMPDCDSDLAVPGNQLILFDF |
Ga0257175_11101431 | 3300028673 | Soil | LSITLLEKTPILSALHASGSNDDLLDAGHELILFDF |
Ga0302267_1000012777 | 3300028745 | Bog | FSLTLFEKTPILQVLQRFNSQEELQGTSNQLILFDF |
Ga0302267_100007271 | 3300028745 | Bog | IFSLTLFEKTPILQVLQRFNSQEELQGTSNQLILFDF |
Ga0302267_1000235822 | 3300028745 | Bog | LSLTLFEKTPILQALQDTDYHNDLGDIGNQLILFDF |
Ga0302198_100018271 | 3300028765 | Bog | ILSLTLFEKTPILQALQDTDYHNDLGDIGNQLILFDF |
Ga0302198_100990441 | 3300028765 | Bog | FSLTLFEKTPISRALQQVDSQNDLPCPTNQLNLFNL |
Ga0302201_100217261 | 3300028785 | Bog | VFSVTLFEKTPILRALQPDDSQNDLHNSGNQLNLFDF |
Ga0302201_101090351 | 3300028785 | Bog | SVTLFEKTPILQALQLYDSQYESDDNSKQLNLFDL |
Ga0302201_101197041 | 3300028785 | Bog | LCLTQFEKTPILRALQQIDSQEDLPCFFNQLNLFDL |
Ga0265338_103796121 | 3300028800 | Rhizosphere | LSLTLFEKTPILQALQASDSQEEFLDPGNQLILFDF |
Ga0265338_104295271 | 3300028800 | Rhizosphere | LSVTLFEKTPILQALQASDSQEELPDHSNQLILFDF |
Ga0302157_101250741 | 3300028813 | Bog | SLTLFEKTPISRALQQVDSQNDLPCPTNQLNLFNL |
Ga0302199_10075636 | 3300028860 | Bog | SLTLFEKTPILQALQDTDYHNDLGDIGNQLILFDF |
Ga0302154_104082471 | 3300028882 | Bog | TIRCVTLFEKTPILRALQPDDSQNDLHNSGNQLNLFDF |
Ga0311329_108365291 | 3300029907 | Bog | LSVTLFEKTPILQALQASNSENDSPDTCNQLILFDL |
Ga0311361_1002384114 | 3300029911 | Bog | LSLTLFEKTPTLRALQASDADNDLGDISNQLILFDL |
Ga0311361_101201381 | 3300029911 | Bog | FSVTLFEKTPILRALQPDDSQNDLHNSGNQLNLFDF |
Ga0311361_103511981 | 3300029911 | Bog | VFSLTLFEKTPISRALQQVDSQNDLPCPTNQLNLFNL |
Ga0311362_1000301138 | 3300029913 | Bog | LSLTQFEKTPILQALQKLGYESDLDDSGNQLILFNF |
Ga0311362_100885181 | 3300029913 | Bog | SLTLFEKTPILQVLQRFTSQEELQDSSNQLILFDF |
Ga0311359_107567161 | 3300029914 | Bog | SLTLFEKTPILRALQTSDSDNDLGDNGNQLNLFNL |
Ga0311358_100157281 | 3300029915 | Bog | ILSLTQFEKTPILQALQKLGYESDLDDSGNQLILFNF |
Ga0311363_100360741 | 3300029922 | Fen | SLTLFEKTPTLRALQASDADNDLGDISNQLILFDL |
Ga0311346_113182462 | 3300029952 | Bog | SLSLFEKMPISQALQPSDSQPELPDPGNQLILFDL |
Ga0311331_108428141 | 3300029954 | Bog | LSVTLFEKTPILRALQASDFENELANPGNQLILFDF |
Ga0302277_11122941 | 3300029982 | Bog | LSVTLFEKTPILQALQPPDSQQDLPSSANQLILFDL |
Ga0311339_105421541 | 3300029999 | Palsa | QILSVTLFEKTPILRALQPSDSEEIALDFANQFNLFSL |
Ga0311344_103625011 | 3300030020 | Bog | LSVTLFEKTPILQALQASNSEEDLADSGNQLILFDF |
Ga0302306_103555741 | 3300030043 | Palsa | LSVTLFEKTPILQAFQDAASQDDLPVDNNQLILFDF |
Ga0302181_102853521 | 3300030056 | Palsa | LSLTLFEKTPILQALQISDSDNDLGDIGNQLILFDL |
Ga0302176_100852901 | 3300030057 | Palsa | FSVTLFEKTPILRALQRFDSQDDLQTTFNQLILFDF |
Ga0302185_101205223 | 3300030508 | Bog | QILQILSLTQFEKTPILQALQAPNSDTDLDDIDNQLILFDL |
Ga0311355_105086731 | 3300030580 | Palsa | LSLTLFEKTPILQALQTSDSDNDLGDIGNQLILFDL |
Ga0311354_108848653 | 3300030618 | Palsa | LQILSLTLFEKTPILTALQPFDPESNLQNDGNQLILFNF |
Ga0316363_100209515 | 3300030659 | Peatlands Soil | LSLTLFEKTPILQALQAPDSQEESLDPGNQLILFEF |
Ga0170834_1005197612 | 3300031057 | Forest Soil | SGTLFEKTPILQALQASDSQEQLTDPGNQLILFDF |
Ga0170822_116089262 | 3300031122 | Forest Soil | ILSLSRFEKMPILQALQPSDSESKSFDQGNQLILFDL |
Ga0170823_156451232 | 3300031128 | Forest Soil | SVTLFEKTPILQALQASDSQEELTDPGNQLILFDF |
Ga0170824_1169386201 | 3300031231 | Forest Soil | ILSVTLFEKTPILQALQTFDMEENLLQDANQLILFNL |
Ga0302323_1006142121 | 3300031232 | Fen | LSVTLFEKTPILRALQACDSDRNLVDIGNQLILFNF |
Ga0302307_105864141 | 3300031233 | Palsa | ILSITLFEKTAILQALQPSDFPEDWPDFSKQLDLFKL |
Ga0302325_100075561 | 3300031234 | Palsa | SLTLFEKTPILTALQPFDSESNLQNDGNQLILFNF |
Ga0302325_103216781 | 3300031234 | Palsa | LQILSVTLFEKTPILRALQPSDSEEIPLDFANRLNLFSL |
Ga0302325_109942182 | 3300031234 | Palsa | SVTLFEKTPILRALQPSDSEEIALDFANQLNLFSL |
Ga0302324_1000252331 | 3300031236 | Palsa | ILSVTLYEKTPILQALHASGSGADLLDPGNQLILFDF |
Ga0302324_1004008361 | 3300031236 | Palsa | SVTLFEKTPILQALHASGSGADLLDPGNQLILFDF |
Ga0302324_1018359631 | 3300031236 | Palsa | LSVTLFEKTPILQALQPSDSQEDLLDNSNQLNLFNL |
Ga0302187_100305981 | 3300031259 | Bog | SVTLFEKTPILRALQPDDSQNDLHNSGNQLNLFDF |
Ga0302140_101210891 | 3300031261 | Bog | LSVTLFEKTPILQALQPSDSQENLLDNSNQLNLFNL |
Ga0302140_110360302 | 3300031261 | Bog | VFSLTLFEKTPILRALQKIDCRDDLPSQANQLILFNL |
Ga0265316_103442361 | 3300031344 | Rhizosphere | ILSVTLFEKTPVLQALQAPDFENDLGDSANQLILFDF |
Ga0302320_100260951 | 3300031524 | Bog | ILSLSLFEKMPISQALQPSDSQPELPDPGNQLILFDL |
Ga0302320_103414281 | 3300031524 | Bog | IFSVALFEKTPILRALQRFDSQNELQSDSNQLILFDF |
Ga0302320_108801421 | 3300031524 | Bog | ILSVTLFEKTPILQALQASNSEEDLADSGNQLILFDF |
Ga0302320_109702781 | 3300031524 | Bog | LSLTLFEKTPVLRALHAFDSCNDLPDPGNQLILFDF |
Ga0302326_103349594 | 3300031525 | Palsa | LSVTLFEKTPILQALHASGSGADLLDPGNQLILFDF |
Ga0302326_116212281 | 3300031525 | Palsa | SVTLFEKTPILQALQPPDSQEELFSSANQLILFDL |
Ga0302326_124657591 | 3300031525 | Palsa | LRLTLFEKTPILQALQPSDSEIDLFESSNQLILFNF |
Ga0302326_130846111 | 3300031525 | Palsa | LSLTLFEKTPILQALQAPDSQEEFLDPGNQLILFDF |
Ga0302326_133985221 | 3300031525 | Palsa | LSVTLFEKTPILQALQSSDSQEELPGPDNQLILFDF |
Ga0247727_100310126 | 3300031576 | Biofilm | LSITPFEQMPILRALQASDSGNNLLDPGNQLNLWDF |
Ga0265313_100742494 | 3300031595 | Rhizosphere | LSVTLFEKTPILQALQSSDSQEELPGSGNQLILFDF |
Ga0307374_100337281 | 3300031670 | Soil | LSLTLFEKAPILQALQPSDSDNDLGGNGNQLNLFDL |
Ga0307374_100708166 | 3300031670 | Soil | ILSLTLFEKAPILQALQPSDSDNDLGGNGNQLNLFDL |
Ga0307374_101597491 | 3300031670 | Soil | SVTLFEKTPILQALQTFDLKANLLADVNQLILFNF |
Ga0307373_100339801 | 3300031672 | Soil | VTLTTLFEKAPILQALQPSDSDNDLGGNGNQLNLFDL |
Ga0315291_101066543 | 3300031707 | Sediment | LSVTLFEKTPILRAFEHCDYRIDLPDTCNQLTLFGL |
Ga0315291_104544911 | 3300031707 | Sediment | LQILSVTLFEKVPILQVLQASDSEENLVDAGNQLILFDF |
Ga0315291_109909582 | 3300031707 | Sediment | LSVTHFEKTPILRALQACDPRDDLHEDSNQLILFDF |
Ga0310686_1009764662 | 3300031708 | Soil | LSVTLFEKTPILQALQPLDMEGNPLPDSNQLILFNR |
Ga0310686_1187792971 | 3300031708 | Soil | SVTLFEKTPILQVLQPPDSQEDLLSSTNQLILFPL |
Ga0310686_1196088402 | 3300031708 | Soil | LQILSVTLFEKTPILQVLQPPDSQEDLLSSTNQLILFPL |
Ga0315293_108380431 | 3300031746 | Sediment | LSLMLFEKTPILQALQPSDSQENLLGNPNQLILFDF |
Ga0315293_108841193 | 3300031746 | Sediment | VLSVTLFEKTPILRAFEHCDYRIDLPDTCNQLTLFGL |
Ga0315288_101651031 | 3300031772 | Sediment | LSVTLFEKTPILRALQASDSESDLLDVGNQLILFDF |
Ga0302319_102296545 | 3300031788 | Bog | ILSLTLFEKTPILQALQPFDSQNELPDNGKQLILFDF |
Ga0302319_103896341 | 3300031788 | Bog | FSVTLFEKTPILRALQRFDSQDELQTNSNQLILFDF |
Ga0302319_112185151 | 3300031788 | Bog | LSVTLFEKTPILQALQACDSGNDLSDPGNQLILFDF |
Ga0310121_104459081 | 3300031801 | Marine | LSVTLFEKTPILQALQPSDSHENSLDDPNQLILFDF |
Ga0310121_105673571 | 3300031801 | Marine | LLQILSVTLFEKTPILQALQPSDSHENSLDDPNQLILFYF |
Ga0310123_100105698 | 3300031802 | Marine | ILSVTLFEKTPILQALQPSDSHENSLDDPNQLILFDF |
Ga0310123_100465071 | 3300031802 | Marine | QILSVTLFEKTPILQALQPADSHENSLDDPNQLILFDF |
Ga0310123_100817541 | 3300031802 | Marine | ILQILSVTLFEKTPILQTLQPSDSHENSLDAPNQLILFDF |
Ga0310123_101309101 | 3300031802 | Marine | SVTLFEKTPILQALQPSDSHENSLDDPNQLILFDF |
Ga0310120_100498435 | 3300031803 | Marine | LQILSVTLFEKTPILQALQPSDSHENSLDGPNWLILFYF |
Ga0310120_100645781 | 3300031803 | Marine | SVTLFEKTPILQALQPADSHENSLDDPNQLILFDF |
Ga0310120_100961513 | 3300031803 | Marine | LQILSVTLFEKTPILQALQPSDSHENSLDDPNQLILFDF |
Ga0316217_100213186 | 3300031813 | Freshwater | ILSLTQFEKTPILQALQKLGYESDLDDSGNQLILLNF |
Ga0315280_100128361 | 3300031862 | Sediment | SVTLFEKTPILRAFEHCDYRIDLPDTCNQLTLFGL |
(restricted) Ga0315314_10915812 | 3300031877 | Sediment | VLSVTLFEKVPILQALQASDSRDDLPCPDNQLVLFEF |
Ga0315285_101240293 | 3300031885 | Sediment | LSVTLFEKTPILQALPASDSESDLRDVGNQLILFD |
Ga0315285_103453442 | 3300031885 | Sediment | SVTLFEKTPILQALPASDSESDLRDVGNQLILFDF |
Ga0302322_1031124021 | 3300031902 | Fen | LSVTLFETTPILRALQAPDFENDLGDSGNQLILFDF |
Ga0315289_1000479914 | 3300032046 | Sediment | SVTLFEKTPILRALQASDSESDLRDVGNQLILFDF |
Ga0315289_1000553222 | 3300032046 | Sediment | LSVTLFEKTPILQALPASDSESDLRDVGNQLILFDF |
Ga0315289_101190731 | 3300032046 | Sediment | VLSVTLFEKTPILRALQASDSESDLLDVGNQLILFDF |
Ga0315289_102367683 | 3300032046 | Sediment | LSVTLFEKTPILQALQASDSESDLRDVGNQLILFDF |
Ga0315284_102122693 | 3300032053 | Sediment | LSVTLFEKTPILQALQASDSESDLRDVGNQFILFDF |
Ga0318533_105242842 | 3300032059 | Soil | QILSVTLFEKTRILQASDSECDLLDSSNQLILFDL |
Ga0315279_100233411 | 3300032070 | Sediment | VLSVTLFEKTPILRAFEHCDYRIDLPDTCNQLILFGL |
Ga0315279_102984191 | 3300032070 | Sediment | LSVTLFEKTPILRAFEHCDYRIDLPDTCNQLILFGL |
Ga0315277_101076031 | 3300032118 | Sediment | LSVTLFEKTPILRALQACDPRDDLHEDSNQLILFDF |
Ga0315295_116466791 | 3300032156 | Sediment | QILSVTLFEKTPILQALQASDSEENLVEDANQLILFDF |
Ga0311301_102199575 | 3300032160 | Peatlands Soil | LSITLFEKTPILRALQACDSQNDSLDLGNQLILFDF |
Ga0311301_104406412 | 3300032160 | Peatlands Soil | LSVTLFEKTPILQALQASTSQDDLLVSGNQLILFDL |
Ga0311301_109922722 | 3300032160 | Peatlands Soil | SVTLFEKTPILQALQASTSQDDLMVSGNQLILFDL |
Ga0311301_118614981 | 3300032160 | Peatlands Soil | LSVTLFEKTPILQALQPSDSQEDPFDHSNQLSLFTL |
Ga0306920_1020275281 | 3300032261 | Soil | LSLTLFEKVPILQALQPSDSQNESDQDPNQLILFDF |
Ga0316222_10069658 | 3300032561 | Freshwater | LSVTLFEKTPVLQALQLDNSQTDLYDSCNQLNLFDF |
Ga0335082_105216731 | 3300032782 | Soil | LSVTLFEKTPILQALQTSGSNNDLLDPGNQLILFDF |
Ga0335079_109848691 | 3300032783 | Soil | LSVTLFEKTPILQALQASDSNNELLDPGNQLILFDF |
Ga0335079_118900571 | 3300032783 | Soil | LSITLFEKVPILQALQASDSQSDLLNPGNQLNLFDS |
Ga0335079_120280921 | 3300032783 | Soil | ILSITLFEKVPILQALQASDSQSDLLNPGNQLNLFDS |
Ga0335078_124207161 | 3300032805 | Soil | LSVTLFERTPILRALQEPDSANNLGDLGNQLILFDL |
Ga0335070_120193731 | 3300032829 | Soil | LSLSLFEKTPILQALQRIDSQSDLPATINQLNLFNL |
Ga0335069_119085771 | 3300032893 | Soil | LSVTLFEKTPILRALQASDFENDLGDSPNQLTLFDF |
Ga0335069_122275341 | 3300032893 | Soil | LSVTLFEKTPILQALQPPDSQENLVGSANQLNLFSL |
Ga0335074_107884033 | 3300032895 | Soil | IFSVILFEKTPILRALQRDDFINELHGSASQLILFDF |
Ga0334722_101134713 | 3300033233 | Sediment | LSVTFFEKTPILRALQAPGSEDDLFDVGNQLILFDF |
Ga0326728_100004181 | 3300033402 | Peat Soil | LSLTLFEKTPILQALQQIDSQLELTCSGNQLNLFSL |
Ga0326728_100323708 | 3300033402 | Peat Soil | VLSLTLFEKTPILQALQQIDSQLELTCSGNQLNLFSL |
Ga0326728_101622021 | 3300033402 | Peat Soil | VLSLTLFEKTPILRALQQINSKDDLPCSDNQLILFN |
Ga0326727_109991332 | 3300033405 | Peat Soil | LSLTLFEKTPILRALQQINSKDDLPCSDNQLILFN |
Ga0316626_119139891 | 3300033485 | Soil | LSVTLFEKTPILQALQPSDSQENLLVSPNQLILFDF |
Ga0316628_1039497041 | 3300033513 | Soil | ILSVTLFEKTPVLRALQASGSQEELREDCNQLILFDF |
Ga0334828_011919_3_113 | 3300033822 | Soil | LSITLFEKTTILQALQASDSQPDLPDQGNQLILFDF |
Ga0334828_042908_1167_1277 | 3300033822 | Soil | LSITLFEKTTILQALQASDSQPDLPDPGNQLILFDF |
Ga0334790_015320_3582_3692 | 3300033887 | Soil | LSLTLFEKTPILQALQTSNSENDLGDLSNQLILFDL |
Ga0334790_056154_1330_1437 | 3300033887 | Soil | SLTLFEKTPILQALQTSNSENDLGDLSNQLILFDL |
Ga0334790_130528_665_775 | 3300033887 | Soil | LSLTLFEKTPILQALQASDSQEDSLDPGNQLILFEF |
Ga0371488_0491814_1_111 | 3300033983 | Peat Soil | LSLTLFEKTPILRALQQIDSEDDLPCFSNQLNLFSL |
Ga0364934_0024368_3_113 | 3300034178 | Sediment | LSLTLFEKTPILRALQPSNSQEDLGDFAKQLNLFNL |
⦗Top⦘ |