NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F003565

Metagenome / Metatranscriptome Family F003565

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F003565
Family Type Metagenome / Metatranscriptome
Number of Sequences 479
Average Sequence Length 41 residues
Representative Sequence LAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS
Number of Associated Samples 333
Number of Associated Scaffolds 479

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 14.32 %
% of genes near scaffold ends (potentially truncated) 95.20 %
% of genes from short scaffolds (< 2000 bps) 81.84 %
Associated GOLD sequencing projects 312
AlphaFold2 3D model prediction Yes
3D model pTM-score0.20

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (96.033 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(28.392 % of family members)
Environment Ontology (ENVO) Unclassified
(29.645 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(50.522 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.35%    β-sheet: 0.00%    Coil/Unstructured: 67.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.20
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 479 Family Scaffolds
PF08388GIIM 20.46
PF00078RVT_1 7.31
PF04392ABC_sub_bind 5.64
PF03401TctC 1.04
PF13420Acetyltransf_4 0.84
PF00072Response_reg 0.63
PF13561adh_short_C2 0.42
PF02371Transposase_20 0.42
PF02518HATPase_c 0.42
PF03972MmgE_PrpD 0.42
PF02652Lactate_perm 0.42
PF13704Glyco_tranf_2_4 0.42
PF14281PDDEXK_4 0.42
PF13432TPR_16 0.42
PF00872Transposase_mut 0.42
PF07883Cupin_2 0.42
PF12833HTH_18 0.42
PF04191PEMT 0.42
PF01699Na_Ca_ex 0.42
PF03466LysR_substrate 0.42
PF00582Usp 0.21
PF00579tRNA-synt_1b 0.21
PF13610DDE_Tnp_IS240 0.21
PF04188Mannosyl_trans2 0.21
PF01494FAD_binding_3 0.21
PF02668TauD 0.21
PF13502AsmA_2 0.21
PF01548DEDD_Tnp_IS110 0.21
PF00857Isochorismatase 0.21
PF01527HTH_Tnp_1 0.21
PF01370Epimerase 0.21
PF13411MerR_1 0.21
PF01152Bac_globin 0.21
PF13426PAS_9 0.21
PF00571CBS 0.21
PF03050DDE_Tnp_IS66 0.21
PF03534SpvB 0.21
PF01048PNP_UDP_1 0.21
PF10048DUF2282 0.21
PF10108DNA_pol_B_exo2 0.21
PF13936HTH_38 0.21
PF02810SEC-C 0.21
PF13505OMP_b-brl 0.21
PF13924Lipocalin_5 0.21
PF00924MS_channel 0.21
PF13191AAA_16 0.21
PF09694Gcw_chp 0.21
PF06186DUF992 0.21
PF00440TetR_N 0.21
PF16363GDP_Man_Dehyd 0.21
PF00486Trans_reg_C 0.21
PF12728HTH_17 0.21
PF05209MinC_N 0.21
PF00239Resolvase 0.21
PF01988VIT1 0.21
PF07690MFS_1 0.21
PF01070FMN_dh 0.21
PF13557Phenol_MetA_deg 0.21
PF00884Sulfatase 0.21
PF00176SNF2-rel_dom 0.21
PF13185GAF_2 0.21
PF13408Zn_ribbon_recom 0.21
PF00496SBP_bac_5 0.21
PF03083MtN3_slv 0.21
PF05598DUF772 0.21
PF06742DUF1214 0.21
PF01042Ribonuc_L-PSP 0.21
PF03781FGE-sulfatase 0.21
PF13180PDZ_2 0.21
PF13701DDE_Tnp_1_4 0.21
PF01609DDE_Tnp_1 0.21
PF09722Xre_MbcA_ParS_C 0.21
PF03098An_peroxidase 0.21
PF00248Aldo_ket_red 0.21
PF11159DUF2939 0.21
PF00296Bac_luciferase 0.21
PF13751DDE_Tnp_1_6 0.21
PF01047MarR 0.21

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 479 Family Scaffolds
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 5.64
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 1.04
COG3547TransposaseMobilome: prophages, transposons [X] 0.63
COG3328Transposase (or an inactivated derivative)Mobilome: prophages, transposons [X] 0.42
COG0387Cation (Ca2+/Na+/K+)/H+ antiporter ChaAInorganic ion transport and metabolism [P] 0.42
COG0530Ca2+/Na+ antiporterInorganic ion transport and metabolism [P] 0.42
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 0.42
COG1620L-lactate permeaseEnergy production and conversion [C] 0.42
COG20792-methylcitrate dehydratase PrpDCarbohydrate transport and metabolism [G] 0.42
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.21
COG3436TransposaseMobilome: prophages, transposons [X] 0.21
COG4095Sugar transporter, SemiSWEET family, contains PQ motifCarbohydrate transport and metabolism [G] 0.21
COG5361Uncharacterized conserved proteinMobilome: prophages, transposons [X] 0.21
COG5402Uncharacterized protein, contains DUF1214 domainFunction unknown [S] 0.21
COG5421TransposaseMobilome: prophages, transposons [X] 0.21
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.21
COG5542Mannosyltransferase related to Gpi18Carbohydrate transport and metabolism [G] 0.21
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.21
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.21
COG0162Tyrosyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.21
COG0180Tryptophanyl-tRNA synthetaseTranslation, ribosomal structure and biogenesis [J] 0.21
COG0251Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 familyDefense mechanisms [V] 0.21
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.21
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.21
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.21
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.21
COG0775Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnBNucleotide transport and metabolism [F] 0.21
COG0813Purine-nucleoside phosphorylaseNucleotide transport and metabolism [F] 0.21
COG0850Septum site-determining protein MinCCell cycle control, cell division, chromosome partitioning [D] 0.21
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.21
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.21
COG1335Nicotinamidase-related amidaseCoenzyme transport and metabolism [H] 0.21
COG1535Isochorismate hydrolaseSecondary metabolites biosynthesis, transport and catabolism [Q] 0.21
COG1633Rubrerythrin, includes spore coat protein YhjRInorganic ion transport and metabolism [P] 0.21
COG1814Predicted Fe2+/Mn2+ transporter, VIT1/CCC1 familyInorganic ion transport and metabolism [P] 0.21
COG1961Site-specific DNA recombinase SpoIVCA/DNA invertase PinEReplication, recombination and repair [L] 0.21
COG2141Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase)Coenzyme transport and metabolism [H] 0.21
COG2175Taurine dioxygenase, alpha-ketoglutarate-dependentSecondary metabolites biosynthesis, transport and catabolism [Q] 0.21
COG2346Truncated hemoglobin YjbIInorganic ion transport and metabolism [P] 0.21
COG2452Predicted site-specific integrase-resolvaseMobilome: prophages, transposons [X] 0.21
COG2820Uridine phosphorylaseNucleotide transport and metabolism [F] 0.21
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.21
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.21
COG3293TransposaseMobilome: prophages, transposons [X] 0.21

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms96.45 %
UnclassifiedrootN/A3.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2040502001|FACENC_GAMC6GA01CDCUYAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium512Open in IMG/M
2067725002|GPICC_F5MS3JC01AFKQXAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661536Open in IMG/M
2088090015|GPICI_9252237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1180Open in IMG/M
2124908044|A5_c1_ConsensusfromContig73097All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium810Open in IMG/M
2124908044|A5_c1_ConsensusfromContig9372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2095Open in IMG/M
2170459010|GIO7OMY02JNHS2All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium516Open in IMG/M
2189573004|GZGWRS402HAAJOAll Organisms → cellular organisms → Bacteria508Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1004654All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1880Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1025214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei760Open in IMG/M
3300000655|AF_2010_repII_A100DRAFT_1008419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1976Open in IMG/M
3300000681|JGI12370J11904_100496All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei745Open in IMG/M
3300000690|JGI12582J11924_101371All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei690Open in IMG/M
3300000705|JGI12455J11871_102386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei742Open in IMG/M
3300000723|JGI12372J11909_103636All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei735Open in IMG/M
3300000731|JGI12381J11899_1010112All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei761Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10060565All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales831Open in IMG/M
3300001137|JGI12637J13337_1016441All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1644Open in IMG/M
3300001154|JGI12636J13339_1005874All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1999Open in IMG/M
3300001356|JGI12269J14319_10038394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3044Open in IMG/M
3300001383|JGI20194J14741_1003585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2183Open in IMG/M
3300001396|JGI20175J14863_1001783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → Nitrobacter hamburgensis4050Open in IMG/M
3300001397|JGI20177J14857_1031984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1597Open in IMG/M
3300001407|JGI20192J14887_1013049All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium777Open in IMG/M
3300001407|JGI20192J14887_1014731All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1693Open in IMG/M
3300001412|JGI20173J14856_1008189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2105Open in IMG/M
3300001593|JGI12635J15846_10460477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1756Open in IMG/M
3300001593|JGI12635J15846_10583799All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1651Open in IMG/M
3300001625|JGI20248J16329_10002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3288Open in IMG/M
3300001640|JGI20244J16305_100047All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1974Open in IMG/M
3300001641|JGI20238J16299_101958All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1630Open in IMG/M
3300001642|JGI20246J16307_100009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3605Open in IMG/M
3300001648|JGI20242J16303_100330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1941Open in IMG/M
3300001658|JGI20282J16327_101010All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei525Open in IMG/M
3300001686|C688J18823_10544381All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei742Open in IMG/M
3300002459|JGI24751J29686_10057394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales802Open in IMG/M
3300002911|JGI25390J43892_10069221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei815Open in IMG/M
3300003505|JGIcombinedJ51221_10247486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei724Open in IMG/M
3300004003|Ga0055445_10186670All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales705Open in IMG/M
3300005331|Ga0070670_100008733All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium8651Open in IMG/M
3300005331|Ga0070670_100127828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2193Open in IMG/M
3300005332|Ga0066388_101086497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1352Open in IMG/M
3300005332|Ga0066388_102479009All Organisms → cellular organisms → Bacteria942Open in IMG/M
3300005332|Ga0066388_103771097All Organisms → cellular organisms → Bacteria → Proteobacteria773Open in IMG/M
3300005340|Ga0070689_100093177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2377Open in IMG/M
3300005340|Ga0070689_100104616All Organisms → cellular organisms → Bacteria2244Open in IMG/M
3300005367|Ga0070667_101980982All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium548Open in IMG/M
3300005435|Ga0070714_101195885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium741Open in IMG/M
3300005436|Ga0070713_101215256All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1730Open in IMG/M
3300005456|Ga0070678_100064641All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2712Open in IMG/M
3300005548|Ga0070665_101185740All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens774Open in IMG/M
3300005553|Ga0066695_10369807All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium895Open in IMG/M
3300005586|Ga0066691_10485076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei739Open in IMG/M
3300005586|Ga0066691_10623500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium641Open in IMG/M
3300005713|Ga0066905_100212545All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1456Open in IMG/M
3300005713|Ga0066905_100359609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1166Open in IMG/M
3300005713|Ga0066905_100802941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei816Open in IMG/M
3300005713|Ga0066905_101165220All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria687Open in IMG/M
3300005713|Ga0066905_101171454All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1686Open in IMG/M
3300005713|Ga0066905_101795528All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium565Open in IMG/M
3300005713|Ga0066905_102284441All Organisms → cellular organisms → Bacteria → Proteobacteria505Open in IMG/M
3300005764|Ga0066903_101768350All Organisms → cellular organisms → Bacteria1179Open in IMG/M
3300005764|Ga0066903_102302738All Organisms → cellular organisms → Bacteria1040Open in IMG/M
3300005764|Ga0066903_103282501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae874Open in IMG/M
3300005764|Ga0066903_103499687All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium846Open in IMG/M
3300005764|Ga0066903_103791018All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria812Open in IMG/M
3300005764|Ga0066903_106037090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales634Open in IMG/M
3300005764|Ga0066903_107440825All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae565Open in IMG/M
3300005834|Ga0068851_10827134All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1577Open in IMG/M
3300005980|Ga0066798_10093414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales884Open in IMG/M
3300006028|Ga0070717_10694540All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium924Open in IMG/M
3300006041|Ga0075023_100015125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2061Open in IMG/M
3300006050|Ga0075028_100621168All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1643Open in IMG/M
3300006086|Ga0075019_10371026All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661871Open in IMG/M
3300006102|Ga0075015_100337353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales837Open in IMG/M
3300006174|Ga0075014_100422144All Organisms → cellular organisms → Bacteria731Open in IMG/M
3300006176|Ga0070765_101218796All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae710Open in IMG/M
3300006176|Ga0070765_101640205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1604Open in IMG/M
3300006354|Ga0075021_10073772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1999Open in IMG/M
3300006358|Ga0068871_100471697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1128Open in IMG/M
3300006358|Ga0068871_101052048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium760Open in IMG/M
3300006603|Ga0074064_11761787All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium558Open in IMG/M
3300006797|Ga0066659_10807490All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum777Open in IMG/M
3300006893|Ga0073928_10187865All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1629Open in IMG/M
3300006950|Ga0075524_10396535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1609Open in IMG/M
3300009012|Ga0066710_101910488All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei888Open in IMG/M
3300009038|Ga0099829_10649987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1876Open in IMG/M
3300009089|Ga0099828_10067524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. URHD00693017Open in IMG/M
3300009137|Ga0066709_101697486All Organisms → cellular organisms → Bacteria896Open in IMG/M
3300009143|Ga0099792_10147535All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1293Open in IMG/M
3300009176|Ga0105242_12824734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei536Open in IMG/M
3300009177|Ga0105248_10402055All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Hyphomicrobium → unclassified Hyphomicrobium → Hyphomicrobium sp.1542Open in IMG/M
3300009698|Ga0116216_10930700All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300009789|Ga0126307_10111442All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2174Open in IMG/M
3300009824|Ga0116219_10054465All Organisms → cellular organisms → Bacteria2368Open in IMG/M
3300009824|Ga0116219_10139561All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300009839|Ga0116223_10540984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium675Open in IMG/M
3300010037|Ga0126304_10174754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1398Open in IMG/M
3300010041|Ga0126312_10807379All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium681Open in IMG/M
3300010045|Ga0126311_10235672All Organisms → cellular organisms → Bacteria → Proteobacteria1351Open in IMG/M
3300010047|Ga0126382_10442526All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300010047|Ga0126382_11158534Not Available689Open in IMG/M
3300010101|Ga0127481_1127713All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1608Open in IMG/M
3300010147|Ga0126319_1279343All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei811Open in IMG/M
3300010154|Ga0127503_10277169All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661678Open in IMG/M
3300010341|Ga0074045_10213977All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1286Open in IMG/M
3300010360|Ga0126372_12344431All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661584Open in IMG/M
3300010362|Ga0126377_10136245All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2289Open in IMG/M
3300010362|Ga0126377_10301301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1581Open in IMG/M
3300010366|Ga0126379_12513002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661614Open in IMG/M
3300010366|Ga0126379_12966279Not Available568Open in IMG/M
3300010366|Ga0126379_13164820Not Available551Open in IMG/M
3300010366|Ga0126379_13807535Not Available505Open in IMG/M
3300010379|Ga0136449_102930177All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium669Open in IMG/M
3300010396|Ga0134126_10480227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1435Open in IMG/M
3300010397|Ga0134124_10572338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 46611103Open in IMG/M
3300010859|Ga0126352_1175854All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium542Open in IMG/M
3300010868|Ga0124844_1063127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1343Open in IMG/M
3300011270|Ga0137391_10501160All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.11028Open in IMG/M
3300012199|Ga0137383_11124975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei567Open in IMG/M
3300012203|Ga0137399_10792675All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium798Open in IMG/M
3300012207|Ga0137381_10907761Not Available761Open in IMG/M
3300012209|Ga0137379_10324506All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1450Open in IMG/M
3300012209|Ga0137379_10637244All Organisms → cellular organisms → Bacteria972Open in IMG/M
3300012211|Ga0137377_11028388All Organisms → cellular organisms → Bacteria → Proteobacteria754Open in IMG/M
3300012355|Ga0137369_10370846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1040Open in IMG/M
3300012358|Ga0137368_10458668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. JYMT SZCCT0428827Open in IMG/M
3300012358|Ga0137368_10659906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii661Open in IMG/M
3300012360|Ga0137375_10509426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis → Methylocystis rosea1022Open in IMG/M
3300012363|Ga0137390_11919518All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. 200520Open in IMG/M
3300012469|Ga0150984_108047682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei801Open in IMG/M
3300012903|Ga0157289_10190777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei662Open in IMG/M
3300012922|Ga0137394_10900375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei738Open in IMG/M
3300012922|Ga0137394_11509301All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei531Open in IMG/M
3300012923|Ga0137359_11557373All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales549Open in IMG/M
3300012939|Ga0162650_100000601All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3039Open in IMG/M
3300012971|Ga0126369_11223368All Organisms → cellular organisms → Bacteria841Open in IMG/M
3300013306|Ga0163162_10191707All Organisms → cellular organisms → Bacteria2172Open in IMG/M
3300014156|Ga0181518_10034604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3216Open in IMG/M
3300014200|Ga0181526_10098656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1866Open in IMG/M
3300014320|Ga0075342_1138427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium657Open in IMG/M
3300014657|Ga0181522_10418884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei802Open in IMG/M
3300015052|Ga0137411_1021263All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei929Open in IMG/M
3300015052|Ga0137411_1208607All Organisms → cellular organisms → Bacteria5224Open in IMG/M
3300015242|Ga0137412_10681443All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium768Open in IMG/M
3300015245|Ga0137409_10030276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium5253Open in IMG/M
3300015372|Ga0132256_100137103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum2437Open in IMG/M
3300015374|Ga0132255_100285907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2369Open in IMG/M
3300016270|Ga0182036_10157886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1622Open in IMG/M
3300016270|Ga0182036_10581928All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 65-37896Open in IMG/M
3300016294|Ga0182041_11306347All Organisms → cellular organisms → Bacteria → Proteobacteria664Open in IMG/M
3300016294|Ga0182041_12016255All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1537Open in IMG/M
3300016319|Ga0182033_10995165All Organisms → cellular organisms → Bacteria746Open in IMG/M
3300016357|Ga0182032_10984445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei720Open in IMG/M
3300016371|Ga0182034_10125690All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.11886Open in IMG/M
3300016387|Ga0182040_10415803All Organisms → cellular organisms → Bacteria → Proteobacteria1058Open in IMG/M
3300016387|Ga0182040_10691579All Organisms → cellular organisms → Bacteria → Proteobacteria833Open in IMG/M
3300016404|Ga0182037_10533065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium989Open in IMG/M
3300016404|Ga0182037_11275295All Organisms → cellular organisms → Bacteria647Open in IMG/M
3300016404|Ga0182037_12009325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium519Open in IMG/M
3300016422|Ga0182039_10805221All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei834Open in IMG/M
3300016422|Ga0182039_10931082All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria777Open in IMG/M
3300016422|Ga0182039_11280523All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium664Open in IMG/M
3300016422|Ga0182039_11337977All Organisms → cellular organisms → Bacteria649Open in IMG/M
3300016422|Ga0182039_11472974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei619Open in IMG/M
3300016422|Ga0182039_11589463All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium597Open in IMG/M
3300016445|Ga0182038_10181038All Organisms → cellular organisms → Bacteria → Proteobacteria1641Open in IMG/M
3300016445|Ga0182038_10537713Not Available1002Open in IMG/M
3300017822|Ga0187802_10001098All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria7120Open in IMG/M
3300017822|Ga0187802_10053723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1475Open in IMG/M
3300017822|Ga0187802_10228889All Organisms → cellular organisms → Bacteria717Open in IMG/M
3300017822|Ga0187802_10334935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium sediminis593Open in IMG/M
3300017925|Ga0187856_1166909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales818Open in IMG/M
3300017926|Ga0187807_1021226All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2004Open in IMG/M
3300017927|Ga0187824_10069366All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1105Open in IMG/M
3300017933|Ga0187801_10173526All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium847Open in IMG/M
3300017933|Ga0187801_10442775All Organisms → cellular organisms → Bacteria544Open in IMG/M
3300017946|Ga0187879_10013898All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae5055Open in IMG/M
3300017955|Ga0187817_10067562All Organisms → cellular organisms → Bacteria → Proteobacteria2220Open in IMG/M
3300017955|Ga0187817_10707290All Organisms → cellular organisms → Bacteria643Open in IMG/M
3300017972|Ga0187781_11472604All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium505Open in IMG/M
3300017995|Ga0187816_10474437All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium561Open in IMG/M
3300017995|Ga0187816_10486908All Organisms → cellular organisms → Bacteria554Open in IMG/M
3300018006|Ga0187804_10594295All Organisms → cellular organisms → Bacteria503Open in IMG/M
3300018021|Ga0187882_1321292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium591Open in IMG/M
3300018023|Ga0187889_10167118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1031Open in IMG/M
3300018027|Ga0184605_10528847All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria510Open in IMG/M
3300018030|Ga0187869_10312609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei755Open in IMG/M
3300018040|Ga0187862_10550779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei688Open in IMG/M
3300018040|Ga0187862_10627291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium634Open in IMG/M
3300018047|Ga0187859_10020457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3667Open in IMG/M
3300018052|Ga0184638_1031858All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1902Open in IMG/M
3300018061|Ga0184619_10260671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei797Open in IMG/M
3300018062|Ga0187784_10120386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2141Open in IMG/M
3300018468|Ga0066662_11546299All Organisms → cellular organisms → Bacteria691Open in IMG/M
3300018917|Ga0193611_1077891All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales917Open in IMG/M
3300018918|Ga0193616_1115950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales746Open in IMG/M
3300019867|Ga0193704_1009380All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1962Open in IMG/M
3300019886|Ga0193727_1052408All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1312Open in IMG/M
3300019890|Ga0193728_1110438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1259Open in IMG/M
3300019999|Ga0193718_1017148All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1606Open in IMG/M
3300020001|Ga0193731_1113585All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei691Open in IMG/M
3300020004|Ga0193755_1025369All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1963Open in IMG/M
3300020198|Ga0194120_10046087All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3554Open in IMG/M
3300020220|Ga0194119_10275723All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1140Open in IMG/M
3300020579|Ga0210407_10122091All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1993Open in IMG/M
3300020579|Ga0210407_10875855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1689Open in IMG/M
3300020579|Ga0210407_11251745All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300020580|Ga0210403_10108007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2258Open in IMG/M
3300020580|Ga0210403_10140430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1972Open in IMG/M
3300020580|Ga0210403_10523749All Organisms → cellular organisms → Bacteria → Proteobacteria962Open in IMG/M
3300020581|Ga0210399_10040059All Organisms → cellular organisms → Bacteria → Proteobacteria3753Open in IMG/M
3300020581|Ga0210399_10367952All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1200Open in IMG/M
3300020582|Ga0210395_10116618All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1980Open in IMG/M
3300020583|Ga0210401_10184143All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1944Open in IMG/M
3300020583|Ga0210401_10303748All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1456Open in IMG/M
3300020583|Ga0210401_10597738All Organisms → cellular organisms → Bacteria965Open in IMG/M
3300021073|Ga0210378_10036395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1958Open in IMG/M
3300021078|Ga0210381_10010746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2213Open in IMG/M
3300021080|Ga0210382_10031727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1989Open in IMG/M
3300021082|Ga0210380_10129117All Organisms → cellular organisms → Bacteria1128Open in IMG/M
3300021088|Ga0210404_10049677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1967Open in IMG/M
3300021168|Ga0210406_10136588All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2064Open in IMG/M
3300021168|Ga0210406_10147019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1980Open in IMG/M
3300021168|Ga0210406_10535811All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae922Open in IMG/M
3300021170|Ga0210400_11045056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium663Open in IMG/M
3300021171|Ga0210405_10439029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1026Open in IMG/M
3300021178|Ga0210408_10129241All Organisms → cellular organisms → Bacteria1995Open in IMG/M
3300021178|Ga0210408_10209365All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1551Open in IMG/M
3300021178|Ga0210408_10718802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium786Open in IMG/M
3300021180|Ga0210396_10177886All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1905Open in IMG/M
3300021180|Ga0210396_10258127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1548Open in IMG/M
3300021363|Ga0193699_10236187All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei760Open in IMG/M
3300021401|Ga0210393_10136198All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1969Open in IMG/M
3300021403|Ga0210397_10069314All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum2306Open in IMG/M
3300021403|Ga0210397_10789897All Organisms → cellular organisms → Bacteria732Open in IMG/M
3300021404|Ga0210389_11263901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1566Open in IMG/M
3300021405|Ga0210387_10543019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1033Open in IMG/M
3300021405|Ga0210387_10984718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei739Open in IMG/M
3300021407|Ga0210383_10148679All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1989Open in IMG/M
3300021420|Ga0210394_10124912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2228Open in IMG/M
3300021432|Ga0210384_10166201All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1981Open in IMG/M
3300021432|Ga0210384_10167194All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1975Open in IMG/M
3300021475|Ga0210392_10757011All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei724Open in IMG/M
3300021478|Ga0210402_10175580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1961Open in IMG/M
3300021479|Ga0210410_10434449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1175Open in IMG/M
3300021479|Ga0210410_10545095All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1033Open in IMG/M
3300021559|Ga0210409_10777786All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300021559|Ga0210409_11414625All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales571Open in IMG/M
3300021559|Ga0210409_11453638All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300021559|Ga0210409_11520514Not Available545Open in IMG/M
3300021560|Ga0126371_10059178All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3690Open in IMG/M
3300021560|Ga0126371_10154984All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2356Open in IMG/M
3300022510|Ga0242652_1000781All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum2029Open in IMG/M
3300022530|Ga0242658_1233076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium514Open in IMG/M
3300022534|Ga0224452_1019802All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1864Open in IMG/M
3300022889|Ga0247785_1016269All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei801Open in IMG/M
3300024227|Ga0228598_1007903Not Available2156Open in IMG/M
3300025320|Ga0209171_10184439All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1191Open in IMG/M
3300025320|Ga0209171_10372760Not Available739Open in IMG/M
3300025604|Ga0207930_1017964All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2019Open in IMG/M
3300025899|Ga0207642_10501268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1743Open in IMG/M
3300025906|Ga0207699_11460872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria506Open in IMG/M
3300025910|Ga0207684_10197866All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Oligostraca → Ostracoda → Podocopa → Podocopida → Cypridocopina → Cypridoidea → Cyprididae → Notodromas → Notodromas monacha1733Open in IMG/M
3300025913|Ga0207695_11097185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei676Open in IMG/M
3300025922|Ga0207646_10482013All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1118Open in IMG/M
3300025923|Ga0207681_10527606All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales969Open in IMG/M
3300025935|Ga0207709_10095485All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1954Open in IMG/M
3300025936|Ga0207670_10054932All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2689Open in IMG/M
3300025939|Ga0207665_10882331All Organisms → cellular organisms → Bacteria → Proteobacteria709Open in IMG/M
3300025981|Ga0207640_11271419All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales656Open in IMG/M
3300026023|Ga0207677_10035577All Organisms → cellular organisms → Bacteria3236Open in IMG/M
3300026078|Ga0207702_10149824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2121Open in IMG/M
3300026223|Ga0209840_1012567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1932Open in IMG/M
3300026361|Ga0257176_1001903All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1966Open in IMG/M
3300026361|Ga0257176_1056580All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1623Open in IMG/M
3300026886|Ga0207982_1000414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2120Open in IMG/M
3300027003|Ga0207722_1000901All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3922Open in IMG/M
3300027070|Ga0208365_1002722All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2023Open in IMG/M
3300027073|Ga0208366_1001937All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1769Open in IMG/M
3300027383|Ga0209213_1008836Not Available1805Open in IMG/M
3300027480|Ga0208993_1054727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1722Open in IMG/M
3300027546|Ga0208984_1084795All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria685Open in IMG/M
3300027625|Ga0208044_1138045All Organisms → cellular organisms → Bacteria684Open in IMG/M
3300027635|Ga0209625_1049414All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium939Open in IMG/M
3300027651|Ga0209217_1002574All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR655986Open in IMG/M
3300027696|Ga0208696_1099692All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium966Open in IMG/M
3300027812|Ga0209656_10128229All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1298Open in IMG/M
3300027824|Ga0209040_10288884All Organisms → cellular organisms → Bacteria → Proteobacteria804Open in IMG/M
3300027846|Ga0209180_10405887All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1772Open in IMG/M
3300027846|Ga0209180_10531684All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei656Open in IMG/M
3300027846|Ga0209180_10775852All Organisms → cellular organisms → Bacteria → Proteobacteria515Open in IMG/M
3300027879|Ga0209169_10168123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1144Open in IMG/M
3300027882|Ga0209590_10911959All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium553Open in IMG/M
3300027898|Ga0209067_10393842All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661775Open in IMG/M
3300027910|Ga0209583_10024083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1961Open in IMG/M
3300028047|Ga0209526_10105032All Organisms → cellular organisms → Bacteria1987Open in IMG/M
3300028047|Ga0209526_10421103All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium campsiandrae883Open in IMG/M
3300028047|Ga0209526_10506910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales786Open in IMG/M
3300028379|Ga0268266_10912401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium849Open in IMG/M
3300028379|Ga0268266_11085568All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium diazoefficiens774Open in IMG/M
3300028704|Ga0307321_1040664All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei865Open in IMG/M
3300028710|Ga0307322_10010100All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2075Open in IMG/M
3300028714|Ga0307309_10007987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1833Open in IMG/M
3300028778|Ga0307288_10070855All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1231Open in IMG/M
3300028786|Ga0307517_10653746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei511Open in IMG/M
3300028791|Ga0307290_10025665All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2073Open in IMG/M
3300028792|Ga0307504_10012081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1978Open in IMG/M
3300028799|Ga0307284_10024590All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1965Open in IMG/M
3300028802|Ga0307503_10302494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium803Open in IMG/M
3300028819|Ga0307296_10060307All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2009Open in IMG/M
3300028824|Ga0307310_10023414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2440Open in IMG/M
3300028875|Ga0307289_10178549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales873Open in IMG/M
3300028875|Ga0307289_10225603All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei770Open in IMG/M
3300028875|Ga0307289_10429906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei543Open in IMG/M
3300028878|Ga0307278_10048118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1932Open in IMG/M
3300028880|Ga0307300_10003935All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3750Open in IMG/M
3300028885|Ga0307304_10027449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1977Open in IMG/M
3300029907|Ga0311329_10165113All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1736Open in IMG/M
3300029910|Ga0311369_10154728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2203Open in IMG/M
3300029910|Ga0311369_10665646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei859Open in IMG/M
3300029943|Ga0311340_10192789All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2064Open in IMG/M
3300030007|Ga0311338_10116114All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei3280Open in IMG/M
3300030520|Ga0311372_11931764All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1696Open in IMG/M
3300030743|Ga0265461_10077325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1477Open in IMG/M
3300030844|Ga0075377_11761653All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1504Open in IMG/M
3300030943|Ga0311366_11100504All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium686Open in IMG/M
3300030969|Ga0075394_12020759All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1618Open in IMG/M
3300030988|Ga0308183_1038766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1909Open in IMG/M
3300031095|Ga0308184_1027471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1646Open in IMG/M
3300031100|Ga0308180_1021696All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium629Open in IMG/M
3300031184|Ga0307499_10068543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium910Open in IMG/M
3300031198|Ga0307500_10218090All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium576Open in IMG/M
3300031241|Ga0265325_10053264All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2075Open in IMG/M
3300031250|Ga0265331_10146698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1072Open in IMG/M
3300031474|Ga0170818_104815815All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii901Open in IMG/M
3300031525|Ga0302326_10127631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4450Open in IMG/M
3300031545|Ga0318541_10055538All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2044Open in IMG/M
3300031549|Ga0318571_10142686All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei821Open in IMG/M
3300031549|Ga0318571_10143976All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales818Open in IMG/M
3300031549|Ga0318571_10253701All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei647Open in IMG/M
3300031561|Ga0318528_10059025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1955Open in IMG/M
3300031561|Ga0318528_10368219All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei771Open in IMG/M
3300031564|Ga0318573_10205688All Organisms → cellular organisms → Bacteria1044Open in IMG/M
3300031572|Ga0318515_10666667All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300031572|Ga0318515_10696961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. NAS80.1537Open in IMG/M
3300031573|Ga0310915_10100205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1956Open in IMG/M
3300031573|Ga0310915_10223666All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1320Open in IMG/M
3300031585|Ga0315534_1019872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3280Open in IMG/M
3300031585|Ga0315534_1046651All Organisms → cellular organisms → Bacteria → Proteobacteria1839Open in IMG/M
3300031652|Ga0315553_10119385All Organisms → cellular organisms → Bacteria → Proteobacteria1293Open in IMG/M
3300031679|Ga0318561_10322199All Organisms → cellular organisms → Bacteria846Open in IMG/M
3300031680|Ga0318574_10075308All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1830Open in IMG/M
3300031680|Ga0318574_10371591All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei834Open in IMG/M
3300031681|Ga0318572_10078222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1833Open in IMG/M
3300031681|Ga0318572_10089362All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1722Open in IMG/M
3300031681|Ga0318572_10813275All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei555Open in IMG/M
3300031708|Ga0310686_108600357All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661539Open in IMG/M
3300031712|Ga0265342_10214510All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1039Open in IMG/M
3300031718|Ga0307474_10264282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1320Open in IMG/M
3300031719|Ga0306917_10264756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1320Open in IMG/M
3300031723|Ga0318493_10038474All Organisms → cellular organisms → Bacteria2212Open in IMG/M
3300031723|Ga0318493_10643817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei592Open in IMG/M
3300031736|Ga0318501_10020905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2750Open in IMG/M
3300031744|Ga0306918_10415205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1049Open in IMG/M
3300031744|Ga0306918_10934023All Organisms → cellular organisms → Bacteria → Proteobacteria675Open in IMG/M
3300031747|Ga0318502_10659353All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei631Open in IMG/M
3300031748|Ga0318492_10555081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei611Open in IMG/M
3300031753|Ga0307477_10615426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium731Open in IMG/M
3300031765|Ga0318554_10053846All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2207Open in IMG/M
3300031768|Ga0318509_10045377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum2219Open in IMG/M
3300031768|Ga0318509_10390407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei778Open in IMG/M
3300031771|Ga0318546_11002804All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei587Open in IMG/M
3300031777|Ga0318543_10399133All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales616Open in IMG/M
3300031778|Ga0318498_10052101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1818Open in IMG/M
3300031779|Ga0318566_10291075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei808Open in IMG/M
3300031780|Ga0318508_1053094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1075Open in IMG/M
3300031780|Ga0318508_1111549All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium764Open in IMG/M
3300031781|Ga0318547_10232312All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1108Open in IMG/M
3300031793|Ga0318548_10095930All Organisms → cellular organisms → Bacteria1415Open in IMG/M
3300031794|Ga0318503_10013111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum2223Open in IMG/M
3300031794|Ga0318503_10139203All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei780Open in IMG/M
3300031795|Ga0318557_10036373All Organisms → cellular organisms → Bacteria2017Open in IMG/M
3300031797|Ga0318550_10019483All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2782Open in IMG/M
3300031797|Ga0318550_10044280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1976Open in IMG/M
3300031805|Ga0318497_10362576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei810Open in IMG/M
3300031820|Ga0307473_10834688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales660Open in IMG/M
3300031821|Ga0318567_10658916All Organisms → cellular organisms → Bacteria → Proteobacteria594Open in IMG/M
3300031832|Ga0318499_10159342All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales880Open in IMG/M
3300031833|Ga0310917_10625630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei730Open in IMG/M
3300031846|Ga0318512_10318266All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria775Open in IMG/M
3300031846|Ga0318512_10339205All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei750Open in IMG/M
3300031879|Ga0306919_10026975All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium3567Open in IMG/M
3300031879|Ga0306919_10109076All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1961Open in IMG/M
3300031879|Ga0306919_11361118All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → unclassified Hyphomicrobiales → Hyphomicrobiales bacterium536Open in IMG/M
3300031880|Ga0318544_10027386All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium daqingense1959Open in IMG/M
3300031880|Ga0318544_10096728All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1110Open in IMG/M
3300031880|Ga0318544_10150727All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei891Open in IMG/M
3300031890|Ga0306925_10348325All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium barranii → Bradyrhizobium barranii subsp. barranii1591Open in IMG/M
3300031890|Ga0306925_11292304All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei725Open in IMG/M
3300031890|Ga0306925_11806255All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300031890|Ga0306925_11924845All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei561Open in IMG/M
3300031890|Ga0306925_12013805All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium544Open in IMG/M
3300031896|Ga0318551_10062017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1914Open in IMG/M
3300031896|Ga0318551_10095019All Organisms → cellular organisms → Bacteria1579Open in IMG/M
3300031910|Ga0306923_10018391All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium7333Open in IMG/M
3300031910|Ga0306923_10144283All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2714Open in IMG/M
3300031910|Ga0306923_10279429All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1909Open in IMG/M
3300031910|Ga0306923_10981554All Organisms → cellular organisms → Bacteria919Open in IMG/M
3300031912|Ga0306921_11074623All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300031941|Ga0310912_10121467All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1946Open in IMG/M
3300031942|Ga0310916_10095144All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2383Open in IMG/M
3300031942|Ga0310916_10144334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1958Open in IMG/M
3300031942|Ga0310916_10715087All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300031942|Ga0310916_10802547All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei792Open in IMG/M
3300031942|Ga0310916_11617657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales526Open in IMG/M
3300031945|Ga0310913_10079323All Organisms → cellular organisms → Bacteria2190Open in IMG/M
3300031945|Ga0310913_10102594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1936Open in IMG/M
3300031945|Ga0310913_10315726All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1104Open in IMG/M
3300031946|Ga0310910_10617185All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei859Open in IMG/M
3300031947|Ga0310909_11197105Not Available614Open in IMG/M
3300031954|Ga0306926_10499189All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1495Open in IMG/M
3300031954|Ga0306926_10858078All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Caballeronia → Caballeronia calidae1090Open in IMG/M
3300031954|Ga0306926_10869837All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300031954|Ga0306926_11204640All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300031962|Ga0307479_10192564All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2007Open in IMG/M
3300031962|Ga0307479_10924921All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300031981|Ga0318531_10040125All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1956Open in IMG/M
3300031981|Ga0318531_10088375All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1355Open in IMG/M
3300032001|Ga0306922_10225297All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2013Open in IMG/M
3300032001|Ga0306922_11113606All Organisms → cellular organisms → Bacteria808Open in IMG/M
3300032009|Ga0318563_10211567All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 46611046Open in IMG/M
3300032009|Ga0318563_10401199All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei742Open in IMG/M
3300032012|Ga0310902_10197753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1177Open in IMG/M
3300032025|Ga0318507_10289017All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei712Open in IMG/M
3300032035|Ga0310911_10064274All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1944Open in IMG/M
3300032039|Ga0318559_10291401All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei757Open in IMG/M
3300032041|Ga0318549_10234940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei824Open in IMG/M
3300032041|Ga0318549_10348175All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium667Open in IMG/M
3300032044|Ga0318558_10024486All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2485Open in IMG/M
3300032044|Ga0318558_10352324All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei730Open in IMG/M
3300032044|Ga0318558_10372346All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei709Open in IMG/M
3300032051|Ga0318532_10179987All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei750Open in IMG/M
3300032051|Ga0318532_10314609All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales555Open in IMG/M
3300032052|Ga0318506_10034967All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum1952Open in IMG/M
3300032052|Ga0318506_10180084All Organisms → cellular organisms → Bacteria930Open in IMG/M
3300032052|Ga0318506_10357697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei648Open in IMG/M
3300032054|Ga0318570_10148708All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1047Open in IMG/M
3300032055|Ga0318575_10614824All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium550Open in IMG/M
3300032055|Ga0318575_10683164All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661519Open in IMG/M
3300032059|Ga0318533_10104108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1967Open in IMG/M
3300032059|Ga0318533_10156666Not Available1614Open in IMG/M
3300032059|Ga0318533_11173395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales562Open in IMG/M
3300032064|Ga0318510_10226409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei762Open in IMG/M
3300032066|Ga0318514_10033794All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2414Open in IMG/M
3300032076|Ga0306924_10051764All Organisms → cellular organisms → Bacteria → Proteobacteria4535Open in IMG/M
3300032076|Ga0306924_10252893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2023Open in IMG/M
3300032076|Ga0306924_10345315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1707Open in IMG/M
3300032076|Ga0306924_11235105All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei806Open in IMG/M
3300032076|Ga0306924_11725489All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661655Open in IMG/M
3300032080|Ga0326721_10042891All Organisms → Viruses → Predicted Viral1916Open in IMG/M
3300032090|Ga0318518_10338196All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei772Open in IMG/M
3300032094|Ga0318540_10039019All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2091Open in IMG/M
3300032094|Ga0318540_10141517Not Available1150Open in IMG/M
3300032160|Ga0311301_10204249All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3377Open in IMG/M
3300032160|Ga0311301_11523202All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium821Open in IMG/M
3300032205|Ga0307472_100100438All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1988Open in IMG/M
3300032205|Ga0307472_100553734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1004Open in IMG/M
3300032205|Ga0307472_100964054All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 4661795Open in IMG/M
3300032261|Ga0306920_100400336All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei2041Open in IMG/M
3300032261|Ga0306920_101141214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. STM 46611128Open in IMG/M
3300032261|Ga0306920_101608556All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium924Open in IMG/M
3300032261|Ga0306920_102419934All Organisms → cellular organisms → Bacteria724Open in IMG/M
3300032261|Ga0306920_103332427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria598Open in IMG/M
3300032955|Ga0335076_10080299All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3202Open in IMG/M
3300033550|Ga0247829_10801753All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales784Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil28.39%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.27%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.47%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil5.43%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil5.01%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.38%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.51%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.71%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.09%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland1.67%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.67%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.67%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.67%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.25%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.25%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.25%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.04%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.84%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.84%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.84%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.63%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.63%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.63%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.63%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.63%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.63%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.63%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.63%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.63%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.42%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.42%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.42%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.42%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.42%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.42%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.42%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.42%
Miscanthus RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere0.42%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.42%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.42%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.21%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.21%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.21%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.21%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.21%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.21%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.21%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.21%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.21%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.21%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.21%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.21%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.21%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.21%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere0.21%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.21%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.21%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.21%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.21%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.21%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.21%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.21%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.21%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2040502001Soil microbial communities from sample at FACE Site 2 North Carolina CO2+EnvironmentalOpen in IMG/M
2067725002Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2088090015Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000655Forest soil microbial communities from Amazon forest - 2010 replicate II A100EnvironmentalOpen in IMG/M
3300000681Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48EnvironmentalOpen in IMG/M
3300000690Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75EnvironmentalOpen in IMG/M
3300000705Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 55EnvironmentalOpen in IMG/M
3300000723Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72EnvironmentalOpen in IMG/M
3300000731Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34EnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300001137Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3EnvironmentalOpen in IMG/M
3300001154Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1EnvironmentalOpen in IMG/M
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300001383Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012EnvironmentalOpen in IMG/M
3300001396Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012EnvironmentalOpen in IMG/M
3300001397Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012EnvironmentalOpen in IMG/M
3300001407Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 shallow-092012EnvironmentalOpen in IMG/M
3300001412Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001625Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF014EnvironmentalOpen in IMG/M
3300001640Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010EnvironmentalOpen in IMG/M
3300001641Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004EnvironmentalOpen in IMG/M
3300001642Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF012EnvironmentalOpen in IMG/M
3300001648Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF008EnvironmentalOpen in IMG/M
3300001658Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF048EnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002459Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6Host-AssociatedOpen in IMG/M
3300002911Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cmEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004003Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Galinas_PWA_D1EnvironmentalOpen in IMG/M
3300005276Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5Host-AssociatedOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005340Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaGEnvironmentalOpen in IMG/M
3300005367Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaGHost-AssociatedOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005553Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144EnvironmentalOpen in IMG/M
3300005586Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005834Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2Host-AssociatedOpen in IMG/M
3300005980Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil leachate replicate DNA2013-203EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006041Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014EnvironmentalOpen in IMG/M
3300006050Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006358Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2Host-AssociatedOpen in IMG/M
3300006603Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006893Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaGEnvironmentalOpen in IMG/M
3300006950Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-oneEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010037Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25EnvironmentalOpen in IMG/M
3300010041Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104AEnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010101Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Met_20_5_24_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010859Boreal forest soil eukaryotic communities from Alaska, USA - C5-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012209Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012355Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaGEnvironmentalOpen in IMG/M
3300012358Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaGEnvironmentalOpen in IMG/M
3300012360Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012903Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S134-311R-1EnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012939Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t1i015EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014320Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D1EnvironmentalOpen in IMG/M
3300014657Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaGEnvironmentalOpen in IMG/M
3300015052Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015245Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017927Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_4EnvironmentalOpen in IMG/M
3300017933Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300018917Soil crust microbial communities from Colorado Plateau, Utah, USA - early-mid stage, 0 min after wetting v1EnvironmentalOpen in IMG/M
3300018918Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 0 min after wetting v1EnvironmentalOpen in IMG/M
3300019867Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020198Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015019 Mahale Deep Cast 65mEnvironmentalOpen in IMG/M
3300020220Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015018 Mahale Deep Cast 100mEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020581Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redoEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021168Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-MEnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022510Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-14-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022534Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1EnvironmentalOpen in IMG/M
3300022889Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S096-311B-4EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025604Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025899Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025981Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026223Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 2 DNA2013-190 (SPAdes)EnvironmentalOpen in IMG/M
3300026361Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-BEnvironmentalOpen in IMG/M
3300026886Soil and rhizosphere microbial communities from Laval, Canada - mgHAB (SPAdes)EnvironmentalOpen in IMG/M
3300027003Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 26 (SPAdes)EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027073Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027480Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027546Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027625Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027635Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027812Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027846Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028778Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142EnvironmentalOpen in IMG/M
3300028786Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EMHost-AssociatedOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028792Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_SEnvironmentalOpen in IMG/M
3300028799Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028880Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_181EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030520III_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300030743Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada VCO Co-assemblyEnvironmentalOpen in IMG/M
3300030844Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030969Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031095Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_158 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031100Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_151 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031184Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_SEnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031545Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26EnvironmentalOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031585Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1602-40EnvironmentalOpen in IMG/M
3300031652Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-40EnvironmentalOpen in IMG/M
3300031679Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031753Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031771Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031780Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031794Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f23EnvironmentalOpen in IMG/M
3300031795Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031879Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2)EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031947Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000HEnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032012Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3EnvironmentalOpen in IMG/M
3300032025Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f20EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032044Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20EnvironmentalOpen in IMG/M
3300032051Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032055Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032076Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2)EnvironmentalOpen in IMG/M
3300032080Soil microbial communities from Southern Great Plains, Lamont, Oklahoma, United States - SGP_1_2016EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032094Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FACENCE_38058602040502001SoilTVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS
GPICC_012279602067725002SoilLLLAVRPEGADHQWRKIPPGELSIDPVADERLVRATASAEAS
GPICI_029774602088090015SoilRPEGADHQWRKIPPGELSIDPVADERLVRATASAEAS
A5_c1_018036702124908044SoilNTSMMLARVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS
A5_c1_005739202124908044SoilPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS
F62_004172802170459010Grass SoilMSPEVAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAWVGAS
FG2_081251402189573004Grass SoilLPKGFPRCRLLAVRPEGANHQWRKIPPGELSIDPVAKERLGWVTGRA
AP72_2010_repI_A10DRAFT_100465413300000651Forest SoilLLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS*
AP72_2010_repI_A10DRAFT_102521413300000651Forest SoilVMAVRPEGANHQWRKIPHGELSIDPVADERLVRVTAWVGAS*
AF_2010_repII_A100DRAFT_100841913300000655Forest SoilASMSGLPVRPEGANHQWRKIPSGKLSIGPVADERLGRATGRVGAX*
JGI12370J11904_10049613300000681Tropical Forest SoilVMAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS*
JGI12582J11924_10137113300000690Tropical Forest SoilVAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS*
JGI12455J11871_10238613300000705Tropical Forest SoilMAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS*
JGI12372J11909_10363613300000723Tropical Forest SoilLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS*
JGI12381J11899_101011213300000731Tropical Forest SoilCCNALGPEMAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS*
AF_2010_repII_A001DRAFT_1006056523300000793Forest SoilMSLVVAVRPEGAHHQWGRIPPGELSIDPVADERLVRATARVGAS*
JGI12637J13337_101644123300001137Forest SoilLELAVRPEGAKHQWRRVPPRELSIDLVADERFGRVTGRAGAS*
JGI12636J13339_100587413300001154Forest SoilLAVRPEGANHQWRRVPPRELSIDLVADERLGRVTGRAGAS*
JGI12269J14319_1003839413300001356Peatlands SoilAVRPEGANHLWRRVPPGELSIDPVADERLIWVTG*
JGI20194J14741_100358513300001383Arctic Peat SoilPDGAYYQWRKIPPRELSIDLVADERLVWATERAEAS*
JGI20175J14863_100178313300001396Arctic Peat SoilPSPTYSVRPDGAYYQWRKIPPRELSIDLVADERLVWATERAEAS*
JGI20177J14857_103198413300001397Arctic Peat SoilSPDYSVRPDGAYYQRRKIPPRELSIDLVADERLVWATERAEAS*
JGI20192J14887_101304913300001407Arctic Peat SoilYSVRPDGAYYQWRKIPPRELSIDLVADERLVWATERAEAS*
JGI20192J14887_101473123300001407Arctic Peat SoilMQARVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS*
JGI20173J14856_100818923300001412Arctic Peat SoilASPTYSVRPDGAYYQWRKIPPRELSIDLVADERLVWATERAEAS*
JGI12635J15846_1046047713300001593Forest SoilLLAVRPEGANYQWRKIPPRELSIVLVADERLGRVTGWAGAS*
JGI12635J15846_1058379923300001593Forest SoilGLELAVRPEGAKHQWRRVPPRELSIDLVADERFGRVTGRAGAS*
JGI20248J16329_1000213300001625Forest SoilRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
JGI20244J16305_10004733300001640Forest SoilVAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
JGI20238J16299_10195813300001641Forest SoilSLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
JGI20246J16307_10000943300001642Forest SoilMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
JGI20242J16303_10033013300001648Forest SoilFVAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
JGI20282J16327_10101013300001658Forest SoilVAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAWVGAS*
C688J18823_1054438113300001686SoilAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS*
JGI24751J29686_1005739413300002459Corn, Switchgrass And Miscanthus RhizosphereSPTASMSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS*
JGI25390J43892_1006922123300002911Grasslands SoilLAVRPEGANHQWRKNPHGELSIDPVADERLVRVTARAGAS*
JGIcombinedJ51221_1024748613300003505Forest SoilLAVRPEGANYLWRKNPPRELSIDLVADERLGWVTGRAGAS*
Ga0055445_1018667033300004003Natural And Restored WetlandsAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS*
Ga0065717_101129813300005276Arabidopsis RhizosphereLVLAVVPTASMSLLAVRPEGADHQWRKIPPGELSIDPEADEQLVRVTAWAEAS*
Ga0070670_10000873313300005331Switchgrass RhizosphereAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS*
Ga0070670_10012782813300005331Switchgrass RhizosphereMSAIGMRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEA
Ga0066388_10108649733300005332Tropical Forest SoilMSIECPLMAVRLEGANHLWRRNPPREMSISLVADKRFGRETGRAGAS*
Ga0066388_10247900913300005332Tropical Forest SoilLAVRLEGANHQWRKIPPGELSINPEADERLGRVTGWAGAS*
Ga0066388_10377109723300005332Tropical Forest SoilMAVRPEGAHHQWRRIPPGELSIDPVADERLVRATARVGAS
Ga0070689_10009317723300005340Switchgrass RhizosphereMSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS*
Ga0070689_10010461653300005340Switchgrass RhizosphereLLAVRPEGADYQWRKIPPGELSIDPEADERLGRVTGRAEAS*
Ga0070667_10198098223300005367Switchgrass RhizosphereAGFARSEIGFVSVRPEGVCHQRRRVPPRELSIDLVANERLGRATGRAEAS*
Ga0070714_10119588523300005435Agricultural SoilLAVRPEGADHQWRKNPPGELSIDPVADERLVRATAWVGAS*
Ga0070713_10121525623300005436Corn, Switchgrass And Miscanthus RhizosphereLAVRPEGANHQWRKIPSRELSIELEADEQLGWATGRAGAS*
Ga0070678_10006464143300005456Miscanthus RhizosphereLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS*
Ga0070665_10118574013300005548Switchgrass RhizosphereMSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAW
Ga0066695_1036980713300005553SoilAVRPEGADHQWRKIPPRELSIDLVADERLGWVTGRAEAS*
Ga0066691_1048507623300005586SoilFLAVRPEGANHQWRKNPPGELSIDPVADERLMRVTAWVGAS*
Ga0066691_1062350013300005586SoilAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS*
Ga0066905_10021254533300005713Tropical Forest SoilMAERPEGADYQWRKIPLGELSIDPVADERLVRVTARTGAS
Ga0066905_10035960913300005713Tropical Forest SoilMSPEVAVRPEGADHQWRKNPPRELSIDLVADERLGRATGRLEPR
Ga0066905_10080294133300005713Tropical Forest SoilLLRRICRLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0066905_10116522023300005713Tropical Forest SoilMAVRPEGADYQWRKIPLGELSIDPVADERLVRATARAGAS
Ga0066905_10117145413300005713Tropical Forest SoilAVRPEGANHQWRKNPPRELSIGLEADERLGRVTGRAGAS*
Ga0066905_10179552813300005713Tropical Forest SoilAVRPEGANHQWRKNPPGELSIDPVADERLVRVTVRVGAS*
Ga0066905_10228444113300005713Tropical Forest SoilMSPVLAERPEGADYQWRKIPLGELSIDPVADERLVRATARA
Ga0066903_10176835013300005764Tropical Forest SoilVAVRPEGANHQWRKNPPGELSIDPVADERLMRVTAWVGAS*
Ga0066903_10230273833300005764Tropical Forest SoilLKGIHSKECLLLVERPEGADYQWRKIPLGELSIDPVADERLVRATA
Ga0066903_10328250113300005764Tropical Forest SoilVRPEGADHQWRKNPPRELSIDLVADERLGRATGRLEPR
Ga0066903_10349968713300005764Tropical Forest SoilLAVRPEGANHQWRRNPPRELSIDLVADERLGRVTGRA
Ga0066903_10379101813300005764Tropical Forest SoilVRPEGANHQWRRNPPGELSINPVADERLAWATARVGAS
Ga0066903_10603709013300005764Tropical Forest SoilMAVRPEGANHQWRKNPPGELSINPVADERLVWATARVGAS
Ga0066903_10744082513300005764Tropical Forest SoilMAVRPEGADHQWRKIPPGELSIDPEADERLSRVTGRAGAS
Ga0068851_1082713413300005834Corn RhizosphereVRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS*
Ga0066798_1009341433300005980SoilFVSVRPEGACHQRRRVPPRELSIDLVANERLGRVTGRAEAS*
Ga0070717_1069454023300006028Corn, Switchgrass And Miscanthus RhizosphereRPEGADHQWRKNPPGELSIDPVADERLVRATAWVGAS*
Ga0075023_10001512523300006041WatershedsAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
Ga0075028_10062116813300006050WatershedsVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
Ga0075019_1037102643300006086WatershedsAVRPEGANHQWRKIPPRQLSIDLEADERLSRVTGRAGAS*
Ga0075015_10033735313300006102WatershedsLMAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS*
Ga0075014_10042214413300006174WatershedsVEEIGFVSVRPEGACHQRRRVPPRELSIDLVADERLGR
Ga0070765_10121879613300006176SoilMLQRRSRVLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTG
Ga0070765_10164020523300006176SoilLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
Ga0075021_1007377223300006354WatershedsLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS*
Ga0068871_10047169713300006358Miscanthus RhizosphereARVRLEGACHLWRKIPSRELSIELEADEQLGWATGRAGAS*
Ga0068871_10105204823300006358Miscanthus RhizosphereARVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS*
Ga0074064_1176178713300006603SoilVRPEGACHQWRKIPLRELSIDLVADERDGWATGRCEAS*
Ga0066659_1080749023300006797SoilRLMAVRPEGANHQWRKIPPRELSIDLEADGRFGRATGRAEAS*
Ga0073928_1018786513300006893Iron-Sulfur Acid SpringLAVRPEGANHLWRKIPPGELSIDPVADERLGWVTGR
Ga0075524_1039653513300006950Arctic Peat SoilEGACHLWRKIPFRQLSIDLEADERFGWVTGRAEAS*
Ga0066710_10191048813300009012Grasslands SoilAVRPEGANHQWRKNPHGELSIDPVADERLVRVTARAGAS
Ga0099829_1064998713300009038Vadose Zone SoilLYFVRPEGVCHQWRKEPPGELSIDPVADERLGRVTGRAEAS*
Ga0099828_1006752413300009089Vadose Zone SoilMLLCMSLLVAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS*
Ga0066709_10169748613300009137Grasslands SoilLAVRPEGANHQWRKIPPRELSIDLEADERFGRATGRAGAS*
Ga0099792_1014753523300009143Vadose Zone SoilMPVEVLSPECLLMAVRPEGANHQWRKIPPRELSIDLVADERLGRV
Ga0105242_1282473413300009176Miscanthus RhizosphereGADHQWRKIPPGELSIDPVADERLVRATASAEAS*
Ga0105248_1040205523300009177Switchgrass RhizosphereMSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVT
Ga0116216_1093070023300009698Peatlands SoilMHIECRLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGA
Ga0126307_1011144243300009789Serpentine SoilAVRLDGANYLWRKNPPRELSIDLVADERLVRVTGRAGAS*
Ga0116219_1005446513300009824Peatlands SoilGVRPEGAYHLWREVPPGELSIDPVADERLGWATGRVEAS*
Ga0116219_1013956143300009824Peatlands SoilVIGFVLVRPEGACHQRRRVPPRKLSIDLVADERLGRATGRAE
Ga0116223_1054098413300009839Peatlands SoilHRIAKICPVMAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS*
Ga0126304_1017475413300010037Serpentine SoilGADHQWRKIPPGELSIDPVADERLGRVTGRAGAS*
Ga0126312_1080737913300010041Serpentine SoilMAVGPEGADHQWRKIPPGELSIDPVADERLGRATGRAGAS
Ga0126311_1023567223300010045Serpentine SoilVCPHTLRPVLTPDFPVRPDGAYHQWRKVPPRELSIDLVADERPGR
Ga0126382_1044252613300010047Tropical Forest SoilMAERPEGADYQWRKIPLGELSIDPVADERLVRATARA
Ga0126382_1115853413300010047Tropical Forest SoilMAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAG
Ga0127481_112771323300010101Grasslands SoilRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS*
Ga0126319_127934313300010147SoilPEGANHQWRKIPPGELSIDPVADERLGRATARVGAS*
Ga0127503_1027716913300010154SoilPELAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAWVGAS*
Ga0074045_1021397733300010341Bog Forest SoilMFFVCSVRSEGAYHQWRKILPRELSIDLVADERSGWVTGR
Ga0126372_1234443123300010360Tropical Forest SoilPLMAVRLEGANHLWRRNPPREMSISLVADKRFGRETGRAGAS*
Ga0126377_1013624543300010362Tropical Forest SoilMAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTG
Ga0126377_1030130113300010362Tropical Forest SoilMLHCICRFLAVRPEGADHQWRKNPPRELSIDLVADERLGRATVGWP
Ga0126379_1251300223300010366Tropical Forest SoilVAVRPEGANHQWRKNPPGELSIDPVADERLVRATGWVGAS*
Ga0126379_1296627933300010366Tropical Forest SoilMAERPEGADYQWRKIPLGELSIDPVADERLVRVTA
Ga0126379_1316482023300010366Tropical Forest SoilVRPEGANHQWRRNPPGELSIDPVADERLVRVTAWAGAS*
Ga0126379_1380753523300010366Tropical Forest SoilLLRCMSPLLAVRPEGVNHLWRKKPRKELSIGLEADERLGRATGRAGAS*
Ga0136449_10293017713300010379Peatlands SoilMAVRPEGANHLWRRVPPRELSIDLVADERLGRVTGRAGAS
Ga0134126_1048022713300010396Terrestrial SoilGANHQWRKIPPRELSIDLEADERLGRATGRAGAS*
Ga0134124_1057233813300010397Terrestrial SoilMAVRLEGANHQWRKIPSGELSIDPEADERLGWATGRVEAS*
Ga0126352_117585413300010859Boreal Forest SoilEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS*
Ga0124844_106312723300010868Tropical Forest SoilAVRPDGANHQWRKNPPGELSIDPVADERLVRVTVRVGAS*
Ga0137391_1050116023300011270Vadose Zone SoilYFVRPEGVCHQWRKEPPGELSIDPVADERLGRVTGRAEAS*
Ga0137383_1112497523300012199Vadose Zone SoilAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAEAS*
Ga0137399_1079267513300012203Vadose Zone SoilGADHQWRKIPPRELSIDLVADERFGRVTGRAGAS*
Ga0137381_1090776123300012207Vadose Zone SoilPEGADHQSRRIPAGELSIDPVADEWLGRVTGRAGAS*
Ga0137379_1032450623300012209Vadose Zone SoilEGADHQWRKIPPRELSIDLVADERLGRVTGRAEAS*
Ga0137379_1063724433300012209Vadose Zone SoilMECRLMAVRPEGADHQWRRIPPGELSIDPVADERLVRAT
Ga0137377_1102838813300012211Vadose Zone SoilLTIDYTREIGFVSVRPEGACHQRRRVPPRELSIDLVADERFGR
Ga0137369_1037084633300012355Vadose Zone SoilMSPELAVRPEGANHQWRKIPPGELSIDPVADEQLGRAT
Ga0137368_1045866823300012358Vadose Zone SoilVRCMSPELAVRPEGANHQWRKNPPRELSIDLVADERLVRVT
Ga0137368_1065990613300012358Vadose Zone SoilMSPLLAVRPEGANHQWRKIPPGELSIDPVADEQLGRATARAGA
Ga0137375_1050942613300012360Vadose Zone SoilVVAANIRAMSVMAVRPEGADHQWRKIPPRELSIDLVADERLGR
Ga0137390_1191951813300012363Vadose Zone SoilMSPVLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS
Ga0150984_10804768213300012469Avena Fatua RhizosphereSRLCLFLAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS*
Ga0150984_11063049823300012469Avena Fatua RhizosphereVAAPAGVPASRLCLFLAVRPEGADHQWRKIPPRELSIDLVADERLGRVT
Ga0157289_1019077713300012903SoilVAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS*
Ga0137394_1090037523300012922Vadose Zone SoilMAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS*
Ga0137394_1150930113300012922Vadose Zone SoilRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGAS*
Ga0137359_1155737333300012923Vadose Zone SoilMSELAVRPEGANHQWRKIPPRELSIDLVADERLGRVT
Ga0162650_10000060133300012939SoilAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS*
Ga0126369_1122336813300012971Tropical Forest SoilGAHHQWRRIPPGELSIDPIADERLVRATARVGAS*
Ga0163162_1019170713300013306Switchgrass RhizosphereMAVRLEGANHQWRKVPSGELSIDPEADERLLRVTARAI
Ga0181518_1003460433300014156BogMAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS*
Ga0181526_1009865623300014200BogSGVRPEGAYHLWREVPPGELSIDPVADERLGWATGWVEAS*
Ga0075342_113842713300014320Natural And Restored WetlandsSNPNYSVRPDGAYHQWRKIPPRELSIDLVADERFCRATGRAGAS*
Ga0181522_1041888423300014657BogLAVRPEGANYQWRKIPPRELSIDLEADERLGRVTGWVGAS*
Ga0137411_102126313300015052Vadose Zone SoilPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS*
Ga0137411_120860783300015052Vadose Zone SoilAERTRLLLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS*
Ga0137412_1068144313300015242Vadose Zone SoilLFYPVRPEGANHQWRKIPSGKLSIGPVADERLGRATGRVGAS*
Ga0137409_1003027643300015245Vadose Zone SoilMCSQRPVMAVRPEGANHLWRRNPPRELSIDLVADGRFGRVTGRAGAS*
Ga0132256_10013710333300015372Arabidopsis RhizosphereMAILIVRPEGANHQWRKIPPGELSIDPVADERLGRVTGRAGAS*
Ga0132255_10028590733300015374Arabidopsis RhizosphereMSAGCRRLAVRPEGADHQWRKIPPGELSIDPEADEQLVRVTAWAEAS*
Ga0182036_1015788623300016270SoilMARRQLLAVRPEGANRQWRRNPPRELLIDLVADERLGRVTGRAGAS
Ga0182036_1058192823300016270SoilMAVRPEGANHQWRKNPPGELSIDPVADERLVRVTA
Ga0182041_1072738713300016294SoilVTGLFPVLAVRPEGANHQWRKNPPGELSIDPVADER
Ga0182041_1130634723300016294SoilMAVRPEGANHQWRRNPPRELSIDLVADERLGRVTG
Ga0182041_1201625513300016294SoilVRLEGACHQRRRIPPRELSIDLVADERLGRVTGRAEAS
Ga0182033_1099516513300016319SoilMAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS
Ga0182032_1098444523300016357SoilLMAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS
Ga0182034_1012569043300016371SoilLAVRPEGANHQWRKNPPRELSIDLVADERLDRVTGRAEAS
Ga0182040_1041580313300016387SoilMAVRREGANHQWRKNPHGELSIDPVADERLVRVTAWF
Ga0182040_1069157923300016387SoilMAVRPEGANHQWRRNPPRELSIDLVADERLGRVTGRAGAS
Ga0182037_1053306543300016404SoilAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS
Ga0182037_1127529513300016404SoilMAVRLEGANHQWRKKPHGELSIDPVADERLVRVTAWVGA
Ga0182037_1200932513300016404SoilMSLVVAVRPEGAHHQWGRIPPGELSIDPVADERLVRATARVGA
Ga0182039_1080522133300016422SoilRPEGANHQWRKNPPGELSIDPVADERLVRVTARVGAS
Ga0182039_1093108213300016422SoilVAVRPEGANHRWGKNPPGELSIDPVADERLMRVTAWAGANS
Ga0182039_1128052313300016422SoilMSPVLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGASRQRS
Ga0182039_1133797723300016422SoilMAVRPEGVNYQWRRNPPRKLSIDLVADERLGRVTGRAG
Ga0182039_1147297413300016422SoilEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0182039_1158946313300016422SoilMAVRPEGANHQWRKIPHGELSIDPVADERLMRVTAW
Ga0182038_1018103833300016445SoilMAVRLEGANHQWRKKPHGELSIDPVADERLVRVTAWV
Ga0182038_1053771313300016445SoilLAVRPEGANHQWRKNPPGELSIDPVADERLMRVTAWAGAS
Ga0187802_1000109813300017822Freshwater SedimentVTRAECLLLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS
Ga0187802_1005372313300017822Freshwater SedimentMPKCLLMAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRA
Ga0187802_1022888913300017822Freshwater SedimentVRPEGANYQWRKIPPRKLSIDLEADGRLGRVTGRA
Ga0187802_1033493523300017822Freshwater SedimentVLAVRPEGANHQWRKIPSGELSIDPEADERLGRVT
Ga0187856_116690913300017925PeatlandEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS
Ga0187807_102122633300017926Freshwater SedimentLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGAS
Ga0187824_1006936633300017927Freshwater SedimentCWNRKFGIGFILVRLEGACHQRRRVPPRELSIDLVADERLGRVTGRAEAS
Ga0187801_1017352613300017933Freshwater SedimentLAVRPEGANHQWRKIPPRELSIDLEADERLDRVTG
Ga0187801_1044277523300017933Freshwater SedimentMAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGR
Ga0187879_1001389853300017946PeatlandMAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS
Ga0187817_1006756223300017955Freshwater SedimentAVRPEGANHQWRKIPSGELSIDPEADERLGRVTDWAGAS
Ga0187817_1070729023300017955Freshwater SedimentMGRRCRLLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAG
Ga0187781_1147260423300017972Tropical PeatlandAVRPEGANYLWRKNPPRELSIDLVADERLYRVTGRAGAS
Ga0187816_1047443723300017995Freshwater SedimentMPKCLLMAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRAGA
Ga0187816_1048690823300017995Freshwater SedimentMGRRCRLLAVRPEGANHQWRKIPPRELSIDLVADERLGRVANGAA
Ga0187804_1059429513300018006Freshwater SedimentMSALAVRPEGANHQWRKIPPRELSIDLVADERLGRVT
Ga0187882_132129213300018021PeatlandVHPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS
Ga0187889_1016711823300018023PeatlandFVFVHVVMVSGVHPEGAYHLWREVPPGELSIDPVADERLGWATGRVEAS
Ga0184605_1052884713300018027Groundwater SedimentMAVRPEGADHQWRKIPLGELSIDPVADERLVRATA
Ga0187869_1031260913300018030PeatlandVGCCASKETHRIAKICPVMAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS
Ga0187862_1055077913300018040PeatlandEGANHQWRKIPPRELSIDLEADERLDRVTGRAGAS
Ga0187862_1062729123300018040PeatlandAVRPEGANHQWRKIPPRELSIDLEADERLDRVTGWAGAS
Ga0187859_1002045713300018047PeatlandMAVRPEGANHQWRKIPPRELSIDLEADERLGWETGQVEAS
Ga0184638_103185813300018052Groundwater SedimentMSAHGSAPEGANHQWRKIPPGELSIDPVADERLVRATV
Ga0184619_1026067123300018061Groundwater SedimentAVRPEGANHQWRRNPPGELSIDPVADERLVWVTARVGAS
Ga0187784_1012038613300018062Tropical PeatlandRLEGAYHLWRKIPSRELSIDLEADERFGWATGRAEAS
Ga0066662_1154629923300018468Grasslands SoilAVRPEGADHQWRRIPLGELSIDPVVDERLGRVTERAGAS
Ga0193611_107789123300018917SoilPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS
Ga0193616_111595013300018918SoilLAQILICAVRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS
Ga0193704_100938013300019867SoilLLAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0193727_105240813300019886SoilVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0193728_111043813300019890SoilYRAHPRLYVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0193718_101714823300019999SoilAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0193731_111358513300020001SoilCRLLAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS
Ga0193755_102536933300020004SoilCRFLAVRPEGADHQWRKIPPGELSIDPVADERLVRATASAEAS
Ga0194120_1004608733300020198Freshwater LakeINPIYSVRPDGAQRLWREVPPRELSVDLVADERLDRETGRAEAS
Ga0194119_1027572323300020220Freshwater LakeRNLVPGSSPTYSVRPDGAQRLWREVPPRELSVDLVADERLDRETGRAEAS
Ga0210407_1012209113300020579SoilDDRPVMAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS
Ga0210407_1087585523300020579SoilPSSANALVGQLMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210407_1125174523300020579SoilMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRA
Ga0210403_1010800713300020580SoilVPVMAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0210403_1014043013300020580SoilTRAGCLFLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210403_1052374923300020580SoilVRPEGANHQWRKIPPGELSIDPVADERLVRVTAWVGAS
Ga0210399_1004005953300020581SoilMRQNHKRLLLAVRPEGADHQWRKIPPRELSIDLVADERLG
Ga0210399_1036795213300020581SoilMSPFMAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAW
Ga0210395_1011661813300020582SoilLLLRYGSRVLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0210401_1018414313300020583SoilELRYIPVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS
Ga0210401_1030374813300020583SoilLFCPLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210401_1059773823300020583SoilMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210378_1003639513300021073Groundwater SedimentQVAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0210381_1001074613300021078Groundwater SedimentGRVGPELAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0210382_1003172723300021080Groundwater SedimentLAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0210380_1012911713300021082Groundwater SedimentMCLVLAVRPEGAITGGGIPPRELSIDLEADERSAG
Ga0210404_1004967733300021088SoilYYLAGPLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210406_1013658813300021168SoilMSLDLAVRPEGANHQWRKIPPGELSIDPVADERLVRVTAWVGAS
Ga0210406_1014701933300021168SoilISHFMYVLVVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0210406_1053581123300021168SoilMSPVMAVRPEGANHQWRKNPPGELSIDPVADEQLMRVTA
Ga0210400_1104505623300021170SoilLAVRPEGANHQWRRIPPRELSIDLEADERFARATGR
Ga0210405_1043902923300021171SoilHWICRQVAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210408_1012924113300021178SoilLLAVRPEGANHQWRKIPPGELSIDPEADERLGRVTGSMKRATRLA
Ga0210408_1020936513300021178SoilMAVRPEGANHQWRRNPPGELSIDPVADERLMRVTAW
Ga0210408_1071880213300021178SoilMAVRPEGADYQWRKIPPGDLSIDPVADERLVRVTARVGAS
Ga0210396_1017788613300021180SoilELFMSYLLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0210396_1025812713300021180SoilLMLAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS
Ga0193699_1023618713300021363SoilRILAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS
Ga0210393_1013619833300021401SoilPSPLLAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS
Ga0210397_1006931413300021403SoilFSGSQLLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0210397_1078989713300021403SoilLVFVSVRPEGACHQRRRVPPRELSIDLVADERLGRATARAEAS
Ga0210389_1126390113300021404SoilRLLMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210387_1054301923300021405SoilSRPLFCPLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210387_1098471813300021405SoilMAVRPEGANHQWRKIPPGELSIDPVVDERLGWVTGR
Ga0210383_1014867913300021407SoilMTSIRDECRLLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210394_1012491213300021420SoilMSFECLEMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210384_1016620133300021432SoilESECRLMAVRPEGANHQWRKIPPGELSIDPVADERLGWATGRAGAS
Ga0210384_1016719433300021432SoilQRVSLLLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0210392_1075701113300021475SoilLAAECLAMAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0210402_1017558033300021478SoilRSLNVFQLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0210410_1043444913300021479SoilMLAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRA
Ga0210410_1054509523300021479SoilGATAVCLMLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0210409_1077778613300021559SoilLHCMSLQMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAG
Ga0210409_1141462513300021559SoilPEGANHQWRKIPPGELLIDPVADERLVRVTAWVGAS
Ga0210409_1145363813300021559SoilMSQVVAVRPEGANHQWRRNPPGELSIDPVADERLM
Ga0210409_1152051413300021559SoilMLHRMSQQVAVRPEGANHQWRRIPPRELSIDLEAD
Ga0126371_1005917813300021560Tropical Forest SoilCPLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0126371_1015498443300021560Tropical Forest SoilRPEGADYQWRKIPLGELSIDPVADERLVRATARAGAS
Ga0242652_100078113300022510SoilAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0242658_123307623300022530SoilLAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0224452_101980213300022534Groundwater SedimentECLLMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0247785_101626923300022889SoilCRRLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS
Ga0228598_100790313300024227RhizosphereRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0209171_1018443913300025320Iron-Sulfur Acid SpringLLGRPPQPHLATACPLMAVRPEGANHLWRKIPPGELSIDPVADERLGWVTGRAGAS
Ga0209171_1037276013300025320Iron-Sulfur Acid SpringLAVRPEGANHLWRKIPPGELSIDPVADERLGWVTG
Ga0207930_101796413300025604Arctic Peat SoilPSPTYSVRPDGAYYQRRKIPPRELSIDLVADERLVWATERAEAS
Ga0207642_1050126813300025899Miscanthus RhizosphereARPRLYVRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS
Ga0207699_1146087213300025906Corn, Switchgrass And Miscanthus RhizosphereMSPFLAVRPEGADHQWRKNPPGELSIDPVGDERLGRAPEGLEP
Ga0207684_1019786613300025910Corn, Switchgrass And Miscanthus RhizosphereMAVRPEGANHLWRENPPRELSIDLVADERLGRVTGRA
Ga0207695_1109718533300025913Corn RhizosphereRLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS
Ga0207646_1048201313300025922Corn, Switchgrass And Miscanthus RhizospherePTLAVRPEGANHLWRKIPPGELSIDPVADERLGWVTGRAGAS
Ga0207681_1052760623300025923Switchgrass RhizosphereTQCRQVAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS
Ga0207709_1009548513300025935Miscanthus RhizosphereSERLEMAVRPEGADHQWRRIPPRELSIDLVADERSGRATGRAGAS
Ga0207670_1005493223300025936Switchgrass RhizosphereMSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS
Ga0207665_1088233123300025939Corn, Switchgrass And Miscanthus RhizosphereMALLTVRPEGANHQWRKIPPRELSIDPVADERLGRV
Ga0207640_1127141913300025981Corn RhizosphereSVRPEGANHQWRKISPGELSIASVADERLGRVTDLVEAS
Ga0207677_1003557733300026023Miscanthus RhizosphereLCQLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS
Ga0207702_1014982433300026078Corn RhizosphereVAVLLHCICRLLAVRPEGADHQWRENPPGELSIDPVADERLVRVTVRVGAS
Ga0209840_101256713300026223SoilRPDGAYHQWRKIPPRELSIDLVADERLVWATERAEAS
Ga0257176_100190313300026361SoilLLVAVRPEGANHLWRRNPPRELSIDLVADERLGRATGRAGAS
Ga0257176_105658023300026361SoilILDHVEDLAVRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGAS
Ga0207982_100041433300026886SoilMAFLLHCMSPVMAVRPEGANHQWRRNPPGELSIDPVADERLVWVTARVGAS
Ga0207722_100090113300027003Tropical Forest SoilLLAGLPAHIGFVLVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS
Ga0208365_100272223300027070Forest SoilVRPEGANYLWRKNPPRELSIDLVADERFGRVTGRAGAS
Ga0208366_100193713300027073Forest SoilGPRPLLAVRPEGANHQWRKIPPRELSIDLEADERFGRVTGRAGAS
Ga0209213_100883623300027383Forest SoilMSPELAVRPEGANHQWRKIPPRELSIDLVADERLGRVTG
Ga0208993_105472723300027480Forest SoilRVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS
Ga0208984_108479523300027546Forest SoilMSPVLAVRPEGANHQWRKIPPRELSIDLEADERLS
Ga0208044_113804513300027625Peatlands SoilVIGFVLVRPEGACHQRRRVPPRKLSIDLVADERLGRATGR
Ga0209625_104941413300027635Forest SoilMSPEVAVRPEGANHQWRKIPPGELSIDPVADERLMRVTAWVGAS
Ga0209217_100257413300027651Forest SoilMSPEVAVRPEGANYLWRTNPPRELSIDLVADERLGR
Ga0208696_109969213300027696Peatlands SoilPKECRLMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0209656_1012822913300027812Bog Forest SoilPVVAVRPEGANHQWRKNPPGELSIDPVADERLVRVAAWVGAS
Ga0209040_1028888433300027824Bog Forest SoilMSPLLAVRPEGANHQWRKNPPGELSIDPVADERLVRV
Ga0209180_1040588723300027846Vadose Zone SoilEGVCHQWRKEPPGELSIDPVADERLGRVTGRAEAS
Ga0209180_1053168413300027846Vadose Zone SoilFDLKPNAGPVLAVRPEGANHQWRKIPPGELSIDPVADERLVRATARVGAS
Ga0209180_1077585223300027846Vadose Zone SoilMAVRPEGADHQWRENPPRELSIDLVADERLGRVTG
Ga0209169_1016812313300027879SoilMAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0209590_1091195913300027882Vadose Zone SoilMAVRPEGANHQWRKIPPRELSIDLVADERLGRVTGRVGAS
Ga0209067_1039384213300027898WatershedsLQLAVRPEGANHQWRKIPPRQLSIDLEADERLSRVTGRAGAS
Ga0209583_1002408313300027910WatershedsIMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0209526_1010503213300028047Forest SoilMSLEVAVRPEGANHQWRRNPPGELSIDPVADERLMRV
Ga0209526_1042110313300028047Forest SoilMSPELAVRPEGANHQWRRNPPGELSIDPVADERLMR
Ga0209526_1050691033300028047Forest SoilMSPILAVRPEGANHQWRRNPPGELSIDPVADERLMR
Ga0268266_1091240113300028379Switchgrass RhizosphereQSRLCQLLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS
Ga0268266_1108556813300028379Switchgrass RhizosphereMSLLAVRPEGADYQWRKIPPGELSIDPEADERLVRV
Ga0307321_104066413300028704SoilRSRECPFLAVRPEGADHQWRKIPPGELSIDPVADERLVRATASAEAS
Ga0307322_1001010033300028710SoilALLECLDLAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0307309_1000798723300028714SoilLMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0307288_1007085513300028778SoilKCPQVAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0307517_1065374613300028786EctomycorrhizaGIDQAPLSRLAVRPEGANHQWRKIPLGELSIDPVADERLGRVTGRAGAS
Ga0307290_1002566543300028791SoilVKVRLEGACHLWRKIPSRQLSIDLEADERFGWVTGRAEAS
Ga0307504_1001208113300028792SoilAYRGGECLFMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0307284_1002459033300028799SoilLSGCPDMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0307503_1030249413300028802SoilRPEGANHQWRKIPSRELSIELEADEQLGWATGRAGAS
Ga0307296_1006030713300028819SoilSPVLAVRPEGANHQWRKIPPGELSIDPVADERLGRATARAGAS
Ga0307310_1002341433300028824SoilLRECPFVAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0307289_1017854913300028875SoilHAGVGTESICQVLAVRPEGADHQWRKIPPGELSIDPEADERLVRATASAEAS
Ga0307289_1022560313300028875SoilTAKSAMAVRPEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS
Ga0307289_1042990623300028875SoilMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASA
Ga0307278_1004811813300028878SoilEGANHQWRKIPPGELSIDPVADERLGRATARAGAS
Ga0307300_1000393563300028880SoilLECLDLAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0307304_1002744913300028885SoilIDGCPAMAVRPEGADHQWRKIPLGELSIDPVADERLVRATASAEAS
Ga0311329_1016511313300029907BogVRPDGAHHQWRKIPPRKVSIDLVADERFSRVTGWAGAS
Ga0311369_1015472833300029910PalsaPFMAVRPEGAKHQWRRVPPRELSIDLVADERFGRVTGRAGAS
Ga0311369_1066564613300029910PalsaCLLMAVRPEGANYQWRKIPPRELSIDLEADERLGRVTGWVGAS
Ga0311340_1019278923300029943PalsaLAVRPEGANYQWRKIPPRELSIDLVADERLDRVTGWAGAS
Ga0311338_1011611413300030007PalsaLSWRPLSFQAQRRLLAVRPEGANYQWRKIPPRELSIDLVADERLDRVTGWAGAS
Ga0311372_1193176423300030520PalsaLAVRPEGANYQWRKIPPRELSIDLEADERLGRVTG
Ga0265461_1007732523300030743SoilVAVRPEGANHQWRRIPPRELSIDLEADERFGRVTGRAGAS
Ga0075377_1176165313300030844SoilMAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS
Ga0311366_1110050413300030943FenLTVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS
Ga0075394_1202075923300030969SoilLAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0308183_103876613300030988SoilEGANHQWRKISPGELSIASVADERLGRVTDLVEAS
Ga0308184_102747123300031095SoilPVVAVRPEGANHQWRKIPPGELSIDPVADERFGRVTGRAGAS
Ga0308180_102169613300031100SoilLMAVRPEGADHQWRKIPPRELSIDLEADERLGRVTGRAGAS
Ga0307499_1006854313300031184SoilLTKGRVLTVRPEGANHQWRKIPPGELSIDPVADERLGRVTGRAGAS
Ga0307500_1021809013300031198SoilEGADHQWRKIPPRELSIDLVADERLGRVTGRAGAS
Ga0265325_1005326413300031241RhizosphereELRSTRARVRLDGAYHQWRKNPPGELSIDLVADERFDRVTGWAEAS
Ga0265331_1014669813300031250RhizosphereAARVRLDGAYHQWRKNPPGELSIDLVADERFDRVTGWAEAS
Ga0170818_10481581513300031474Forest SoilMAVRPEGANHQWRKIPPGELSIDPEADERLGRVTGRAGAS
Ga0302326_1012763113300031525PalsaQAQRRLLAVRPEGANYQWRKIPPRELSIDLVADERLDRVTGWAGAS
Ga0318541_1005553813300031545SoilVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRAGAS
Ga0318571_1014268623300031549SoilQCICPLMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318571_1014397613300031549SoilVRCLVVAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0318571_1025370133300031549SoilPEGADHQWRKIPPGELSIDPEADERLVRATARVGAS
Ga0318528_1005902513300031561SoilAVMSLLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS
Ga0318528_1036821913300031561SoilLMAERPEGAHHQWRKSPPGELSIDPVADERLVRVTARAGAS
Ga0318573_1020568823300031564SoilMAVRPEGANHQWRRNPPRELSIDLVADERPGRVTG
Ga0318515_1066666723300031572SoilWHGFAALHGPVMAVRLEGANHQWRKKPHGELSIDPVADERLVRVTAWVGAS
Ga0318515_1069696113300031572SoilVRPEGANHQWRRNPPRELSIDLVADERLGRVTGRAGAS
Ga0310915_1010020513300031573SoilPKPSARDGPLLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS
Ga0310915_1022366613300031573SoilIALCPLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0315534_101987213300031585Salt Marsh SedimentMSPKVAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGAS
Ga0315534_104665123300031585Salt Marsh SedimentMAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRAGANANLNA
Ga0315553_1011938513300031652Salt Marsh SedimentMAVRPEGANHQWRKIPPRELSIDLEADERLGRVTGRA
Ga0318561_1032219923300031679SoilMAVRPEGANHQWRKNPPGKLSIDPVADERLVWATARVG
Ga0318574_1007530813300031680SoilRQLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0318574_1037159123300031680SoilRPGEKEFRAAIPLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318572_1007822253300031681SoilAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRAGAS
Ga0318572_1008936223300031681SoilLLHCICRLLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0318572_1081327523300031681SoilLMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0310686_10860035713300031708SoilMSFMAVRPEGANHQWRKIPPGELSIDPVANERLGW
Ga0265342_1021451013300031712RhizosphereTAAKVRLDGAYHQWRKNPPGELSIDLVADERFDRVTGWAEAS
Ga0307474_1026428223300031718Hardwood Forest SoilPEGANHQWRKIPPGESSIDPVANERLGWVTGRAGAS
Ga0306917_1026475613300031719SoilEARCPLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0318493_1003847413300031723SoilGPEVAVRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGAS
Ga0318493_1064381723300031723SoilLLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS
Ga0318501_1002090563300031736SoilMAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRGRCLVTRVAVGG
Ga0306918_1041520523300031744SoilRCRSLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS
Ga0306918_1093402323300031744SoilMAVRPEGANHQWRRNPPRELSIDLVADERLGRVTGR
Ga0318502_1065935323300031747SoilLRCVSPVMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318492_1055508113300031748SoilYRLMAVRLEGANHQWRKIPSGELSIDPEADERLSRVTGWAGAS
Ga0307477_1061542623300031753Hardwood Forest SoilMSAASESLLVAVRPEGANYLWRKNPPRELSIDLVADERLVRVTG
Ga0318554_1005384613300031765SoilLLHCICRLMAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0318509_1004537713300031768SoilIHKLVGRLPHLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0318509_1039040733300031768SoilSFHDQCPVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318546_1100280413300031771SoilLERQLLAVRLEGANHQWRKIPPGELSIDPEADERLGRVTGWAGAS
Ga0318543_1039913323300031777SoilVRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGA
Ga0318498_1005210113300031778SoilLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0318566_1029107513300031779SoilSPLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318508_105309413300031780SoilSPELAVRPEGADYQWRKIPLGELSIDPVADERLVRATARAGAS
Ga0318508_111154923300031780SoilPLLAVRPEGANHQWRRDPPRELSIDLVADERLVRVTGRAGAS
Ga0318547_1023231213300031781SoilIKEFGFVLVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS
Ga0318548_1009593043300031793SoilSLMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318503_1001311113300031794SoilLLHCICRLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0318503_1013920333300031794SoilMRVCQFLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0318557_1003637323300031795SoilMLGTTMALSNSRELAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0318550_1001948333300031797SoilGLELAVRPEGANHQWRKNPPGELSIDPVADERLVRGTTWVGAS
Ga0318550_1004428023300031797SoilLLLHCTSPELAVRPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0318497_1036257623300031805SoilAAIPLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0307473_1083468813300031820Hardwood Forest SoilFDVRPEGADHQWRKEPSGELSINPAADERLGRATGWAEAS
Ga0318567_1065891623300031821SoilMAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRGRCLVTRVA
Ga0318499_1015934223300031832SoilVVAVRPEGAHHQWGRIPPGELSIDPVADERLVRATARVGAS
Ga0310917_1062563013300031833SoilRFLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318512_1031826633300031846SoilMAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGA
Ga0318512_1033920513300031846SoilFLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0306919_1002697543300031879SoilACRLLAVRPEGANHLWRKNPPRELSIDLVADERLDRVTGRAGAS
Ga0306919_1010907623300031879SoilDLDKIGFVLVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS
Ga0306919_1136111813300031879SoilLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVGAS
Ga0318544_1002738613300031880SoilSLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS
Ga0318544_1009672813300031880SoilLLAVRPEGAHHQWGRIPPGELSIDPVADERLVGATARVGAS
Ga0318544_1015072723300031880SoilHCMSPLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0306925_1034832513300031890SoilMAVRPEGADHQWRKNPPGELSIDPVADERLVRVTARA
Ga0306925_1129230413300031890SoilMAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0306925_1180625513300031890SoilMAVRPEGANHQWRKNPHGELSIDPVVDERLVRVTAWVGAS
Ga0306925_1192484523300031890SoilMAVRPEGANHLWRKKPPRELSIDLVADERLGRVTE
Ga0306925_1201380513300031890SoilLAVRPEGADYQWRKIPLGELSIDPVADERLVRATARAGA
Ga0318551_1006201733300031896SoilVRLEGANHQWRKIPSGELSIDPEADERLSRVTGWAGAS
Ga0318551_1009501913300031896SoilISPLMAVRPEGANHQWRKNPPRELSIDLVADERLDRVTGRAEAS
Ga0306923_1001839113300031910SoilPALAVRPEGANHQWRKNPPGELSIGPVADERLVRVTAWVGAS
Ga0306923_1014428313300031910SoilMAVRPEGANHQWRKNPPGELSIDPVADERLVRGTTWVGAS
Ga0306923_1027942923300031910SoilKLAVRLEGANHQWRKIPSGELSIDPEADERLSRVTGWAGAS
Ga0306923_1098155413300031910SoilMAVRPEGANHLWRKKPPRELSIDLVADERLGRVTGR
Ga0306921_1107462313300031912SoilFVSVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS
Ga0310912_1012146723300031941SoilLQIKAAHDEVRCRRLAVRLEGANHQWRKIPPGELSIDPEADERLGRVTGWAGAS
Ga0310916_1009514413300031942SoilCECLLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0310916_1014433413300031942SoilSAGQCRLMAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS
Ga0310916_1071508713300031942SoilMAVRPEGANHQWRKNPHGELSIDPVADERLVRVTAW
Ga0310916_1080254733300031942SoilIPLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0310916_1161765713300031942SoilCRLMAVRPEGANHLWRKNPPRNLPISLVADERGSAG
Ga0310913_1007932313300031945SoilMAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRGRCLVT
Ga0310913_1010259413300031945SoilQVAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS
Ga0310913_1031572613300031945SoilVAVRPEGANHRWGKNPPGELSIDPVADERLMRVTAWAGANSIDVGT
Ga0310910_1061718533300031946SoilSRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0310909_1119710533300031947SoilMSALAVRPEGADYQWRKIAPGELSIDPVADERLVRA
Ga0306926_1049918913300031954SoilLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0306926_1085807813300031954SoilMAVRPEGANHLWRKKPPRELSIDLVADERLGRVTGRAGA
Ga0306926_1086983713300031954SoilMAERPEGADYQWRKIPLGELSIDPVADERLVRVTARA
Ga0306926_1120464023300031954SoilLENGFVSVRLEGACHQRRRIPPRELSIDLVADERLGRATGRAEAS
Ga0307479_1019256413300031962Hardwood Forest SoilRLIAAPACPQMAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0307479_1092492123300031962Hardwood Forest SoilVGDMSAASESLLVAVRPEGANYLWRKNPPRELSIDLVADERLVRVTGRAGAS
Ga0318531_1004012513300031981SoilCPLLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0318531_1008837513300031981SoilPLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS
Ga0306922_1022529713300032001SoilRPLSPLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS
Ga0306922_1111360613300032001SoilMAVRPEGADYQWRKIAPGELSIDPVADERLVRATAR
Ga0318563_1021156713300032009SoilVRPEGADHQWRKIPPGELSIDPEADEQLVRVTAWAEAS
Ga0318563_1040119923300032009SoilPDQMSALAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0310902_1019775323300032012SoilEGADYQWRKIPPGELSIDPEADGRLVRVTAWAEAS
Ga0318507_1028901733300032025SoilCICPLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0310911_1006427413300032035SoilLLLLLRCVGPLMAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0318559_1029140113300032039SoilLLAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0318549_1023494023300032041SoilSRFKRPVAGIDTSDLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318549_1034817513300032041SoilLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTARVGAS
Ga0318558_1002448663300032044SoilMAVRPEGANHLWRKKPPRELSIDLVADKRLGRVTGRAGAS
Ga0318558_1035232413300032044SoilMSLVVAVRPEGVHHQWGRIPPGELSIDPVADERLVRATARVGAS
Ga0318558_1037234633300032044SoilICRFLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318532_1017998713300032051SoilLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318532_1031460913300032051SoilVAVRRRVGERPLLAVRPEGANHQWRRNPPRELSIDLVADERLGRVTGRAGAS
Ga0318506_1003496733300032052SoilCLLLAVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGAS
Ga0318506_1018008423300032052SoilVDPMDRRCPLLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS
Ga0318506_1035769713300032052SoilQCLLLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318570_1014870813300032054SoilMAVRPEGANHQWRKNPPGELSIDPVADERLVRVTARVGAS
Ga0318575_1061482413300032055SoilMSLVVAVRPEGAHHQWGRIPPGELSIDPVADERLVRATARVG
Ga0318575_1068316423300032055SoilMAERPEGTHHQWRKIPPGELSIDPVADERLVRVTARAGAS
Ga0318533_1010410833300032059SoilPWMSVRGTGHLLAVRLEGANHQWRKIPPGELSINPEADERLDRVTGRAGAS
Ga0318533_1015666613300032059SoilLLRCISPLLAERPEGADYQWRKIPLGELSIDPVADERLVRVTA
Ga0318533_1117339523300032059SoilILLQCISPFLAVRPEGANHQWRKNPPGELSIDPVANERLVRVTAWVGAS
Ga0318510_1022640933300032064SoilPLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318514_1003379413300032066SoilSSGCPTMAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAGAS
Ga0306924_1005176453300032076SoilMARRQLLAVRPEGANRQWRRNPPRELLIDLVADEQLGRVTGRAGAS
Ga0306924_1025289313300032076SoilLMAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS
Ga0306924_1034531533300032076SoilVAVRPEGANHRWGKNPPGELSIDPVADERLMRVTA
Ga0306924_1123510523300032076SoilLICRVLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0306924_1172548913300032076SoilVRLEGANHQWRKIPPGELSIDPEADEQLGRVTGWAGA
Ga0306924_1176035813300032076SoilVTGLFPVLAVRPEGANHRWGKNPPGELSIDPVADER
Ga0326721_1004289123300032080SoilFDFKTKSGEGQEMAVRPEGADHQWRRIPSRELSIDLVADERFGRVTGRAGAS
Ga0318518_1033819623300032090SoilGIDTSDLAVRPEGADYQWRKIAPGELSIDPVADERLVRATARAGAS
Ga0318540_1003901933300032094SoilNMSAPMVRPEGVHHPWRKIPPRELSIDLVADERFGRAIERTEAS
Ga0318540_1014151723300032094SoilMSPVLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWVG
Ga0311301_1020424913300032160Peatlands SoilLAVRPEGANHQWRKIPPRELSIDLEADERFGWATGWA
Ga0311301_1152320213300032160Peatlands SoilAVRPEGANHQWRKIPPGELSIDPVANERLGWVTGRAGAS
Ga0307472_10010043813300032205Hardwood Forest SoilEGELARAALWSRLAVRPEGADYQWRKIPPGELSIDPEADERLVRVTAWAEAS
Ga0307472_10055373413300032205Hardwood Forest SoilLHCVCRLLAVRPEGADHQWRKNPPGELSIDPVADERLVQVTVRVGAS
Ga0307472_10096405413300032205Hardwood Forest SoilQLAVRPEGANHQWRKNPPGELSIDPVADERLVRATARAGAS
Ga0306920_10040033633300032261SoilRLRQQCLRLAVRPEGADYQWRKIPSGELSIDPEADERVVRVTARAEAS
Ga0306920_10114121413300032261SoilMAVRPEGANHQWRKNPPGELSIDPVADERLMRVTAWAG
Ga0306920_10160855613300032261SoilLAVRPEGADYQWRKIPLGELSIDPVADERLVRATA
Ga0306920_10241993423300032261SoilMSPELAERPEGADYQWRKIPLGELSIDPVADERLVRVTARAG
Ga0306920_10333242713300032261SoilGDRVTGLFPVLAVRPEGANHQWRKNPPGELSIDPVADERLVRVTAWAGAS
Ga0335076_1008029943300032955SoilANAGGDERKKCGLTVRPEGACHQWRKVPPRELSIDLVADEQFERVIGWTGAS
Ga0247829_1080175313300033550SoilVVLPERLKMAVRPEGADHRWRRIPPRELSIDLVADERFGRATGRAGAS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.