NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F002278

Metagenome / Metatranscriptome Family F002278

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F002278
Family Type Metagenome / Metatranscriptome
Number of Sequences 575
Average Sequence Length 108 residues
Representative Sequence MKTAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Number of Associated Samples 390
Number of Associated Scaffolds 574

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 0.53 %
% of genes near scaffold ends (potentially truncated) 60.52 %
% of genes from short scaffolds (< 2000 bps) 99.30 %
Associated GOLD sequencing projects 359
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.304 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(33.217 % of family members)
Environment Ontology (ENVO) Unclassified
(60.696 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(82.087 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 20.44%    β-sheet: 0.00%    Coil/Unstructured: 79.56%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 574 Family Scaffolds
PF00491Arginase 0.17

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 574 Family Scaffolds
COG0010Arginase/agmatinase family enzymeAmino acid transport and metabolism [E] 0.17


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.30 %
UnclassifiedrootN/A0.70 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000116|DelMOSpr2010_c10154195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum783Open in IMG/M
3300000130|SA_S2_NOR15_50mDRAFT_c10129878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum862Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10102918All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum742Open in IMG/M
3300000241|BS_KBA_SWE21_205mDRAFT_10071349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum774Open in IMG/M
3300000949|BBAY94_10101234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum789Open in IMG/M
3300001346|JGI20151J14362_10147986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum708Open in IMG/M
3300001355|JGI20158J14315_10134741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300001355|JGI20158J14315_10136296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300001355|JGI20158J14315_10198905All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani573Open in IMG/M
3300001822|ACM39_117028All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300001970|GOS2248_10086247All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1389Open in IMG/M
3300002408|B570J29032_109286403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300002447|JGI24768J34885_10271532All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani570Open in IMG/M
3300002835|B570J40625_101095210All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300003216|JGI26079J46598_1038072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1042Open in IMG/M
3300003677|Ga0008458J53046_101591All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300003683|Ga0008459J53047_1004048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300003860|Ga0031658_1080864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300004097|Ga0055584_102268543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani552Open in IMG/M
3300005043|Ga0071100_1059723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum911Open in IMG/M
3300005516|Ga0066831_10079077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum890Open in IMG/M
3300005516|Ga0066831_10104383All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum768Open in IMG/M
3300005516|Ga0066831_10166112All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum600Open in IMG/M
3300005584|Ga0049082_10171291All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300005599|Ga0066841_10080345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300005608|Ga0066840_10075546All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum691Open in IMG/M
3300005662|Ga0078894_11530460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300006357|Ga0075502_1698402All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum662Open in IMG/M
3300006383|Ga0075504_1383131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300006390|Ga0075509_1511040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300006393|Ga0075517_1011113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300006393|Ga0075517_1550281All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300006397|Ga0075488_1545687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300006400|Ga0075503_1015418All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300006401|Ga0075506_1802274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300006641|Ga0075471_10390523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum699Open in IMG/M
3300006803|Ga0075467_10404815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum710Open in IMG/M
3300007513|Ga0105019_1224696All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum897Open in IMG/M
3300007513|Ga0105019_1227234All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum888Open in IMG/M
3300007513|Ga0105019_1231787All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum872Open in IMG/M
3300007516|Ga0105050_10466403All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300007552|Ga0102818_1052284All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300007629|Ga0102895_1173924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300007634|Ga0102901_1227664All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300007725|Ga0102951_1096136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum842Open in IMG/M
3300007864|Ga0105749_1084537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300007953|Ga0105738_1060890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300007955|Ga0105740_1053317All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300007957|Ga0105742_1015535All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum834Open in IMG/M
3300007972|Ga0105745_1204650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300008110|Ga0114343_1211107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300008114|Ga0114347_1217560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300008832|Ga0103951_10537525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300008929|Ga0103732_1074993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300008929|Ga0103732_1075262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300008931|Ga0103734_1062684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300008931|Ga0103734_1077219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300008932|Ga0103735_1055837All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum588Open in IMG/M
3300008932|Ga0103735_1067614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300008933|Ga0103736_1045525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300008933|Ga0103736_1052128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300008936|Ga0103739_1055005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300008936|Ga0103739_1066511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300008938|Ga0103741_1019331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1171Open in IMG/M
3300008938|Ga0103741_1115909All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300008958|Ga0104259_1038631All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300008958|Ga0104259_1039048All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300008993|Ga0104258_1072626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300008993|Ga0104258_1103759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300009022|Ga0103706_10144130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300009071|Ga0115566_10324509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum903Open in IMG/M
3300009071|Ga0115566_10351296All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum859Open in IMG/M
3300009071|Ga0115566_10375222All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum824Open in IMG/M
3300009071|Ga0115566_10581040All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300009161|Ga0114966_10440367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum754Open in IMG/M
3300009172|Ga0114995_10660576All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300009172|Ga0114995_10784561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300009182|Ga0114959_10430524All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300009195|Ga0103743_1051106All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300009265|Ga0103873_1084458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum641Open in IMG/M
3300009269|Ga0103876_1073651All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300009432|Ga0115005_11246758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300009436|Ga0115008_10449262All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum917Open in IMG/M
3300009436|Ga0115008_10549441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum828Open in IMG/M
3300009436|Ga0115008_10956235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300009441|Ga0115007_10399479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum899Open in IMG/M
3300009441|Ga0115007_10535663All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum775Open in IMG/M
3300009441|Ga0115007_10572343All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum750Open in IMG/M
3300009441|Ga0115007_10779146All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300009507|Ga0115572_10324422All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300009543|Ga0115099_10205885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300009543|Ga0115099_10704412All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300009543|Ga0115099_11004932All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300009550|Ga0115013_11038648All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300009550|Ga0115013_11496560All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300009599|Ga0115103_1293908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300009599|Ga0115103_1764577All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300009606|Ga0115102_10654224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300009677|Ga0115104_10465372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300009677|Ga0115104_10671509All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300009677|Ga0115104_10958983All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300009679|Ga0115105_10332835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1739Open in IMG/M
3300009679|Ga0115105_10960582All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300009705|Ga0115000_10413911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum857Open in IMG/M
3300009732|Ga0123373_172594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300009735|Ga0123377_1044659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300009741|Ga0123361_1088053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300009785|Ga0115001_10268923All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1087Open in IMG/M
3300009785|Ga0115001_10485488All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum764Open in IMG/M
3300009785|Ga0115001_10709530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300009790|Ga0115012_11581614All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300009864|Ga0132193_104878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum727Open in IMG/M
3300010306|Ga0129322_1055318All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300010312|Ga0102883_1246906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium rassoulzadegani500Open in IMG/M
3300010404|Ga0129323_1030784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300010987|Ga0138324_10613170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300010987|Ga0138324_10708335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300012030|Ga0136599_1034407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300012370|Ga0123369_1002817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300012415|Ga0138263_1467211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300012472|Ga0129328_1099007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300012504|Ga0129347_1203479All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum933Open in IMG/M
3300012516|Ga0129325_1310585All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300012518|Ga0129349_1163410All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300012518|Ga0129349_1195276All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300012520|Ga0129344_1273254All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300012523|Ga0129350_1152708All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300012524|Ga0129331_1247539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300012525|Ga0129353_1833078All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300012525|Ga0129353_1834302All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300012528|Ga0129352_10114598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300012528|Ga0129352_10856774All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300012952|Ga0163180_10438522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum963Open in IMG/M
3300012952|Ga0163180_10512004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum899Open in IMG/M
3300012952|Ga0163180_11589212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300012952|Ga0163180_11827076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300012954|Ga0163111_12123232All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300012963|Ga0129340_1223539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300012965|Ga0129346_1252907All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300012966|Ga0129341_1301156All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300012969|Ga0129332_1274470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300013004|Ga0164293_10993364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300013295|Ga0170791_11572263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300016703|Ga0182088_1010864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300016735|Ga0182074_1294339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300016737|Ga0182047_1398715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300016737|Ga0182047_1399163All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300016737|Ga0182047_1467465All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300016741|Ga0182079_1648441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300016742|Ga0182052_1319816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300016746|Ga0182055_1159643All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300016748|Ga0182043_1117392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300016749|Ga0182053_1236268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300016749|Ga0182053_1509987All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300016751|Ga0182062_1081599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300016776|Ga0182046_1144430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300017717|Ga0181404_1136851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300017719|Ga0181390_1185855All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300017728|Ga0181419_1107373All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300017735|Ga0181431_1082077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300017758|Ga0181409_1230633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300017763|Ga0181410_1220135All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300017769|Ga0187221_1062471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1178Open in IMG/M
3300017771|Ga0181425_1251967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300017772|Ga0181430_1129341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum740Open in IMG/M
3300017788|Ga0169931_10684737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum678Open in IMG/M
3300017949|Ga0181584_10905471All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300017951|Ga0181577_10398618All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum876Open in IMG/M
3300017967|Ga0181590_11103675All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300018048|Ga0181606_10535964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300018413|Ga0181560_10322350All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum719Open in IMG/M
3300018417|Ga0181558_10310130All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum859Open in IMG/M
3300018423|Ga0181593_10526390All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum861Open in IMG/M
3300018423|Ga0181593_10647339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300018424|Ga0181591_10990603All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300018428|Ga0181568_11186460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300018502|Ga0193334_104215All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300018515|Ga0192960_106175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300018567|Ga0188858_108712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300018575|Ga0193474_1018477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300018593|Ga0192844_1020604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300018602|Ga0193182_1023771All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300018622|Ga0188862_1021450All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300018625|Ga0192842_1033292All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300018628|Ga0193355_1016759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300018628|Ga0193355_1020597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300018644|Ga0193352_1050652All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300018649|Ga0192969_1047823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300018649|Ga0192969_1050095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum579Open in IMG/M
3300018655|Ga0192846_1035784All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300018674|Ga0193166_1034176All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300018678|Ga0193007_1055622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300018684|Ga0192983_1048586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300018684|Ga0192983_1062673All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300018692|Ga0192944_1027729All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum815Open in IMG/M
3300018692|Ga0192944_1036136All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300018692|Ga0192944_1050707All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300018692|Ga0192944_1054478All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300018692|Ga0192944_1064082All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300018730|Ga0192967_1063861All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300018730|Ga0192967_1075460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300018730|Ga0192967_1078945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300018730|Ga0192967_1079182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300018735|Ga0193544_1026835All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300018739|Ga0192974_1080187All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300018742|Ga0193138_1049377All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300018742|Ga0193138_1053518All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300018742|Ga0193138_1054477All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300018745|Ga0193000_1060514All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300018745|Ga0193000_1060517All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300018745|Ga0193000_1063095All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300018745|Ga0193000_1070545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300018762|Ga0192963_1071727All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300018763|Ga0192827_1075240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300018763|Ga0192827_1091238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300018763|Ga0192827_1093896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300018765|Ga0193031_1073600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300018765|Ga0193031_1080269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300018765|Ga0193031_1090001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300018765|Ga0193031_1092079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300018765|Ga0193031_1092687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300018766|Ga0193181_1066168All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300018782|Ga0192832_1053879All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018787|Ga0193124_1061674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300018787|Ga0193124_1062105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300018796|Ga0193117_1080476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300018801|Ga0192824_1103991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300018811|Ga0193183_1077553All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300018823|Ga0193053_1072946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018830|Ga0193191_1081018All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300018831|Ga0192949_1105224All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300018832|Ga0194240_1023931All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300018842|Ga0193219_1073046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300018846|Ga0193253_1107195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum644Open in IMG/M
3300018846|Ga0193253_1132732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300018848|Ga0192970_1094888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300018848|Ga0192970_1097667All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300018852|Ga0193284_1063849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300018853|Ga0192958_1157128All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300018855|Ga0193475_1066255All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300018855|Ga0193475_1077892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300018862|Ga0193308_1086984All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300018874|Ga0192977_1107647All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300018879|Ga0193027_1120172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300018880|Ga0193337_1039737All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300018893|Ga0193258_1228638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300018899|Ga0193090_1109253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum626Open in IMG/M
3300018913|Ga0192868_10088537All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300018926|Ga0192989_10139746All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300018926|Ga0192989_10139749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum591Open in IMG/M
3300018926|Ga0192989_10145074All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300018928|Ga0193260_10140495All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300018928|Ga0193260_10145409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300018928|Ga0193260_10149031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300018961|Ga0193531_10321997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300018967|Ga0193178_10077441All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300018967|Ga0193178_10080252All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300018968|Ga0192894_10295419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300018968|Ga0192894_10310143All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300018969|Ga0193143_10177039All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum623Open in IMG/M
3300018969|Ga0193143_10191846All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300018974|Ga0192873_10370077All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300018975|Ga0193006_10187353All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300018975|Ga0193006_10211595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300018976|Ga0193254_10132859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300018976|Ga0193254_10149404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300018977|Ga0193353_10213816All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300018979|Ga0193540_10171195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum605Open in IMG/M
3300018980|Ga0192961_10205473All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum589Open in IMG/M
3300018980|Ga0192961_10244924All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300018980|Ga0192961_10253864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300018981|Ga0192968_10150586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300018982|Ga0192947_10239818All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum585Open in IMG/M
3300018982|Ga0192947_10251388All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300018982|Ga0192947_10254720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300018982|Ga0192947_10259080All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300018982|Ga0192947_10274748All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300018982|Ga0192947_10278530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300018982|Ga0192947_10293481All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300018985|Ga0193136_10221411All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300018988|Ga0193275_10243994All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300018989|Ga0193030_10228102All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum612Open in IMG/M
3300018989|Ga0193030_10239059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300018989|Ga0193030_10300406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300018989|Ga0193030_10309653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300018989|Ga0193030_10310559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300018997|Ga0193257_10219642All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300019001|Ga0193034_10136633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300019001|Ga0193034_10199238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300019009|Ga0192880_10183466All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300019010|Ga0193044_10246569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300019010|Ga0193044_10251433All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300019021|Ga0192982_10298573All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300019021|Ga0192982_10302241All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum574Open in IMG/M
3300019021|Ga0192982_10304066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300019021|Ga0192982_10335641All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300019022|Ga0192951_10312389All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum594Open in IMG/M
3300019022|Ga0192951_10344997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300019027|Ga0192909_10169069All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300019027|Ga0192909_10277154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300019031|Ga0193516_10195338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300019031|Ga0193516_10239171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300019031|Ga0193516_10241109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300019031|Ga0193516_10300088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300019031|Ga0193516_10303854All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300019032|Ga0192869_10275680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum731Open in IMG/M
3300019032|Ga0192869_10349765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300019032|Ga0192869_10395092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300019032|Ga0192869_10425653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300019032|Ga0192869_10496293All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300019033|Ga0193037_10358801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300019033|Ga0193037_10371827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300019036|Ga0192945_10095749All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum929Open in IMG/M
3300019036|Ga0192945_10219277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300019036|Ga0192945_10259310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300019036|Ga0192945_10265813All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300019036|Ga0192945_10297021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300019037|Ga0192886_10265792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum564Open in IMG/M
3300019039|Ga0193123_10398741All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300019040|Ga0192857_10310404All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300019045|Ga0193336_10532883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300019045|Ga0193336_10541955All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300019045|Ga0193336_10615072All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300019048|Ga0192981_10151037All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum917Open in IMG/M
3300019048|Ga0192981_10210845All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300019048|Ga0192981_10213125All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum750Open in IMG/M
3300019048|Ga0192981_10336992All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300019050|Ga0192966_10311687All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300019050|Ga0192966_10316384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300019051|Ga0192826_10267045All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum628Open in IMG/M
3300019051|Ga0192826_10305825All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300019051|Ga0192826_10330153All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300019051|Ga0192826_10330366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300019051|Ga0192826_10343493All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300019051|Ga0192826_10349376All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300019051|Ga0192826_10351988All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300019051|Ga0192826_10375091All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300019054|Ga0192992_10324338All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300019095|Ga0188866_1029528All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300019095|Ga0188866_1029793All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300019095|Ga0188866_1031325All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300019097|Ga0193153_1027902All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300019097|Ga0193153_1032717All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300019103|Ga0192946_1055551All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300019108|Ga0192972_1079228All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300019116|Ga0193243_1060233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300019117|Ga0193054_1073734All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300019118|Ga0193157_1027710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum587Open in IMG/M
3300019118|Ga0193157_1032559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300019118|Ga0193157_1033265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300019118|Ga0193157_1036011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300019118|Ga0193157_1036399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300019118|Ga0193157_1036815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300019123|Ga0192980_1081238All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum592Open in IMG/M
3300019123|Ga0192980_1085399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum572Open in IMG/M
3300019123|Ga0192980_1092120All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum542Open in IMG/M
3300019123|Ga0192980_1095288All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300019123|Ga0192980_1096107All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300019129|Ga0193436_1055150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300019146|Ga0188881_10026780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum716Open in IMG/M
3300019146|Ga0188881_10029378All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum683Open in IMG/M
3300019149|Ga0188870_10140628All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300019149|Ga0188870_10147057All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300019149|Ga0188870_10154076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300019262|Ga0182066_1057482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300019266|Ga0182061_1050158All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300019272|Ga0182059_1190425All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300019272|Ga0182059_1270268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300019282|Ga0182075_1860908All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300020014|Ga0182044_1104499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300020014|Ga0182044_1303375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300020074|Ga0194113_10650200All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum737Open in IMG/M
3300020074|Ga0194113_10736621All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300020165|Ga0206125_10198638All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum782Open in IMG/M
3300020166|Ga0206128_1331480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300020169|Ga0206127_1267470All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300020182|Ga0206129_10189967All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum920Open in IMG/M
3300020182|Ga0206129_10234897All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum782Open in IMG/M
3300020183|Ga0194115_10293170All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300020214|Ga0194132_10361434All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum751Open in IMG/M
3300020382|Ga0211686_10202004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum820Open in IMG/M
3300020603|Ga0194126_10667474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum611Open in IMG/M
3300021085|Ga0206677_10195189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300021085|Ga0206677_10225335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum788Open in IMG/M
3300021089|Ga0206679_10643937All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300021169|Ga0206687_1055710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum544Open in IMG/M
3300021169|Ga0206687_1565366All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300021305|Ga0210296_1072499All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300021325|Ga0210301_1385863All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300021345|Ga0206688_10081864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300021345|Ga0206688_10534092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300021348|Ga0206695_1012264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum672Open in IMG/M
3300021348|Ga0206695_1367802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300021350|Ga0206692_1338381All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum533Open in IMG/M
3300021353|Ga0206693_1359032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum677Open in IMG/M
3300021353|Ga0206693_1457809All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum513Open in IMG/M
3300021359|Ga0206689_10112859All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300021359|Ga0206689_10435516All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300021365|Ga0206123_10205653All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum873Open in IMG/M
3300021365|Ga0206123_10214903All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum849Open in IMG/M
3300021373|Ga0213865_10295109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum757Open in IMG/M
3300021872|Ga0063132_102566All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300021872|Ga0063132_107888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum549Open in IMG/M
3300021892|Ga0063137_1012677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300021892|Ga0063137_1015543All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300021893|Ga0063142_1031372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum521Open in IMG/M
3300021896|Ga0063136_1041636All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300021896|Ga0063136_1055549All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300021902|Ga0063086_1018750All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300021908|Ga0063135_1018131All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum543Open in IMG/M
3300021908|Ga0063135_1026539All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300021912|Ga0063133_1035104All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300021912|Ga0063133_1037223All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300021927|Ga0063103_1019305All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum512Open in IMG/M
3300021927|Ga0063103_1063865All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300021935|Ga0063138_1019294All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300021950|Ga0063101_1051588All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300021957|Ga0222717_10316266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum886Open in IMG/M
3300021958|Ga0222718_10331361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300021959|Ga0222716_10404225All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum792Open in IMG/M
3300021962|Ga0222713_10481011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum746Open in IMG/M
3300021964|Ga0222719_10822788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum508Open in IMG/M
3300022367|Ga0210312_113561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300022752|Ga0214917_10342233All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300022934|Ga0255781_10246409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum843Open in IMG/M
3300022935|Ga0255780_10505240All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300023179|Ga0214923_10368512All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum749Open in IMG/M
3300023566|Ga0228679_1024198All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300023679|Ga0232113_1036683All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300023685|Ga0228686_1050123All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300023693|Ga0232112_1043229All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300023694|Ga0228683_1027703All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum617Open in IMG/M
3300023696|Ga0228687_1044023All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300023698|Ga0228682_1027064All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300025138|Ga0209634_1169111All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum870Open in IMG/M
3300025138|Ga0209634_1279744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum586Open in IMG/M
3300025626|Ga0209716_1070536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1074Open in IMG/M
3300025640|Ga0209198_1067878All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1229Open in IMG/M
3300025732|Ga0208784_1135986All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum729Open in IMG/M
3300025887|Ga0208544_10249831All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum710Open in IMG/M
3300025894|Ga0209335_10273442All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum731Open in IMG/M
3300025897|Ga0209425_10361695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum705Open in IMG/M
3300026166|Ga0208276_1036160All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300026182|Ga0208275_1062182All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum733Open in IMG/M
3300026182|Ga0208275_1092692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300026403|Ga0247557_1016027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum843Open in IMG/M
3300026420|Ga0247581_1083076All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300026421|Ga0247569_1095527All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300026434|Ga0247591_1077485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300026447|Ga0247607_1079116All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300026448|Ga0247594_1063910All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum637Open in IMG/M
3300026448|Ga0247594_1067004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300026449|Ga0247593_1088480All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300026449|Ga0247593_1100885All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum563Open in IMG/M
3300026458|Ga0247578_1087265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300026458|Ga0247578_1128226All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300026461|Ga0247600_1106372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300026461|Ga0247600_1114427All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum536Open in IMG/M
3300026465|Ga0247588_1120401All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300026466|Ga0247598_1127137All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300026468|Ga0247603_1117032All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300026470|Ga0247599_1132720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300026471|Ga0247602_1137995All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300026495|Ga0247571_1099659All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum675Open in IMG/M
3300026495|Ga0247571_1140093All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300026503|Ga0247605_1149789All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300026503|Ga0247605_1156559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300026503|Ga0247605_1173329All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300026504|Ga0247587_1108392All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum684Open in IMG/M
3300026504|Ga0247587_1119849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum648Open in IMG/M
3300027159|Ga0208020_1047432All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum806Open in IMG/M
3300027194|Ga0208799_1037970All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300027194|Ga0208799_1053883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum546Open in IMG/M
3300027235|Ga0208804_1023941All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300027308|Ga0208796_1065504All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum791Open in IMG/M
3300027586|Ga0208966_1196991All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300027708|Ga0209188_1220745All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum671Open in IMG/M
3300027753|Ga0208305_10319060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum541Open in IMG/M
3300027791|Ga0209830_10156666All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1087Open in IMG/M
3300027805|Ga0209229_10327345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum673Open in IMG/M
3300027810|Ga0209302_10210277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum928Open in IMG/M
3300027833|Ga0209092_10213357All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1080Open in IMG/M
3300027833|Ga0209092_10293610All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum882Open in IMG/M
3300027836|Ga0209230_10575231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum633Open in IMG/M
3300027849|Ga0209712_10411194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum762Open in IMG/M
3300027849|Ga0209712_10588803All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300027859|Ga0209503_10256177All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum848Open in IMG/M
3300027976|Ga0209702_10231916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum773Open in IMG/M
3300028008|Ga0228674_1249733All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum553Open in IMG/M
3300028109|Ga0247582_1190525All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum520Open in IMG/M
3300028137|Ga0256412_1363627All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300028233|Ga0256417_1201286All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum532Open in IMG/M
3300028233|Ga0256417_1208316All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300028233|Ga0256417_1213732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300028282|Ga0256413_1239712All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum645Open in IMG/M
3300028282|Ga0256413_1253963All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum624Open in IMG/M
3300028290|Ga0247572_1173710All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300028290|Ga0247572_1175732All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300028333|Ga0247595_1095570All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300028334|Ga0247597_1058959All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300028335|Ga0247566_1054283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum667Open in IMG/M
3300028405|Ga0306909_117159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum723Open in IMG/M
3300028595|Ga0272440_1240203All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium531Open in IMG/M
3300030670|Ga0307401_10374275All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300030670|Ga0307401_10579419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300030671|Ga0307403_10814993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300030699|Ga0307398_10313269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300030709|Ga0307400_10963298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum519Open in IMG/M
3300030715|Ga0308127_1037075All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300030723|Ga0308129_1037613All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300030725|Ga0308128_1037650All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum575Open in IMG/M
3300030750|Ga0073967_11956303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300030780|Ga0073988_12362014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum552Open in IMG/M
3300031038|Ga0073986_10002676All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum501Open in IMG/M
3300031522|Ga0307388_10806159All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum630Open in IMG/M
3300031523|Ga0307492_10221626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300031540|Ga0308143_130429All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300031542|Ga0308149_1053217All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300031569|Ga0307489_10523165All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum809Open in IMG/M
3300031569|Ga0307489_10688001All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300031570|Ga0308144_1047155All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum529Open in IMG/M
3300031580|Ga0308132_1137713All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum502Open in IMG/M
3300031602|Ga0307993_1044595All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1112Open in IMG/M
3300031621|Ga0302114_10195706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum853Open in IMG/M
3300031622|Ga0302126_10134109All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum933Open in IMG/M
3300031622|Ga0302126_10172458All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum789Open in IMG/M
3300031626|Ga0302121_10175778All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300031674|Ga0307393_1148728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300031710|Ga0307386_10354308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum748Open in IMG/M
3300031710|Ga0307386_10354308All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum748Open in IMG/M
3300031710|Ga0307386_10722046All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum534Open in IMG/M
3300031717|Ga0307396_10623841All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300031725|Ga0307381_10112993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum903Open in IMG/M
3300031725|Ga0307381_10354375All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum535Open in IMG/M
3300031739|Ga0307383_10635206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300031739|Ga0307383_10694890All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum518Open in IMG/M
3300031743|Ga0307382_10533649All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum539Open in IMG/M
3300031750|Ga0307389_11023529All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300031784|Ga0315899_10914914All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum789Open in IMG/M
3300031851|Ga0315320_10526599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum791Open in IMG/M
3300031851|Ga0315320_10899274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300032047|Ga0315330_10876574All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300032092|Ga0315905_11594108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300032463|Ga0314684_10760053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum554Open in IMG/M
3300032470|Ga0314670_10612394All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300032492|Ga0314679_10511630All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300032492|Ga0314679_10526507All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum527Open in IMG/M
3300032517|Ga0314688_10749632All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum522Open in IMG/M
3300032518|Ga0314689_10638950All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum550Open in IMG/M
3300032518|Ga0314689_10645365All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300032519|Ga0314676_10761006All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300032522|Ga0314677_10505569All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum643Open in IMG/M
3300032540|Ga0314682_10678359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum560Open in IMG/M
3300032616|Ga0314671_10629339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum578Open in IMG/M
3300032616|Ga0314671_10675723All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum555Open in IMG/M
3300032651|Ga0314685_10762828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300032666|Ga0314678_10539925All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300032666|Ga0314678_10569726All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum507Open in IMG/M
3300032707|Ga0314687_10430916All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum732Open in IMG/M
3300032707|Ga0314687_10714206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum556Open in IMG/M
3300032708|Ga0314669_10595934All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum608Open in IMG/M
3300032713|Ga0314690_10644883All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum515Open in IMG/M
3300032727|Ga0314693_10622695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum584Open in IMG/M
3300032728|Ga0314696_10585485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300032730|Ga0314699_10536358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum526Open in IMG/M
3300032732|Ga0314711_10601686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum558Open in IMG/M
3300032751|Ga0314694_10490567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300032752|Ga0314700_10300260All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum846Open in IMG/M
3300032755|Ga0314709_10789680All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300032820|Ga0310342_103687108All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum505Open in IMG/M
3300034064|Ga0335001_0462257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum676Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine33.22%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine15.13%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater8.17%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh5.57%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous5.22%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater4.70%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.96%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine2.78%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica2.26%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.57%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.22%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.22%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.22%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.91%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.04%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.87%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.87%
Estuary WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water0.87%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.87%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water0.87%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.52%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.52%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.52%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic0.35%
Freshwater, PlanktonEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton0.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater0.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.35%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.35%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.35%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake0.35%
Surface Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water0.35%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater0.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.17%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.17%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.17%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.17%
Marine PlanktonEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton0.17%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.17%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.17%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine0.17%
MarineEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine0.17%
Marine SedimentEnvironmental → Aquatic → Marine → Wetlands → Sediment → Marine Sediment0.17%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.17%
Marine Subseafloor AquiferEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine Subseafloor Aquifer0.17%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.17%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.17%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline0.17%
Macroalgal SurfaceHost-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface0.17%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.17%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000116Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010EnvironmentalOpen in IMG/M
3300000130Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 2 sample NOR 15_50mEnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000241Marine microbial communities from chronically polluted sediments in the Baltic Sea - site KBB sample SWE 21_20.5mEnvironmentalOpen in IMG/M
3300000949Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY94Host-AssociatedOpen in IMG/M
3300001346Pelagic Microbial community sample from North Sea - COGITO 998_met_01EnvironmentalOpen in IMG/M
3300001355Pelagic Microbial community sample from North Sea - COGITO 998_met_08EnvironmentalOpen in IMG/M
3300001822Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM39, ROCA_DNA108_2.0um_23aEnvironmentalOpen in IMG/M
3300001970Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033EnvironmentalOpen in IMG/M
3300002408Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)EnvironmentalOpen in IMG/M
3300002447Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion MetagenomeEnvironmentalOpen in IMG/M
3300002835Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300003677Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_66_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300003860Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PLEnvironmentalOpen in IMG/M
3300004097Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaGEnvironmentalOpen in IMG/M
3300005043Mid-Atlantic Ridge North Pond Expedition - Sample 1382AEnvironmentalOpen in IMG/M
3300005516Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49BEnvironmentalOpen in IMG/M
3300005584Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRFEnvironmentalOpen in IMG/M
3300005599Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91AEnvironmentalOpen in IMG/M
3300005608Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF84AEnvironmentalOpen in IMG/M
3300005662Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4)EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006383Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006390Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006393Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006397Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006400Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006401Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006641Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNAEnvironmentalOpen in IMG/M
3300006803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNAEnvironmentalOpen in IMG/M
3300007513Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate bEnvironmentalOpen in IMG/M
3300007516Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01EnvironmentalOpen in IMG/M
3300007551Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3EnvironmentalOpen in IMG/M
3300007552Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571EnvironmentalOpen in IMG/M
3300007629Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3EnvironmentalOpen in IMG/M
3300007634Estuarine microbial communities from the Columbia River estuary - metaG 1555A-02EnvironmentalOpen in IMG/M
3300007725Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MGEnvironmentalOpen in IMG/M
3300007864Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461B_3.0umEnvironmentalOpen in IMG/M
3300007953Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_3umEnvironmentalOpen in IMG/M
3300007955Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_3.0umEnvironmentalOpen in IMG/M
3300007957Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_3.0umEnvironmentalOpen in IMG/M
3300007972Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0umEnvironmentalOpen in IMG/M
3300008110Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NAEnvironmentalOpen in IMG/M
3300008114Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NAEnvironmentalOpen in IMG/M
3300008832Eukaryotic communities of water collected during the Tara Oceans expedition - TARA_A200000150EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009057Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009161Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaGEnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009182Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaGEnvironmentalOpen in IMG/M
3300009195Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4CEnvironmentalOpen in IMG/M
3300009265Eukaryotic communities of water from the North Atlantic ocean - ACM8EnvironmentalOpen in IMG/M
3300009269Eukaryotic communities of water from the North Atlantic ocean - ACM28EnvironmentalOpen in IMG/M
3300009432Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M MetagenomeEnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009550Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 MetagenomeEnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009606Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009705Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128EnvironmentalOpen in IMG/M
3300009732Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_232_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009735Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_240_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009741Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_193_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009785Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130EnvironmentalOpen in IMG/M
3300009790Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 MetagenomeEnvironmentalOpen in IMG/M
3300009864Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, surface; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010306Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010312Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02EnvironmentalOpen in IMG/M
3300010404Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012030Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697EnvironmentalOpen in IMG/M
3300012370Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_209_2m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012472Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012504Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012516Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012518Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012520Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012523Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012525Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012528Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300012963Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012965Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012966Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300013004Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaGEnvironmentalOpen in IMG/M
3300013295northern Canada Lakes metatranscriptome co-assemblyEnvironmentalOpen in IMG/M
3300016703Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041407CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016735Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071406BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016741Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071410CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016742Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011511BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016746Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101401AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016748Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011502CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016751Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101408BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016776Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011505AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017719Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017771Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017788Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20LEnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018048Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041412US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018413Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011509CT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018423Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071413AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018424Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018502Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001750 (ERX1782144-ERR1711886)EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018567Metatranscriptome of marine microbial communities from Baltic Sea - GS683_3p0_dTEnvironmentalOpen in IMG/M
3300018575Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782379-ERR1712162)EnvironmentalOpen in IMG/M
3300018593Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000600 (ERX1782171-ERR1712017)EnvironmentalOpen in IMG/M
3300018602Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782193-ERR1711945)EnvironmentalOpen in IMG/M
3300018622Metatranscriptome of marine microbial communities from Baltic Sea - GS684_3p0_dTEnvironmentalOpen in IMG/M
3300018625Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000598 (ERX1782204-ERR1712199)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018644Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782112-ERR1712144)EnvironmentalOpen in IMG/M
3300018649Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782476-ERR1712161)EnvironmentalOpen in IMG/M
3300018655Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000522 (ERX1782387-ERR1711943)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018678Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782149-ERR1712036)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018735Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399747-ERR1328127)EnvironmentalOpen in IMG/M
3300018739Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001019 (ERX1789514-ERR1719246)EnvironmentalOpen in IMG/M
3300018742Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000534 (ERX1789653-ERR1719224)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018762Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001006 (ERX1789586-ERR1719157)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018765Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)EnvironmentalOpen in IMG/M
3300018766Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000317 (ERX1789428-ERR1719465)EnvironmentalOpen in IMG/M
3300018782Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000570 (ERX1782313-ERR1712019)EnvironmentalOpen in IMG/M
3300018787Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001288 (ERX1789595-ERR1719164)EnvironmentalOpen in IMG/M
3300018796Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)EnvironmentalOpen in IMG/M
3300018801Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000063 (ERX1789476-ERR1719434)EnvironmentalOpen in IMG/M
3300018811Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000319 (ERX1782290-ERR1712064)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018830Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000006 (ERX1789678-ERR1719267)EnvironmentalOpen in IMG/M
3300018831Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001386 (ERX1789378-ERR1719149)EnvironmentalOpen in IMG/M
3300018832Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000852 (ERX1782372-ERR1712031)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018848Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001442 (ERX1789421-ERR1719148)EnvironmentalOpen in IMG/M
3300018852Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_100 - TARA_N000001606 (ERX1809471-ERR1739847)EnvironmentalOpen in IMG/M
3300018853Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001400 (ERX1782437-ERR1712106)EnvironmentalOpen in IMG/M
3300018855Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002191 (ERX1782341-ERR1711903)EnvironmentalOpen in IMG/M
3300018862Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001652 (ERX1789608-ERR1719146)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018880Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782455-ERR1712124)EnvironmentalOpen in IMG/M
3300018893Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789445-ERR1719354)EnvironmentalOpen in IMG/M
3300018899Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001029 (ERX1809754-ERR1740133)EnvironmentalOpen in IMG/M
3300018913Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782451-ERR1712205)EnvironmentalOpen in IMG/M
3300018926Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001309 (ERX1789376-ERR1719276)EnvironmentalOpen in IMG/M
3300018928Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001111 (ERX1789573-ERR1719386)EnvironmentalOpen in IMG/M
3300018961Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)EnvironmentalOpen in IMG/M
3300018967Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000316 (ERX1789557-ERR1719488)EnvironmentalOpen in IMG/M
3300018968Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000713 (ERX1782205-ERR1712096)EnvironmentalOpen in IMG/M
3300018969Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000539 (ERX1782234-ERR1712179)EnvironmentalOpen in IMG/M
3300018974Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000809 (ERX1782160-ERR1711971)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018976Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001301 (ERX1789542-ERR1719444)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018979Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_153 - TARA_N000002817 (ERX1782403-ERR1712037)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018981Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001440 (ERX1782157-ERR1712238)EnvironmentalOpen in IMG/M
3300018982Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782271-ERR1711935)EnvironmentalOpen in IMG/M
3300018985Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_020 - TARA_A100000761 (ERX1782416-ERR1711874)EnvironmentalOpen in IMG/M
3300018988Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001580 (ERX1782315-ERR1711974)EnvironmentalOpen in IMG/M
3300018989Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782326-ERR1711934)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019009Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000756 (ERX1782233-ERR1711966)EnvironmentalOpen in IMG/M
3300019010Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001428 (ERX1809462-ERR1739838)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019027Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000678 (ERX1782477-ERR1711924)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019032Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000805 (ERX1782188-ERR1712216)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019037Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000703 (ERX1782146-ERR1712183)EnvironmentalOpen in IMG/M
3300019039Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_011 - TARA_X000001286 (ERX1782333-ERR1712137)EnvironmentalOpen in IMG/M
3300019040Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019050Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782371-ERR1711865)EnvironmentalOpen in IMG/M
3300019051Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782232-ERR1712227)EnvironmentalOpen in IMG/M
3300019054Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_098 - TARA_N000001590 (ERX1782183-ERR1711964)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019103Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001384 (ERX1782358-ERR1712021)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019116Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001491 (ERX1782226-ERR1711967)EnvironmentalOpen in IMG/M
3300019117Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002348 (ERX1782351-ERR1711912)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019123Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782390-ERR1712195)EnvironmentalOpen in IMG/M
3300019129Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002352 (ERX1782251-ERR1711975)EnvironmentalOpen in IMG/M
3300019146Metatranscriptome of marine microbial communities from Baltic Sea - GS860_ls5EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019262Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101412AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019266Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101407AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019272Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101405AT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019282Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071407BT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020166Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160426_1EnvironmentalOpen in IMG/M
3300020169Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1EnvironmentalOpen in IMG/M
3300020182Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160502_2EnvironmentalOpen in IMG/M
3300020183Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surfaceEnvironmentalOpen in IMG/M
3300020214Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015054 Kigoma Offshore 80mEnvironmentalOpen in IMG/M
3300020382Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059)EnvironmentalOpen in IMG/M
3300020603Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150mEnvironmentalOpen in IMG/M
3300021085Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015EnvironmentalOpen in IMG/M
3300021089Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015EnvironmentalOpen in IMG/M
3300021169Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021305Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R868 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021364Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO304EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021892Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S15 C1 B20 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021893Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S23 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021896Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S13 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021902Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-1S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021908Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S11 C1 B13 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021912Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S7 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021935Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S17 C1 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300021962Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649DEnvironmentalOpen in IMG/M
3300021964Estuarine water microbial communities from San Francisco Bay, California, United States - C33_34DEnvironmentalOpen in IMG/M
3300022367Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1161 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022752Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BBEnvironmentalOpen in IMG/M
3300022934Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaGEnvironmentalOpen in IMG/M
3300022935Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaGEnvironmentalOpen in IMG/M
3300023179Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510EnvironmentalOpen in IMG/M
3300023566Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 18R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023679Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 32R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023685Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 50R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023694Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 31R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023698Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 27R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025138Marine viral communities from the Pacific Ocean - LP-40 (SPAdes)EnvironmentalOpen in IMG/M
3300025626Pelagic marine microbial communities from North Sea - COGITO_mtgs_120531 (SPAdes)EnvironmentalOpen in IMG/M
3300025640Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes)EnvironmentalOpen in IMG/M
3300025732Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025887Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302PF91A (SPAdes)EnvironmentalOpen in IMG/M
3300026182Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF49B (SPAdes)EnvironmentalOpen in IMG/M
3300026403Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 2R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026420Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 40R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026421Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026434Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 53R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026448Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 57R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026449Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 56R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026458Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 36R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026465Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 48R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026466Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 70R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026468Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 79R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026471Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 77R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026504Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 46R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027159Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573 (SPAdes)EnvironmentalOpen in IMG/M
3300027194Estuarine microbial communities from the Columbia River estuary - metaG S.751 (SPAdes)EnvironmentalOpen in IMG/M
3300027229Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027235Estuarine microbial communities from the Columbia River estuary - metaG 1553A-3 (SPAdes)EnvironmentalOpen in IMG/M
3300027308Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes)EnvironmentalOpen in IMG/M
3300027586Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027708Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027791Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130 (SPAdes)EnvironmentalOpen in IMG/M
3300027805Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes)EnvironmentalOpen in IMG/M
3300027810Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027833Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027836Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027849Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean - Greenland ARC118M Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027859Marine eukaryotic phytoplankton communities from Atlantic Ocean - South Atlantic ANT15 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300027976Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-01 (SPAdes)EnvironmentalOpen in IMG/M
3300028008Seawater microbial communities from Monterey Bay, California, United States - 1D_rEnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028233Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - MB_1026D (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028333Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 60R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028334Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 68R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028335Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 14R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028405Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 2 #697 (v2)EnvironmentalOpen in IMG/M
3300028595Marine sediment archaeal communities from Little Sippewissett salt marsh, Falmouth, MA, United States - SSM-MMB-Aug17EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030715Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1295_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030725Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1298_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030750Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030780Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S19_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031038Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S14_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031523Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SI3LEnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031542Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CBN3_331_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031569Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 1.2EnvironmentalOpen in IMG/M
3300031570Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_547_5m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031580Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1111_SCM (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031602Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031622Marine microbial communities from Western Arctic Ocean, Canada - CB4_20mEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031739Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031784Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032092Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032492Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032518Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032519Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032651Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032666Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032713Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_sur (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032728Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032752Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032755Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad10_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032820Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - S1503-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300034064Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
DelMOSpr2010_1015419523300000116MarineMKFICIALIGAAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
SA_S2_NOR15_50mDRAFT_1012987823300000130MarineMKITALAVIATIMSTASANAGEEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
KGI_S1_ANT02_95mDRAFT_1010291813300000136MarineMKSTIIALIGVVAATVQDAPAGVDKLHFFDFDNAKMLYKGDWNSYKVSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
BS_KBA_SWE21_205mDRAFT_1007134923300000241MarineMLWKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGTPLPTQAPGLSYTH*
BBAY94_1010123413300000949Macroalgal SurfaceMKFIAIALIGAAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*ANRSERSTSVFKQNNLSWLEITK*
JGI20151J14362_1014798613300001346Pelagic MarineMKFAIALIGAAAATAIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
JGI20158J14315_1013474113300001355Pelagic MarineMKFIAIALIGAAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
JGI20158J14315_1013629613300001355Pelagic MarineMKFTALAALVATVYAQEDKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*AANA*FEKILNSI*
JGI20158J14315_1019890513300001355Pelagic MarineDFDNSTGIWKGDWAAYKAGHPHDQDCSVAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPVQSAGLAPDH*
ACM39_11702813300001822Marine PlanktonMKTAIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCFESWECRGARLCERGGWCSGFDGCEGSPLPAQAPGVSYTH*
GOS2248_1008624713300001970HypersalineMLYHGDWNFYRKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSNTH*
B570J29032_10928640313300002408FreshwaterMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*GI*KYYIFKKESLIVKSIDTRLLK*
JGI24768J34885_1027153213300002447Freshwater And SedimentPATREDYDNAAALWKNDWAKYRAAHPNDQDCAISESDNWKGAQQCSQSWECRGARLCERGGWCSGYXGCEGTPLPDQAPGLAPDH*
B570J40625_10109521013300002835FreshwaterMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*
JGI26079J46598_103807213300003216MarineMKFLSIAAIVALASASAGEEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH*
Ga0008458J53046_10159113300003677SeawaterKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0008459J53047_100404813300003683SeawaterNQTKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0031658_108086413300003860Freshwater Lake SedimentLVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*
Ga0055584_10226854313300004097Pelagic MarineNGKELWKGDWSKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0071100_105972313300005043Marine Subseafloor AquiferDDKKNATAAAFGDEKPCAAAAFTEIPDGEDKLHFFDFDNAKMLYKGDWNAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSNTH*
Ga0066831_1007907723300005516MarineMKFAVLAAIVATVYAIPDGEDKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPIQAPGVSYTH*
Ga0066831_1010438313300005516MarineMKFLALLIVAVNASTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH*
Ga0066831_1016611213300005516MarineMKFLALLVATVSAASDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0049082_1017129113300005584Freshwater LenticMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*GSSKCNIFKNERLIVKPIE*
Ga0066841_1008034523300005599MarineMKFIALLISAAAAMHATDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0066840_1007554613300005608MarineMKTAFAVIVALVATVSATADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0078894_1153046013300005662Freshwater LakeMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*GI*KCKLFKNEHLIEKLIE*
Ga0075502_169840213300006357AqueousMKTAIAVIAALVAIVPSVEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0075504_138313113300006383AqueousRINNQTKMKTAIAVIAALVAIVPSVEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0075509_151104013300006390AqueousIINNQTKMKTAIAVIAALVAIVPSVEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0075517_101111323300006393AqueousMKSFIIAALALVVSAETVETQSADDKLHFFDFDNAKMLYKGDWNLYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSFTH*
Ga0075517_155028113300006393AqueousKMKTAIAVIAALVAIVPSVEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0075488_154568713300006397AqueousTMKVLAIAALLGAAVATQEDPDKLHFFEFDNAKMLYKNDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGTSYTH*
Ga0075503_101541813300006400AqueousDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0075506_180227413300006401AqueousINNQTKMKTAIAVIAALVAIVPSVEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0075471_1039052313300006641AqueousMAALLAVASAETTQDDGKLHFFDFDNAKMLYHGDWNFYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGYDGCEGSPLPTQAPGLSATH*
Ga0075467_1040481513300006803AqueousMKFATIALMGVVAASADDKLHFFDFDNAKMLYKGDWNAYKTSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0105019_122469613300007513MarineMKFIALISAAAAMHATDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0105019_122723413300007513MarineMKFIALALLSVVSASSDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0105019_123178713300007513MarineMKFLALAALLATTEAVADDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0105050_1046640313300007516FreshwaterMKSIVIAALLAVAAASNTVVPDGEDKLHFFDFDNAKMLYKGDWSAYKQTRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0102881_116188423300007551EstuarineARQAPVANATPAAYARQAPVANATAPVFAMIPDGQDKLHFFDFDNAKMLYKGDWNAYKATRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0102818_105228413300007552EstuarineMKFIIAALLGLTTTVSAQADKLHFFDFDNAKMLYKGDWNAYKVSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0102895_117392423300007629EstuarineANATAPVFAMIPDGQDKLHFFDFDNAKMLYKGDWNAYKATRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0102901_122766413300007634EstuarineAYARQAPVANATAPVFAMIPDGQDKLHFFDFDNAKMLYKGDWNAYKATRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0102951_109613623300007725WaterMKIAVIAALGLMSVSAVPDGQDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0105749_108453713300007864Estuary WaterMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0105738_106089013300007953Estuary WaterKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0105740_105331713300007955Estuary WaterDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0105742_101553523300007957Estuary WaterLKMKIAIIAALGLVVSAIPDGQDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0105745_120465013300007972Estuary WaterMKFTAVAVLATLIATSSAQDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSTTH*
Ga0114343_121110713300008110Freshwater, PlanktonVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*
Ga0114347_121756013300008114Freshwater, PlanktonKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*
Ga0103951_1053752513300008832MarineMKSFVIAALLATATAIVSDVPKGEDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGYDGCE*
Ga0103732_107499313300008929Ice Edge, Mcmurdo Sound, AntarcticaIAIAIIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH*
Ga0103732_107526213300008929Ice Edge, Mcmurdo Sound, AntarcticaMFEFDNAKMLWKNDFSAYEGVRRAADDSHDCKLAESDNYYGAQQCKYQWECRGARTCERGGWCSGYDGCEGTPLPMQAPGLMADH*
Ga0103734_106268413300008931Ice Edge, Mcmurdo Sound, AntarcticaAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0103734_107721913300008931Ice Edge, Mcmurdo Sound, AntarcticaKFIAIAIIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH*
Ga0103735_105583713300008932Ice Edge, Mcmurdo Sound, AntarcticaMKFIAIAIIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH*
Ga0103735_106761413300008932Ice Edge, Mcmurdo Sound, AntarcticaMKFIAIAIIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0103736_104552513300008933Ice Edge, Mcmurdo Sound, AntarcticaNNYYPKNTKKQNNKTIMKFIAIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH*
Ga0103736_105212813300008933Ice Edge, Mcmurdo Sound, AntarcticaNKPKKMKFIAIAIIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH*
Ga0103739_105500513300008936Ice Edge, Mcmurdo Sound, AntarcticaMKHLELGLGVGILHIHRSRSTVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH*
Ga0103739_106651113300008936Ice Edge, Mcmurdo Sound, AntarcticaKPIMKFIAIALVATAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKSSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0103741_101933113300008938Ice Edge, Mcmurdo Sound, AntarcticaMRSFIALIAAVVAVSASTVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0103741_111590913300008938Ice Edge, Mcmurdo Sound, AntarcticaMKFIAIAIIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0104259_103863113300008958Ocean WaterTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0104259_103904813300008958Ocean WaterAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0104258_107262613300008993Ocean WaterAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0104258_110375923300008993Ocean WaterKIAVLAALGLMSSVSAQSDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0103706_1014413013300009022Ocean WaterKMKTAFAVIAALVATVPTVDAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0102892_110340413300009057EstuarineSRQAPVVNATPAAYARQAPVANATAPVFAMIPDGQDKLHFFDFDNAKMLYKGDWNAYKATRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0115566_1032450913300009071Pelagic MarineMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115566_1035129613300009071Pelagic MarineMKIAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0115566_1037522213300009071Pelagic MarineMKFLTLAIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKSSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH*
Ga0115566_1058104013300009071Pelagic MarineMKFAIAIAAIGFAAAQEDDADKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0114966_1044036713300009161Freshwater LakeMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAETDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*
Ga0114995_1066057613300009172MarineMRTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0114995_1078456113300009172MarineKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0114959_1043052413300009182Freshwater LakeMKFIAALALLATASAVQMEDDKLHFFDFDNAKMLYKGDWAAYKRSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGILPTH*
Ga0103743_105110613300009195Ice Edge, Mcmurdo Sound, AntarcticaTLFNLLVWLQAISSTKLHLKINLNKQKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0103873_108445823300009265Surface Ocean WaterMAAFFFIRFLAFAALIATTTATLGDEDKLHFFDFDNAKMLYKGDWASYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0103876_107365113300009269Surface Ocean WaterLAALFATAEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0115005_1124675813300009432MarineMKFTAVAVLATLIATSSAQDDKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0115008_1044926213300009436MarineMKFIALLISAAAAMHATDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH*
Ga0115008_1054944113300009436MarineMKSIVIAALLAVVSCSNQDVPKGEDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGYDGCEGSPLPTQAPGLSATH*
Ga0115008_1095623513300009436MarineSSATADDKLHFFDFDNAKMLYKGDWASYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0115007_1039947913300009441MarineMKFIALLLVAVASATATNDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPT*
Ga0115007_1053566313300009441MarineMKFLALLVAAVAADEKIHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH*
Ga0115007_1057234313300009441MarineALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115007_1077914613300009441MarineMKFLALLVAAVAADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0115572_1032442213300009507Pelagic MarineKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115099_1020588513300009543MarineKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115099_1070441213300009543MarineMKFIAAALIAAVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115099_1100493213300009543MarineKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115013_1103864813300009550MarineSIIKNLILNKMKFIALLIAAVAASTDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0115013_1149656013300009550MarineDFDNAKMLYKGDWAAYKTSRPHDNDSSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH*
Ga0115103_129390813300009599MarineMKIAIIAALGLVVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGTPLPTQAPGVSYTH*
Ga0115103_176457713300009599MarineHIINNQTKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115102_1065422413300009606MarineTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115104_1046537223300009677MarineNIKITMKFIALLIASAYAATDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0115104_1067150913300009677MarineKMKTAIAVIAALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115104_1095898313300009677MarineTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWGCRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115105_1033283523300009679MarineMSKNASGNATAFAEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSTTH*
Ga0115105_1096058213300009679MarineKHLKMKFAVLAAIVATVYAIPDGEDKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPIQAPGVSYTH*
Ga0115000_1041391113300009705MarineNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0123373_17259413300009732MarineAVIALLGAVAANSQDVPKGEDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGTPLPTQAPGVSYTH*
Ga0123377_104465913300009735MarineKIAILAALGLVVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGTPLPTQAPGVSYTH*
Ga0123361_108805313300009741MarineKMKIAILAALGLVVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGTPLPTQAPGVSYTH*
Ga0115001_1026892323300009785MarineMRTAFAIIAALVAVSATEIKDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115001_1048548813300009785MarineTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAKSDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0115001_1070953013300009785MarineMKFIALALIAVSSATADDKLHFFDFDNAKMLYKGDWASYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0115012_1158161423300009790MarineMKTAFAVIAALVATVAATEIADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0132193_10487813300009864Meromictic PondMCLILDVAGMTQVTAGWEIINFKKMKIAVIAALGLMSASAVPDGQDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0129322_105531813300010306AqueousKMKIAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0102883_124690613300010312EstuarineDYNNAKDLWKGDWKKYRAAHPNDQDCSISESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLSTDC*
Ga0129323_103078413300010404AqueousKIAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0138324_1061317013300010987MarineKMKTAFAVIVALVATVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0138324_1070833523300010987MarineKMKTAFAVIAALVATAAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0136599_103440713300012030Saline LakeMKSAIIALIGAVVASTQEVPTGVDKLHFFDFDNAKMLYKGDWNSYKVSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH*
Ga0123369_100281713300012370MarineAVIALLGAVAANSQDVPKGEDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0138263_146721113300012415Polar MarineGNLIKNNKPIMKFICIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKSSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPT*
Ga0129328_109900713300012472AqueousIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129347_120347913300012504AqueousMTRSAALVATVSATEIQDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129325_131058513300012516AqueousKMKIAVLAALGLMSSVSAQAGGDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0129349_116341013300012518AqueousAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129349_119527613300012518AqueousKMKTAIAVIAALFVTVNAAEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129344_127325413300012520AqueousKMKIAVIAALGLMSASAVPDGQDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0129350_115270813300012523AqueousKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129331_124753913300012524AqueousIKMKFIALALIAVSSATADDKLHFFDFDNAKMLYKGDWASYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0129353_183307813300012525AqueousKTAIAVIAALFVTVNAAEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNGKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129353_183430213300012525AqueousKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129352_1011459813300012528AqueousMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129352_1085677413300012528AqueousHIINNQTKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0163180_1043852223300012952SeawaterMRFIALAFLAVVSASTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0163180_1051200413300012952SeawaterMFLLFTIININNFYKLILTPKMKFIALAALFATAEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0163180_1158921213300012952SeawaterLVLAALSATTEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH*
Ga0163180_1182707613300012952SeawaterMKFNAIVMLGAVTAIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH*
Ga0163111_1212323213300012954Surface SeawaterLHFFEFDNAKMLYKNDWASYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129340_122353913300012963AqueousAIAVIAALVAIVPSVEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129346_125290713300012965AqueousIAALVATVSATEIQDGEDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129341_130115613300012966AqueousKMKTAFAVIAALVATVSATEIQDGEDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0129332_127447013300012969AqueousINNQTKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH*
Ga0164293_1099336413300013004FreshwaterALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*
Ga0170791_1157226313300013295FreshwaterFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH*
Ga0182088_101086413300016703Salt MarshLKKMKFAAIAALCLASVSANTDDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182074_129433913300016735Salt MarshMKFTAVAVLAALMSTTAAGDDEKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0182047_139871513300016737Salt MarshKMKFAAIAALCLASVSANTDDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182047_139916313300016737Salt MarshTLKMKIAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182047_146746513300016737Salt MarshKIAVLAALGLMSSVSAQAGGDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182079_164844113300016741Salt MarshKMKFAIAALLGFVAAGDGDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0182052_131981623300016742Salt MarshLLVLKFAAIAALCLASVSANTDDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182055_115964313300016746Salt MarshFAAIAALCLASVSANTDDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182043_111739213300016748Salt MarshIAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182053_123626813300016749Salt MarshLKMKIAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182053_150998713300016749Salt MarshSKMKIAVLAALGLMSSVSAQAGGDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182062_108159913300016751Salt MarshMKFIIALLGAAAAADIPTGQDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182046_114443013300016776Salt MarshMKIAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0181404_113685123300017717SeawaterMKTAFAVIAALVATVSASGIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0181390_118585523300017719SeawaterMKFLALLIAAVAADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0181419_110737313300017728SeawaterMKFALAIAAIGFAAAQDDADKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0181431_108207713300017735SeawaterMKFIALLLSAAYAATDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0181409_123063313300017758SeawaterMKTAFAVVAALVAVVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0181410_122013523300017763SeawaterMRVIAIAAILGAACAEDPDKLHFFEFDNAKMLYKNDWASYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGTPLPTQAPGVSYTH
Ga0187221_106247113300017769SeawaterMKTAIAVIAALFVTVNAVEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0181425_125196713300017771SeawaterEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0181430_112934113300017772SeawaterMKFIVSLAALMSVSYAQEEKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSNTH
Ga0169931_1068473713300017788FreshwaterMKFIALFALVASASAAPKDADKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGSXKCDLFKNERLIGKKIDKKIIFDNSS
Ga0181584_1090547113300017949Salt MarshMKFAIAALLGFVAAGDGDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0181577_1039861813300017951Salt MarshMKFAAIAALCLASVSANTDDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0181590_1110367513300017967Salt MarshPKTPKPLGSDYLIGDGLIYIIIKMKVLSLAAILALATATEAPEGADKLHFFEFDNAKMLYKGDWSLYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0181606_1053596413300018048Salt MarshMKSFVIAALLAVAAATEQVVPKGEDKLHFFDFDNAKMLYKGDWNAYKRSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0181560_1032235013300018413Salt MarshMKFLTIAALVALASASAGEEDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0181558_1031013013300018417Salt MarshMKIAVLAALGLMSSVSAQAGGDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0181593_1052639013300018423Salt MarshMKVLAIAALLGAAVATQEDPDKLHFFEFDNAKMLYKNDWAAYKKSRPHDNDCSIAESDNWKGAQQCTESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0181593_1064733913300018423Salt MarshMKFAIAALLGFVAAGDGDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGYDGCEGSPLPTQAPGLSATH
Ga0181591_1099060313300018424Salt MarshPKTPKPLGSDYLIGDGLIYIIIKMKVLSLAAILALATATEAPEGADKLHFFEFDNAKMLYKGDWSLYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAAGLSPTH
Ga0181568_1118646023300018428Salt MarshMKFIAIAMLGAVAAIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0193334_10421513300018502MarineDAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192960_10617513300018515MarineMGINKQTKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0188858_10871213300018567Freshwater LakeKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193474_101847713300018575MarineTWGYKLNLITMKFIALALLGLVSASTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192844_102060413300018593MarineADIHDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193182_102377113300018602MarineMGIINQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0188862_102145013300018622Freshwater LakeMKFLALIAATAAMHATDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192842_103329213300018625MarineTWGINKQTKMKTAIAVIAALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193355_101675913300018628MarineMKTAFAVIVALVATATATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193355_102059713300018628MarineHGELIIKLIKMKTAFAVIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193352_105065213300018644MarineMKTAFAVIAALVATVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192969_104782313300018649MarineMGQSTWGINNQTKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYT
Ga0192969_105009513300018649MarineMKFTPLAVLVALVATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192846_103578413300018655MarineMKFIAIALLGAAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0193166_103417613300018674MarineMKFIAIAMLGAVAAIPTGQDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193007_105562213300018678MarineMKFIAALLVATVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLAPTH
Ga0192983_104858613300018684MarineTWGINNQTKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192983_106267313300018684MarineHGDNKLNYLQMKFTPIAVLAALVATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPT
Ga0192944_102772913300018692MarineMGKINLNKQKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192944_103613613300018692MarineHGIINKQTKMKTAFAIIAALVATVAAXXXXHGELIIKLIKMKTAFAVIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192944_105070713300018692MarineHGELIIKLIKMKTAFAVIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192944_105447813300018692MarineHGELIIKLIKMKTAFAVIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH
Ga0192944_106408213300018692MarineMKFIAIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192967_106386113300018730MarineMRSFIALIAAVVAVSASTVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192967_107546013300018730MarineMKFIVALVAAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH
Ga0192967_107894513300018730MarineMKFIVALVAAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192967_107918213300018730MarineTWGNLKQNNKTIMKFIAIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0193544_102683513300018735MarineATKMKFLLAALVATVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192974_108018713300018739MarineKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193138_104937713300018742MarineSQMKFIAAALIAAVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193138_105351813300018742MarineKMKTAFAVIAALVATVPTVDAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193138_105447713300018742MarineKTAFAVIAALVATAAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSLAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193000_106051413300018745MarineTWGINKQTKMKTAFAVIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193000_106051713300018745MarineTWGINKQTKMKTAFAVLFALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193000_106309513300018745MarineHGELINKMKFVALALIATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193000_107054513300018745MarineTEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192963_107172713300018762MarineMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192827_107524013300018763MarineTWGIIKQTKMKFLLAALVATVAAIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192827_109123813300018763MarineGIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192827_109389613300018763MarineHGEIIIKQTKMKTAIAVIAALVATVAATGIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193031_107360013300018765MarineTWGINKQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193031_108026913300018765MarineTWGINKQTKMKFIALAALVATVSAIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193031_109000113300018765MarineDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193031_109207913300018765MarineTWGINKQTKMKFIALAALVATVSAIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLAPTH
Ga0193031_109268713300018765MarineTWGINKYKMKFILAALLGLAAAGDDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193181_106616813300018766MarineKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192832_105387913300018782MarineGINNQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193124_106167413300018787MarineKTAFAVVAALVAVVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193124_106210513300018787MarineKMKTAFAVIAALVATAAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193117_108047613300018796MarineKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192824_110399113300018801MarineANLTANVTANTTANATAAFVEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193183_107755313300018811MarineTWGINQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193053_107294613300018823MarineKMKTAFAVIAALVATVPTVDAQADKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193191_108101813300018830MarineKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192949_110522413300018831MarineKQKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0194240_102393113300018832MarineMKFTPIAVLAALIATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193219_107304613300018842MarineAILAALGLVVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193253_110719513300018846MarineMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193253_113273213300018846MarineFYIINQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192970_109488813300018848MarineLKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192970_109766713300018848MarineQKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193284_106384913300018852MarineTWGKYKMKFILATLLGLAAAGADDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192958_115712813300018853MarineMKSIVIAALLAVVSCSNQDVPKGEDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGYDGCEGSPLPTQAPGLSATH
Ga0193475_106625513300018855MarineMKFIALAALFATAEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193475_107789213300018855MarineEFNLYKLNLITMKFIALALLGLVSASTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193308_108698413300018862MarineATQDSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192977_110764713300018874MarineKMKSAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193027_112017213300018879MarineKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193337_103973713300018880MarineTWGNNQTKMKTAFAVIAALVATVPTVDAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193258_122863813300018893MarineAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193090_110925313300018899MarineLQMKFTPIAVLAALVATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192868_1008853713300018913MarineHGDIIIKILQMKFTPLAVLVALVATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192989_1013974613300018926MarineFHIINNQTKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192989_1013974913300018926MarineFHIINNQTKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192989_1014507413300018926MarineNKLIIMKFLAVALLGALQATDIPSGQDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193260_1014049513300018928MarineMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193260_1014540913300018928MarineMKFLALAALIATTEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193260_1014903113300018928MarineLVLAAILGFAQAGDDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193531_1032199713300018961MarineMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193178_1007744113300018967MarineKTAFAVIAALVATVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193178_1008025213300018967MarineKTAFAVIAALVATVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192894_1029541913300018968MarineMKFIAIALLGAAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0192894_1031014313300018968MarineMKFALLISAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0193143_1017703913300018969MarineHGIINNQTKMKTAIAVIAALFVTVNAVEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193143_1019184613300018969MarineHGIINNQTKMKTAIAVIAALFVTVNAVEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192873_1037007713300018974MarineHGELINNMKFTPIAVLAALIATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193006_1018735313300018975MarineTWGKLFLKQTKMKIAFAALMLVAITATEVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193006_1021159513300018975MarineMKFIAALLVATVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193254_1013285913300018976MarineNNQTKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193254_1014940413300018976MarineNNQTKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193353_1021381613300018977MarineMGIIIKINMKFLSIALIGALSATDIPAGQDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193540_1017119523300018979MarineTWGINNQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192961_1020547313300018980MarineTTWGINKQTKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192961_1024492413300018980MarineMKFAIALIGAAAATAIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192961_1025386413300018980MarineMKITALAVIAAVMTSTVSATEGDEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0192968_1015058613300018981MarineTWGKINLNKQKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192947_1023981813300018982MarineTWGYNLIKKYTIMKFIAIALVATAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0192947_1025138813300018982MarineHGENNFYKLILKTMKFLALLVAAVAADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192947_1025472013300018982MarineMGNAEYMGKINLNKQKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192947_1025908013300018982MarineMKFIALALVAIVSAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192947_1027474813300018982MarineMKFIAIALVATAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192947_1027853013300018982MarineNMGIINKQTKMKTAFAIIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192947_1029348113300018982MarineTWGYNLIKKYTIMKFIAIALVATAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0193136_1022141113300018985MarineMGNINQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSLAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193275_1024399413300018988MarineMKFLTLAFLAAVNADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193030_1022810213300018989MarineMKFIAAALIAAVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193030_1023905913300018989MarineSTWGINNQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193030_1030040613300018989MarineMKFIAAALIAAVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0193030_1030965313300018989MarineINAEYMGNLKIINMKFIAIAILGALQATDIPSGQDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLAPTH
Ga0193030_1031055913300018989MarineHMGTIKFIKTMKFIALALLSVVTASSDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193257_1021964213300018997MarinePSQLPRINQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193034_1013663313300019001MarineTWGINKQTKMKFIALAALVATVSAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193034_1019923813300019001MarineMKFIAIALLGAAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLAPTH
Ga0192880_1018346623300019009MarineMKFAAIAIIGAIQATDIPSGQDKLHFFDFDNAKMLYKGDWASYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLAPTH
Ga0193044_1024656913300019010MarineMKFIAIALLGAAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193044_1025143313300019010MarineHGEIIKLNMKFLALAAILGFAAAGDDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192982_1029857313300019021MarineMKLLALAAVCLATTEVAADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0192982_1030224113300019021MarineMKSFVIVALLGLTAAVESADDKLHFFDFDNAKMLYKGDWSAYKHSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0192982_1030406613300019021MarineMGIIIKFLQMKFTPLAVLVALVATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192982_1033564113300019021MarineMKFIVALIAAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0192951_1031238913300019022MarineHGELIIKLIKMKTAFAIIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192951_1034499713300019022MarineMGKINLNKQKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192909_1016906913300019027MarineMGKINFNKTKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192909_1027715413300019027MarineAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193516_1019533813300019031MarineMLDELAMTNDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193516_1023917113300019031MarineMKFAVLAAIVATAYAGDGEDKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPIQAPGVSYTH
Ga0193516_1024110913300019031MarineMKFAVLAAIVATAYAGDGEDKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193516_1030008813300019031MarineMKFIALALLSVVTASTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGYDGCEGSPLPTQAPGLSATH
Ga0193516_1030385413300019031MarineMKFIALALLGLVSASTDDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192869_1027568013300019032MarineMKFIALAALFALAEATADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTHXDPIXDHEKEQKLIDQSFND
Ga0192869_1034976513300019032MarineMKFIALAALFALAEATADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQFAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192869_1039509213300019032MarineHGEIIIKQTKMKTAIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192869_1042565313300019032MarineTWGINKKTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192869_1049629323300019032MarineMGIIKILQMKFTPLAVLVALVATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPHGAPGLSNTH
Ga0193037_1035880113300019033MarineMKFLALLVASAAAMTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193037_1037182713300019033MarineTWGINNSIMKFALLIAAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0192945_1009574913300019036MarineMKFTPIAVLAALIATGSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192945_1021927713300019036MarineVSTQSTWGINKQTKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192945_1025931013300019036MarineMKFLALLVAAVAADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192945_1026581313300019036MarineMKFIAIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0192945_1029702113300019036MarineMGNNLYKLKNIKMKFIALAALFATAEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192886_1026579213300019037MarineTWGIIKQTKMKTAIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193123_1039874113300019039MarineMKTAFAVIAALVATAAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192857_1031040413300019040MarineMKFIAIALLGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0193336_1053288313300019045MarineTWGINNQTKMKTAFAVIAALVATVPTVDAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193336_1054195513300019045MarineTWGIIIKQTKMKTAFAVIVALVATVSATADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193336_1061507213300019045MarineMKSFVIAALLATATAVSQDVPKGEDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGYDGCEGSPLPTQAPGLAATH
Ga0192981_1015103713300019048MarineMKFIALALIAVSSATADDKLHFFDFDNAKMLYKGDWASYKKTRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192981_1021084513300019048MarineMKFIALALIAVVEATADDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0192981_1021312513300019048MarineMKFTILLLSAVAASTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0192981_1033699213300019048MarineMKFIAALLIASVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192966_1031168713300019050MarineMRSFIALIAAVVAVSASTVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0192966_1031638413300019050MarineHGNAEYMGNLKQNNKTIMKFIAIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192826_1026704513300019051MarineMKFVIAALVATVAASGIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192826_1030582513300019051MarineMGKIIIKQTKMKTAIAVIAALFVAVQATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192826_1033015313300019051MarineNMGNINQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192826_1033036623300019051MarineMRTAFAIIAALVAVSASEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192826_1034349313300019051MarineHGESNKLIIMKFLAVALLGALQATDIPSGQDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192826_1034937613300019051MarineMGNKNFLSKQKNMKSFIVAALLAIVTVEAAESHDDDKLHFFDFDNAKMLYKGDWGLYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLAPT
Ga0192826_1035198813300019051MarineHGDIINKQTKMKTAFAVIAALVATVAATGIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192826_1037509113300019051MarineHGESNKLIIMKFLAVALLGALQATDIPSGQDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0192992_1032433813300019054MarineGINAEYMGNIINNSIMKFALLIAAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH
Ga0188866_102952813300019095Freshwater LakeMAVVQQGDDDSKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0188866_102979313300019095Freshwater LakeNNQTKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0188866_103132513300019095Freshwater LakeKMKTTIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193153_102790213300019097MarineMGIINKQTKMKTAIAVIAALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193153_103271713300019097MarineMKFIAIALLGAAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLAPTH
Ga0192946_105555113300019103MarineMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192972_107922813300019108MarineKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193243_106023313300019116MarineMGNLINNKIKMKFIAAAILGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193054_107373413300019117MarineHGDIINKLTKMKTAFAVIAALVATVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193157_102771013300019118MarineMKFVALALIATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193157_103255913300019118MarineTWDIIQSIKIKFIKTMKFIALALLSVVSASSDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193157_103326513300019118MarineMKFIAAALIAAVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERG
Ga0193157_103601113300019118MarineGDNLLIHFNIIKMKFFVLAALALATTEADDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0193157_103639913300019118MarineMKFIALALVATVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0193157_103681513300019118MarineMKFIALALLSVVSATTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192980_108123813300019123MarineMKFIALALIAVVEATADDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0192980_108539913300019123MarineTWGINKQTKMKTAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0192980_109212013300019123MarineMGNLIKNNKLIMKFIAIALVATAAAADIPTGQDKLHFFDFDNAKMLYKGDWAAYKSSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0192980_109528813300019123MarineMKFIAIAIIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH
Ga0192980_109610723300019123MarineMGNNIYYFKMKFIALALIAVSSATADDKLHFFDFDNAKMLYKGDWASYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0193436_105515013300019129MarineTWGINNQTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0188881_1002678023300019146Freshwater LakeMKFIAIALIGAVAANPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0188881_1002937813300019146Freshwater LakeMKFAAIAALCLASVSANTDDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGTPLPTQAPGLSYTH
Ga0188870_1014062813300019149Freshwater LakeKQTKMKTTIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0188870_1014705713300019149Freshwater LakeKMKTAIAVIAALFVTVNAVEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0188870_1015407613300019149Freshwater LakeLIKMKFIALALIAVSSATADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0182066_105748213300019262Salt MarshLLGAVSALKGDDEKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182061_105015823300019266Salt MarshKFAAIAALCLASVSANTDDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182059_119042513300019272Salt MarshAVIALLGAVAANSQDVPKGEDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0182059_127026813300019272Salt MarshIMKFIIALLGAAAAADIPTGQDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182075_186090813300019282Salt MarshKMKFIVAALLAVASASEQVVPKGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0182044_110449913300020014Salt MarshKIAIIAALGLMSVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0182044_130337513300020014Salt MarshAIAVIAALVAIVPSVEAQTDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0194113_1065020013300020074Freshwater LakeMKFIALFALVASASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGIXKCKLFKKRLLIEKLIE
Ga0194113_1073662113300020074Freshwater LakeMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGNXKCNLFKNERLIGKKFDKKIIFDNFS
Ga0206125_1019863813300020165SeawaterMKFIAIALIGATAAVEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0206128_133148013300020166SeawaterTKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0206127_126747013300020169SeawaterMKFLAIALVGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0206129_1018996713300020182SeawaterMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0206129_1023489713300020182SeawaterMKFICIALIGAAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0194115_1029317013300020183Freshwater LakeMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGIXKCKLFKKRRLIEKLIE
Ga0194132_1036143413300020214Freshwater LakeMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGIXKCKLFKKKLLIEKLIE
Ga0211686_1020200413300020382MarineMKSAFAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0194126_1066747413300020603Freshwater LakeMKFIALFALVASASAATKDDDKLHFFDFDNAKMLLQGXLAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGIXKCKLFKKRLLIEKLIE
Ga0206677_1019518913300021085SeawaterMKFIAIALLGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTHXAVXXAQADHARSLFKTDNLTWYETSE
Ga0206677_1022533513300021085SeawaterMKFIAIALLGVATAAEIPTGQDKLHFFDFDNAKMLYKGDWASYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0206679_1064393713300021089SeawaterMKFIALALVATVAAVPDGEDKLHFFDFDNAKMLYKGDGAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGYDGCEGTPLPDQAPGLSHD
Ga0206687_105571013300021169SeawaterTKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0206687_156536613300021169SeawaterMKSFILAALLAIATAEHVDIETADDKLHFFDFDNAKMLYKGDWNLYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSFTH
Ga0210296_107249913300021305EstuarineTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0210301_138586313300021325EstuarineMKFLSIAAIVALASASAGEEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSTTH
Ga0206688_1008186413300021345SeawaterKFIAIALLGAVAAIPAGQDKLHFFDFDNAKMLYKGDWASYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0206688_1053409213300021345SeawaterKTKMKFIAIALLGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH
Ga0206695_101226413300021348SeawaterTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0206695_136780213300021348SeawaterMKFLALLVATAAAMRVEDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0206692_133838113300021350SeawaterVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0206693_135903213300021353SeawaterKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0206693_145780913300021353SeawaterALVACVSAIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0206689_1011285913300021359SeawaterALLDATVAAVPDGEDKLHFFDFDNAKMLDKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0206689_1043551613300021359SeawaterMKFIAALLVATVAAGSDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0213859_1035634013300021364SeawaterTKLHFFDFDNAKMLYKNDWNVYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGYDGCEGTPLPDQAPGLAPDH
Ga0206123_1020565313300021365SeawaterMKFLTLAIGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKSSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH
Ga0206123_1021490313300021365SeawaterMKFTALAALVATVYAQEDKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0213865_1029510913300021373SeawaterMKTFVIALLGMAAATVQNVPSGEDKLHFFDFDNAKMLYKGDWNSYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGYDGCEGSPLPTQAPGLSATH
Ga0063132_10256613300021872MarinePKMKFLALAALLATTEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0063132_10788813300021872MarineKMKTAFAVIAALVATVPTVDAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063137_101267713300021892MarineMKTAFAVIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063137_101554313300021892MarineKMKTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063142_103137213300021893MarineAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063136_104163613300021896MarineKMKTAFAVLVALVATVSATADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063136_105554913300021896MarineKMKTAFAVLFALVASVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063086_101875013300021902MarineKMKFIALALVAIVSAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063135_101813113300021908MarineIHQTKMKTAIAVIAALVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063135_102653913300021908MarineKTAFAVIAALVATVSASGIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063133_103510413300021912MarineKMKTAFAVIAALVATVAATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063133_103722313300021912MarineMKTAFAVIVALVATVSATADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063103_101930513300021927MarineQMKFTPLAVLVALVATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0063103_106386513300021927MarineTAFAIIAALVAVSATEIKDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063138_101929413300021935MarineKMKTAFAVIVALVATVSATADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0063101_105158813300021950MarineNKKMRTAFAIIAALVAVSATEIKDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0222717_1031626613300021957Estuarine WaterMKFLALIAATAAMSTADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0222718_1033136113300021958Estuarine WaterMKFIAIALIGAAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0222716_1040422513300021959Estuarine WaterMKFIAIALLGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSVTH
Ga0222713_1048101113300021962Estuarine WaterMKFAIAALLGIVAAGDGDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGYDGCEGSPLPTQAPGLSATH
Ga0222719_1082278813300021964Estuarine WaterMKFLSIAAIVALASASAGEEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0210312_11356113300022367EstuarineKLFIQQKMKSFIIAALAIVFSAETVENQAADDKLHFFDFAKATMLYKGDWNLYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0214917_1034223313300022752FreshwaterMKFIAALALLATASAVQMEDDKLHFFDFDNAKMLYKGDWAAYKRSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGILPTHXGHS
Ga0255781_1024640923300022934Salt MarshMKFTPIAVLAALIATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0255780_1050524013300022935Salt MarshASENATAFFAEIYEAANATAPEGVDKLHFFDFDNAKMLYKGDWSFYRKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAAGLSPTH
Ga0214923_1036851213300023179FreshwaterMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGS
Ga0228679_102419813300023566SeawaterAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQRVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0232113_103668313300023679SeawaterKTAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0228686_105012313300023685SeawaterLTIMKFIAIALLGVATAAEIPTGQDKLHFFDFDNAKMLYKGDWASYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0232112_104322913300023693SeawaterNTEMKFLALLIAAVAADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0228683_102770313300023694SeawaterKMKTAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0228687_104402313300023696SeawaterKMKTAFAVVASLVSVVSATEIPVGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0228682_102706423300023698SeawaterKMKTAIAVIAALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0209634_116911113300025138MarineMKFIAIALLGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRVARMCERGGWCSGFDGCEGSPLPTQAPGVSTTHXAVXXAQADHARSLFKTDNLTWYETSE
Ga0209634_127974413300025138MarineMKFIAAALLGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKTSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0209716_107053613300025626Pelagic MarineMRTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0209198_106787813300025640Pelagic MarineMKSFAIAALVAVVAAETTTIQDDADKLHFFDFDNAKMLYKGDWSFYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0208784_113598613300025732AqueousMKYAVIAALMAVASAERTQDDKLHFFDFDNAKMLYHGDWNFYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGYDGCEGSPLPTQAPGLSATH
Ga0208544_1024983113300025887AqueousMKFATIALMGVVAASADDKLHFFDFDNAKMLYKGDWNAYKTSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0209335_1027344213300025894Pelagic MarineMKFTAVAVLATLIATSSAQDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0209425_1036169523300025897Pelagic MarineMKFAIAIAAIGFAAAQEDDADKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0208276_103616023300026166MarineMKFIAIALLGAAAAADIPTGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0208275_106218213300026182MarineMKFLALLVATVSAASDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0208275_109269223300026182MarineMKFAVLAAIVATVYAIPDGEDKLHFFDFDNSKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPIQAPGVSYTH
Ga0247557_101602713300026403SeawaterYTCLGVIYIINKQTKMKTAFAVIAALVATVAASGIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247581_108307613300026420SeawaterMKIAIIAALGLVVSAIPDGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247569_109552713300026421SeawaterNIMKFIAIAMLGAVAAIPTGQDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0247591_107748513300026434SeawaterMKTAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247607_107911613300026447SeawaterVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247594_106391013300026448SeawaterNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247594_106700413300026448SeawaterTEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247593_108848013300026449SeawaterVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247593_110088513300026449SeawaterTTIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247578_108726513300026458SeawaterKFFALLIASAYAATDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0247578_112822613300026458SeawaterVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247600_110637213300026461SeawaterKTAIAVIAALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247600_111442713300026461SeawaterFAIAAIGFAAAQDDDADKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247588_112040113300026465SeawaterTAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247598_112713713300026466SeawaterIKMKTAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247603_111703213300026468SeawaterKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247599_113272013300026470SeawaterKMKFIALAALFATAEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0247602_113799513300026471SeawaterKTAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247571_109965923300026495SeawaterKFIALAALFATAEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0247571_114009313300026495SeawaterMKTAIAVIAALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247605_114978913300026503SeawaterPAMKTAIAVIAALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247605_115655913300026503SeawaterAFAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247605_117332913300026503SeawaterLIKMKFIALAALFATAEAVADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0247587_110839213300026504SeawaterKTAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0247587_111984913300026504SeawaterGIELMGMKTAFAVIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0208020_104743213300027159EstuarineMKFIIAALLGLTTTVSAQADKLHFFDFDNAKMLYKGDWNAYKVSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0208799_103797013300027194EstuarineMKFIAIAMLGAVAAIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0208799_105388323300027194EstuarineMKFFAIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWASYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGYDGCEGTPLPNQAPGLAADC
Ga0208442_106183223300027229EstuarineAAYARQAPVANATPAAYARQAPVANATAPVFAMIPDGQDKLHFFDFDNAKMLYKGDWNAYKATRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0208804_102394123300027235EstuarineRQAPVANATAPVFAMIPDGQDKLHFFDFDNAKMLYKGDWNAYKATRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0208796_106550423300027308EstuarineMKFFAIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWASYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0208966_119699113300027586Freshwater LenticMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGSSKCNIFKNERLIVKPIE
Ga0209188_122074513300027708Freshwater LakeMKFVYLAALVATVSAAQKKDDDKLHFFDFDNAKMLYKGDWASYKQSRPHDNDCSIAETDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0208305_1031906013300027753EstuarineMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCSQSWECRGARLCERGGWCSGYDGCEGTPLPEQAPGLSRDE
Ga0209830_1015666623300027791MarineMRTAFAIIAALVAVSATEIKDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0209229_1032734513300027805Freshwater And SedimentMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH
Ga0209302_1021027723300027810MarineMKFIALLLVAVASATATNDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPT
Ga0209092_1021335713300027833MarineMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0209092_1029361013300027833MarineMKTTIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0209230_1057523113300027836Freshwater And SedimentLFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGSXKCKLFKNESLIKKPI
Ga0209712_1041119413300027849MarineMKSFVIAALLGLTLAAEGPADKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0209712_1058880313300027849MarineMKFIAIALLGVAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKSSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0209503_1025617713300027859MarineMKFIALLIASAYAATDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0209702_1023191613300027976FreshwaterMKSIVIAALLAVAAASNTVVPDGEDKLHFFDFDNAKMLYKGDWSAYKQTRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0228674_124973313300028008SeawaterIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247582_119052513300028109SeawaterAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0256412_136362713300028137SeawaterIAALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0256417_120128613300028233SeawaterKMKTAFAVIAALVAVSATEIPDGEYKLHFFDFDNAKMLYKGDWAAYTKSRPHDNACSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0256417_120831613300028233SeawaterMRTAFAIIAVLVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0256417_121373213300028233SeawaterMKSFIIALLGLVVSAETVENQVADDKLHFFDFDNAKMLYKGDWNLYKKSRPHDNDCSIAESDNWKGARQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSFTH
Ga0256413_123971213300028282SeawaterAIAVIAALFVAVNATEIPDGEDKLHFFDFAKAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0256413_125396313300028282SeawaterLVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247572_117371013300028290SeawaterALFVAVNATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247572_117573213300028290SeawaterDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247595_109557013300028333SeawaterAVIAALVATVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247597_105895913300028334SeawaterVAIVPSAEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0247566_105428313300028335SeawaterKFIAAALIAAVAAVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0306909_11715913300028405Saline LakeMKSAIIALIGAVVASTQEVPTGVDKLHFFDFDNAKMLYKGDWNSYKVSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0272440_124020313300028595Marine SedimentMKTIGVLALLMATTQASNDDKLHFFEFDNAKMIWKNDWDFYRNSRDHGEHDCKLAESDNFLGAQQCRFSWECRGARICERGGWCSGYDGCEGTPLPQEAAGLSADH
Ga0307401_1037427513300030670MarineAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307401_1057941913300030670MarineAVIAALVAIVPTAEAQSDKLHFFDFDNAKMLYKGDWAAYKKTRPHDNDCSIAETDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307403_1081499313300030671MarineKMKLLALAAVCLATTEVAADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0307398_1031326913300030699MarineMTNDDKLHFFDFDNAKMLYKGDWAAYKKSRPRDNDCSIAESDNWKGAQQCAESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0307400_1096329813300030709MarineKMRSFIALIAAVVAVSASTVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0308127_103707513300030715MarineKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0308129_103761313300030723MarineRTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0308128_103765013300030725MarineRTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERRGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0073967_1195630313300030750MarineIKMKSFVIAALLATATAIVSDVPKGEDKLHFFDFDNAKMLYKGDWNAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0073988_1236201413300030780MarineMKFAIALAAIGFAAAQDDADKLHFFDFDNSKMLYKGDWAAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0073986_1000267613300031038MarineTKMKTAFAVIAALVATVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0307388_1080615913300031522MarineKFFALIALAAADDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0307492_1022162613300031523Sea-Ice BrineMKSIIMVALLGFATAGQVEVQDDKLHFFDFDNAKMLYKGDWNAYKVSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0308143_13042913300031540MarineQQIMRTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0308149_105321713300031542MarineIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307489_1052316513300031569Sackhole BrineMKSIIIAALLGFAAAGQTEDDKLHFFDFDNAKMLYKGDWNAYKVSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0307489_1068800113300031569Sackhole BrineMKSIAIAALLAVATATLQVVPKGEDKLHFFDFDNAKMLYKGDWNAYKKTRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSATH
Ga0308144_104715513300031570MarineAFAIIAALVAVSATEIKDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0308132_113771313300031580MarineQKMKFLALLLVATVNASTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0307993_104459523300031602MarineMKFIALALIAVSSATADDKLHFFDFDNAKMLYKGDWASYKKTRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTHXS
Ga0302114_1019570613300031621MarineMKFTGIAVLATLIATSSAQDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0302126_1013410913300031622MarineMKFTLALAALVAVTEATNDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0302126_1017245813300031622MarineMKFIALALIAVSSATADDKLHFFDFDNAKMLYKGDWASYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0302121_1017577813300031626MarineTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307393_114872813300031674MarineQKMRSFIALIAAVVAVSASTVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307386_1035430813300031710MarineKFIIALIASVAAIPTGQDKLHFFDFDNAKMLYKGDWAAYKSSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSVTH
Ga0307386_1035430823300031710MarineDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0307386_1072204613300031710MarineKKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307396_1062384113300031717MarineLQMKFTPLAVLVALVATSSAQEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0307381_1011299323300031725MarineMTNDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGLSSTH
Ga0307381_1035437513300031725MarineKMRTFIAIIAAVVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307383_1063520613300031739MarineVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTH
Ga0307383_1069489013300031739MarineKMKTAIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307382_1053364913300031743MarineKTAFAVIAALVATVSTAEIADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0307389_1102352913300031750MarineLNKQKMRSFIALIAAVVAVSASTVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0315899_1091491413300031784FreshwaterMKFIALFALVASASAATKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTHXGIXKCKLFKNEHLIEKLIE
Ga0315320_1052659913300031851SeawaterMKFIAAALLGAVAAIPAGQDKLHFFDFDNAKMLYKGDWAAYKTSRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSTTHXAKISVINRLQVFKTNNLTWY
Ga0315320_1089927413300031851SeawaterFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0315330_1087657413300032047SeawaterMKFLLAALVATVAAIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0315905_1159410813300032092FreshwaterMKFVAVLALLATASAVQVEDDKLHFFDFDNAKMLYKGDWAAYKRSRPHDNDCSIAESDNWKGAQQCVESWECRGARLCERGGWCSGFDGCEGSPLPTQAPGILPTH
Ga0314684_1076005313300032463SeawaterKKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314670_1061239413300032470SeawaterTNKKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314679_1051163013300032492SeawaterKFTAVAVLATLIATSSAQDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0314679_1052650713300032492SeawaterKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314688_1074963213300032517SeawaterTTIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314689_1063895013300032518SeawaterLKQQIMRTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314689_1064536513300032518SeawaterMKTAFAVIAALVAIVPYVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314676_1076100613300032519SeawaterNKKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314677_1050556913300032522SeawaterLEAIFRRAVCATDGSDGDDWTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314682_1067835913300032540SeawaterKQQIMRTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314671_1062933913300032616SeawaterEVLIFKQTKKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314671_1067572313300032616SeawaterQIMRTAFAIIAALVAVSATSVPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314685_1076282813300032651SeawaterEIPTGQDKLHFFDFENAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314678_1053992513300032666SeawaterFALAIAAIGFAAAQEDDADKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314678_1056972613300032666SeawaterNIYAETALGVELPYWCPKEDAAAAEIPTGQDKLHFFDFDNAKMLYKGDWAAYKASRPHDNDCSLAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSYTH
Ga0314687_1043091613300032707SeawaterLHPEYSRNPIWICGESCAKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314687_1071420613300032707SeawaterQTKKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314669_1059593413300032708SeawaterHLRQLAEIAALHLEHVRLATLELVPVSLRLVKLLLTAVAVLATLIATSSAQDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0314690_1064488313300032713SeawaterNQTKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314693_1062269513300032727SeawaterGINNQTKMKTAFAVIAALVAIVPNVEAQTDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314696_1058548513300032728SeawaterKKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0314699_1053635813300032730SeawaterKTTIAVIAALFVAVNATEVADSEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314711_1060168613300032732SeawaterKQTKKMRTAFAIIAALVAVSATEIPDGEDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0314694_1049056713300032751SeawaterINKMKFTAVAVLATLIATSSAQDDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0314700_1030026013300032752SeawaterMKFTPIAVLAALVATSSAQEDKLHFFDFDNAKMLYKGDWSAYKKSRPHDNDCSIAESDNWKGAQQCAESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0314709_1078968013300032755SeawaterRLATLELVPVSLRLVKLLLTAVAVLATLIATSSAQDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGLSNTH
Ga0310342_10368710813300032820SeawaterMKFLALALLGAVSATTDDKLHFFDFDNAKMLYKGDWAAYKKSRPHDNDCSIAESDNWKGAQQCVESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSYTH
Ga0335001_0462257_88_4023300034064FreshwaterMKFIALFTLVASAASKDDDKLHFFDFDNAKMLYKGDWAAYKATRPHDNDCSIAESDNWKGAQQCFESWECRGARMCERGGWCSGFDGCEGSPLPTQAPGVSSTH


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.