Basic Information | |
---|---|
Family ID | F000763 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 901 |
Average Sequence Length | 45 residues |
Representative Sequence | MNMKNPYVLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Number of Associated Samples | 342 |
Number of Associated Scaffolds | 900 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 77.67 % |
% of genes near scaffold ends (potentially truncated) | 27.19 % |
% of genes from short scaffolds (< 2000 bps) | 67.15 % |
Associated GOLD sequencing projects | 289 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.39 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (72.586 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (14.983 % of family members) |
Environment Ontology (ENVO) | Unclassified (46.060 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (57.381 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 39.19% β-sheet: 0.00% Coil/Unstructured: 60.81% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 900 Family Scaffolds |
---|---|---|
PF05065 | Phage_capsid | 3.00 |
PF01844 | HNH | 2.44 |
PF12850 | Metallophos_2 | 2.33 |
PF03354 | TerL_ATPase | 1.89 |
PF04860 | Phage_portal | 1.56 |
PF03406 | Phage_fiber_2 | 1.44 |
PF01391 | Collagen | 1.00 |
PF05869 | Dam | 0.78 |
PF09250 | Prim-Pol | 0.78 |
PF04586 | Peptidase_S78 | 0.78 |
PF00149 | Metallophos | 0.44 |
PF16778 | Phage_tail_APC | 0.44 |
PF00145 | DNA_methylase | 0.33 |
PF14279 | HNH_5 | 0.33 |
PF00877 | NLPC_P60 | 0.33 |
PF09636 | XkdW | 0.33 |
PF05257 | CHAP | 0.33 |
PF13392 | HNH_3 | 0.22 |
PF03237 | Terminase_6N | 0.22 |
PF13385 | Laminin_G_3 | 0.22 |
PF09723 | Zn-ribbon_8 | 0.22 |
PF02018 | CBM_4_9 | 0.22 |
PF01464 | SLT | 0.22 |
PF00383 | dCMP_cyt_deam_1 | 0.11 |
PF12705 | PDDEXK_1 | 0.11 |
PF03796 | DnaB_C | 0.11 |
PF13539 | Peptidase_M15_4 | 0.11 |
PF02467 | Whib | 0.11 |
PF06199 | Phage_tail_2 | 0.11 |
COG ID | Name | Functional Category | % Frequency in 900 Family Scaffolds |
---|---|---|---|
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 3.00 |
COG4626 | Phage terminase-like protein, large subunit, contains N-terminal HTH domain | Mobilome: prophages, transposons [X] | 1.89 |
COG3740 | Phage head maturation protease | Mobilome: prophages, transposons [X] | 0.78 |
COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.33 |
COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.33 |
COG0305 | Replicative DNA helicase | Replication, recombination and repair [L] | 0.11 |
COG1066 | DNA repair protein RadA/Sms, contains AAA+ ATPase domain | Replication, recombination and repair [L] | 0.11 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 81.91 % |
Unclassified | root | N/A | 18.09 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000405|LV_Brine_h2_0102DRAFT_1006526 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2638 | Open in IMG/M |
3300000558|Draft_10011198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8868 | Open in IMG/M |
3300000558|Draft_10157397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1281 | Open in IMG/M |
3300000558|Draft_11669881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12399 | Open in IMG/M |
3300000756|JGI12421J11937_10009280 | All Organisms → Viruses → Predicted Viral | 3811 | Open in IMG/M |
3300000756|JGI12421J11937_10017253 | Not Available | 2701 | Open in IMG/M |
3300000756|JGI12421J11937_10021147 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2396 | Open in IMG/M |
3300000756|JGI12421J11937_10115997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 706 | Open in IMG/M |
3300001282|B570J14230_10046329 | Not Available | 1462 | Open in IMG/M |
3300001371|BBDRAFT_10267630 | Not Available | 636 | Open in IMG/M |
3300001605|Draft_10004659 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15922 | Open in IMG/M |
3300001838|RCM33_1009407 | All Organisms → cellular organisms → Bacteria | 1715 | Open in IMG/M |
3300001848|RCM47_1061032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1189 | Open in IMG/M |
3300001849|RCM26_1157611 | Not Available | 723 | Open in IMG/M |
3300001850|RCM37_1109910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 925 | Open in IMG/M |
3300001850|RCM37_1153906 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 913 | Open in IMG/M |
3300001850|RCM37_1169707 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
3300002198|metazooDRAFT_1221286 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 521 | Open in IMG/M |
3300002199|metazooDRAFT_1246703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300002200|metazooDRAFT_1249276 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
3300002220|MLSBCLC_10051820 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12534 | Open in IMG/M |
3300002408|B570J29032_108771168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300002408|B570J29032_108862782 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 527 | Open in IMG/M |
3300002408|B570J29032_109766174 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
3300002408|B570J29032_109844365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1606 | Open in IMG/M |
3300002465|LO132_10231590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
3300002471|metazooDRAFT_1436878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 571 | Open in IMG/M |
3300002476|metazooDRAFT_10751846 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 526 | Open in IMG/M |
3300002835|B570J40625_100013718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14379 | Open in IMG/M |
3300002835|B570J40625_100025725 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9583 | Open in IMG/M |
3300002835|B570J40625_100147743 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2695 | Open in IMG/M |
3300002835|B570J40625_100188425 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2262 | Open in IMG/M |
3300002835|B570J40625_100928611 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 750 | Open in IMG/M |
3300002835|B570J40625_101247215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
3300002835|B570J40625_101365867 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 586 | Open in IMG/M |
3300002844|contig_10280 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
3300002930|Water_104160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2290 | Open in IMG/M |
3300003277|JGI25908J49247_10026235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1687 | Open in IMG/M |
3300003277|JGI25908J49247_10061582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300003277|JGI25908J49247_10081091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300003393|JGI25909J50240_1045143 | Not Available | 928 | Open in IMG/M |
3300003394|JGI25907J50239_1067537 | Not Available | 711 | Open in IMG/M |
3300003394|JGI25907J50239_1073191 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
3300003395|JGI25917J50250_1002812 | All Organisms → cellular organisms → Bacteria | 4800 | Open in IMG/M |
3300003411|JGI25911J50253_10030864 | All Organisms → cellular organisms → Bacteria | 1952 | Open in IMG/M |
3300003412|JGI25912J50252_10049416 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1162 | Open in IMG/M |
3300003412|JGI25912J50252_10099502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 705 | Open in IMG/M |
3300003413|JGI25922J50271_10053978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 897 | Open in IMG/M |
3300003413|JGI25922J50271_10086680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 670 | Open in IMG/M |
3300003429|JGI25914J50564_10013321 | All Organisms → cellular organisms → Bacteria | 2570 | Open in IMG/M |
3300003429|JGI25914J50564_10166759 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
3300003430|JGI25921J50272_10051512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 936 | Open in IMG/M |
3300003431|JGI25913J50563_1049357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300003490|JGI25926J51410_1082979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
3300003497|JGI25925J51416_10003059 | All Organisms → Viruses → Predicted Viral | 4757 | Open in IMG/M |
3300003499|JGI25930J51415_1005013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2830 | Open in IMG/M |
3300004126|Ga0066179_10174969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300004240|Ga0007787_10096599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1376 | Open in IMG/M |
3300004282|Ga0066599_100047487 | Not Available | 1727 | Open in IMG/M |
3300004282|Ga0066599_100284825 | Not Available | 963 | Open in IMG/M |
3300004282|Ga0066599_100802368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
3300004282|Ga0066599_101624912 | Not Available | 501 | Open in IMG/M |
3300004448|Ga0065861_1143736 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1567 | Open in IMG/M |
3300004460|Ga0066222_1001908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1885 | Open in IMG/M |
3300004481|Ga0069718_14977621 | Not Available | 604 | Open in IMG/M |
3300004481|Ga0069718_15184234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300004481|Ga0069718_15591282 | Not Available | 690 | Open in IMG/M |
3300004481|Ga0069718_15626354 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 841 | Open in IMG/M |
3300004481|Ga0069718_15737269 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300004481|Ga0069718_15804626 | Not Available | 601 | Open in IMG/M |
3300004481|Ga0069718_16090745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12271 | Open in IMG/M |
3300004829|Ga0068515_115827 | Not Available | 944 | Open in IMG/M |
3300005416|Ga0068880_1386626 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 684 | Open in IMG/M |
3300005417|Ga0068884_1067030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 846 | Open in IMG/M |
3300005417|Ga0068884_1575834 | All Organisms → cellular organisms → Bacteria | 884 | Open in IMG/M |
3300005417|Ga0068884_1577885 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1030 | Open in IMG/M |
3300005421|Ga0068882_1790379 | Not Available | 537 | Open in IMG/M |
3300005517|Ga0070374_10023184 | All Organisms → Viruses → Predicted Viral | 3172 | Open in IMG/M |
3300005517|Ga0070374_10269680 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300005525|Ga0068877_10071199 | All Organisms → cellular organisms → Bacteria | 2236 | Open in IMG/M |
3300005525|Ga0068877_10215218 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1144 | Open in IMG/M |
3300005525|Ga0068877_10308510 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 913 | Open in IMG/M |
3300005527|Ga0068876_10001799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16339 | Open in IMG/M |
3300005527|Ga0068876_10014031 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5180 | Open in IMG/M |
3300005527|Ga0068876_10038321 | Not Available | 2963 | Open in IMG/M |
3300005527|Ga0068876_10162338 | Not Available | 1310 | Open in IMG/M |
3300005527|Ga0068876_10411865 | Not Available | 752 | Open in IMG/M |
3300005527|Ga0068876_10574236 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 613 | Open in IMG/M |
3300005527|Ga0068876_10625049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 581 | Open in IMG/M |
3300005527|Ga0068876_10698301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
3300005527|Ga0068876_10789294 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300005528|Ga0068872_10522094 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 636 | Open in IMG/M |
3300005581|Ga0049081_10001923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7818 | Open in IMG/M |
3300005581|Ga0049081_10023581 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2336 | Open in IMG/M |
3300005581|Ga0049081_10178026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 769 | Open in IMG/M |
3300005581|Ga0049081_10234796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300005581|Ga0049081_10334833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300005582|Ga0049080_10193261 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 674 | Open in IMG/M |
3300005662|Ga0078894_10008692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7909 | Open in IMG/M |
3300005662|Ga0078894_10068856 | All Organisms → Viruses → Predicted Viral | 3051 | Open in IMG/M |
3300005662|Ga0078894_10404880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1233 | Open in IMG/M |
3300005662|Ga0078894_10407908 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
3300005662|Ga0078894_10442583 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1171 | Open in IMG/M |
3300005662|Ga0078894_10445039 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1168 | Open in IMG/M |
3300005662|Ga0078894_11722807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
3300005662|Ga0078894_11793815 | Not Available | 501 | Open in IMG/M |
3300005805|Ga0079957_1002410 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16441 | Open in IMG/M |
3300005805|Ga0079957_1002535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15932 | Open in IMG/M |
3300005805|Ga0079957_1002578 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15774 | Open in IMG/M |
3300005805|Ga0079957_1004542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11482 | Open in IMG/M |
3300005805|Ga0079957_1007729 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 8388 | Open in IMG/M |
3300005805|Ga0079957_1013478 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6027 | Open in IMG/M |
3300005805|Ga0079957_1014520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5752 | Open in IMG/M |
3300005805|Ga0079957_1017687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5087 | Open in IMG/M |
3300005805|Ga0079957_1041185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2927 | Open in IMG/M |
3300005805|Ga0079957_1129254 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1320 | Open in IMG/M |
3300005805|Ga0079957_1193509 | Not Available | 988 | Open in IMG/M |
3300005805|Ga0079957_1197417 | All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon | 973 | Open in IMG/M |
3300005805|Ga0079957_1268023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 784 | Open in IMG/M |
3300005832|Ga0074469_11241275 | All Organisms → Viruses → Predicted Viral | 3711 | Open in IMG/M |
3300006018|Ga0068875_1012627 | Not Available | 743 | Open in IMG/M |
3300006030|Ga0075470_10000333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15751 | Open in IMG/M |
3300006030|Ga0075470_10001771 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6725 | Open in IMG/M |
3300006030|Ga0075470_10036826 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1510 | Open in IMG/M |
3300006030|Ga0075470_10071722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1050 | Open in IMG/M |
3300006030|Ga0075470_10081806 | Not Available | 975 | Open in IMG/M |
3300006030|Ga0075470_10089865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 924 | Open in IMG/M |
3300006037|Ga0075465_10067669 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 770 | Open in IMG/M |
3300006037|Ga0075465_10078141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 720 | Open in IMG/M |
3300006484|Ga0070744_10066224 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1051 | Open in IMG/M |
3300006484|Ga0070744_10092649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300006484|Ga0070744_10128112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300006484|Ga0070744_10241946 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300006637|Ga0075461_10216819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
3300006641|Ga0075471_10020775 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3891 | Open in IMG/M |
3300006641|Ga0075471_10400248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300006802|Ga0070749_10001546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15596 | Open in IMG/M |
3300006802|Ga0070749_10039081 | All Organisms → Viruses → Predicted Viral | 2923 | Open in IMG/M |
3300006802|Ga0070749_10047804 | All Organisms → cellular organisms → Bacteria | 2612 | Open in IMG/M |
3300006802|Ga0070749_10052340 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2486 | Open in IMG/M |
3300006802|Ga0070749_10080444 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1946 | Open in IMG/M |
3300006802|Ga0070749_10092403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1796 | Open in IMG/M |
3300006802|Ga0070749_10098784 | All Organisms → cellular organisms → Bacteria | 1727 | Open in IMG/M |
3300006802|Ga0070749_10100050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1715 | Open in IMG/M |
3300006802|Ga0070749_10122841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1524 | Open in IMG/M |
3300006802|Ga0070749_10246458 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1013 | Open in IMG/M |
3300006802|Ga0070749_10254494 | Not Available | 994 | Open in IMG/M |
3300006802|Ga0070749_10278597 | Not Available | 942 | Open in IMG/M |
3300006802|Ga0070749_10342541 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 832 | Open in IMG/M |
3300006802|Ga0070749_10350927 | All Organisms → cellular organisms → Bacteria | 820 | Open in IMG/M |
3300006802|Ga0070749_10411829 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
3300006802|Ga0070749_10425649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 730 | Open in IMG/M |
3300006802|Ga0070749_10448786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 707 | Open in IMG/M |
3300006802|Ga0070749_10525800 | Not Available | 643 | Open in IMG/M |
3300006802|Ga0070749_10607837 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300006802|Ga0070749_10693118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 545 | Open in IMG/M |
3300006802|Ga0070749_10730038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 528 | Open in IMG/M |
3300006802|Ga0070749_10784630 | Not Available | 506 | Open in IMG/M |
3300006803|Ga0075467_10400514 | Not Available | 715 | Open in IMG/M |
3300006803|Ga0075467_10541762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
3300006803|Ga0075467_10548744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300006805|Ga0075464_10024329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3166 | Open in IMG/M |
3300006805|Ga0075464_10052085 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2260 | Open in IMG/M |
3300006805|Ga0075464_10061445 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2100 | Open in IMG/M |
3300006805|Ga0075464_10104522 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
3300006805|Ga0075464_10107949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1605 | Open in IMG/M |
3300006805|Ga0075464_10121176 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1519 | Open in IMG/M |
3300006805|Ga0075464_10230472 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1105 | Open in IMG/M |
3300006805|Ga0075464_10298950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
3300006805|Ga0075464_10305333 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 958 | Open in IMG/M |
3300006805|Ga0075464_10373169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 864 | Open in IMG/M |
3300006805|Ga0075464_10383289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300006805|Ga0075464_10385461 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300006805|Ga0075464_10415263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 819 | Open in IMG/M |
3300006805|Ga0075464_10450373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300006805|Ga0075464_10505489 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 740 | Open in IMG/M |
3300006805|Ga0075464_10506180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300006805|Ga0075464_10514622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 733 | Open in IMG/M |
3300006805|Ga0075464_10545542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 711 | Open in IMG/M |
3300006805|Ga0075464_10567874 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300006805|Ga0075464_10589938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300006805|Ga0075464_10631405 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 660 | Open in IMG/M |
3300006805|Ga0075464_10651983 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300006805|Ga0075464_10656855 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300006805|Ga0075464_10734468 | Not Available | 612 | Open in IMG/M |
3300006805|Ga0075464_10765208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300006805|Ga0075464_10862455 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
3300006805|Ga0075464_11007029 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 523 | Open in IMG/M |
3300006805|Ga0075464_11019387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
3300006805|Ga0075464_11068838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
3300006805|Ga0075464_11073770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300006863|Ga0075459_1011133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1473 | Open in IMG/M |
3300006863|Ga0075459_1030664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 900 | Open in IMG/M |
3300006917|Ga0075472_10088273 | Not Available | 1501 | Open in IMG/M |
3300006917|Ga0075472_10116098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1307 | Open in IMG/M |
3300006917|Ga0075472_10169182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 1073 | Open in IMG/M |
3300006917|Ga0075472_10282394 | Not Available | 818 | Open in IMG/M |
3300006917|Ga0075472_10510597 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300006920|Ga0070748_1067327 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
3300006920|Ga0070748_1068990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1378 | Open in IMG/M |
3300006920|Ga0070748_1087328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1198 | Open in IMG/M |
3300006920|Ga0070748_1096383 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1130 | Open in IMG/M |
3300006920|Ga0070748_1096568 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1128 | Open in IMG/M |
3300006920|Ga0070748_1121165 | Not Available | 986 | Open in IMG/M |
3300006920|Ga0070748_1156099 | Not Available | 847 | Open in IMG/M |
3300006920|Ga0070748_1186038 | Not Available | 763 | Open in IMG/M |
3300006920|Ga0070748_1235443 | Not Available | 661 | Open in IMG/M |
3300006920|Ga0070748_1248239 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300006920|Ga0070748_1294220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 578 | Open in IMG/M |
3300007165|Ga0079302_1036202 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1178 | Open in IMG/M |
3300007169|Ga0102976_1023076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5421 | Open in IMG/M |
3300007171|Ga0102977_1109247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1498 | Open in IMG/M |
3300007171|Ga0102977_1118050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1626 | Open in IMG/M |
3300007229|Ga0075468_10186401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300007234|Ga0075460_10257072 | Not Available | 581 | Open in IMG/M |
3300007276|Ga0070747_1278548 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 577 | Open in IMG/M |
3300007276|Ga0070747_1279415 | Not Available | 576 | Open in IMG/M |
3300007276|Ga0070747_1280483 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300007276|Ga0070747_1311649 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
3300007304|Ga0102689_1127129 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 669 | Open in IMG/M |
3300007304|Ga0102689_1188360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1702 | Open in IMG/M |
3300007344|Ga0070745_1070361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1404 | Open in IMG/M |
3300007538|Ga0099851_1004199 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6046 | Open in IMG/M |
3300007538|Ga0099851_1090748 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1170 | Open in IMG/M |
3300007538|Ga0099851_1098321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1116 | Open in IMG/M |
3300007538|Ga0099851_1127175 | Not Available | 959 | Open in IMG/M |
3300007540|Ga0099847_1060202 | Not Available | 1185 | Open in IMG/M |
3300007541|Ga0099848_1001843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9906 | Open in IMG/M |
3300007541|Ga0099848_1143292 | Not Available | 889 | Open in IMG/M |
3300007541|Ga0099848_1185281 | Not Available | 754 | Open in IMG/M |
3300007542|Ga0099846_1273639 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 582 | Open in IMG/M |
3300007622|Ga0102863_1049315 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1227 | Open in IMG/M |
3300007636|Ga0102856_1028824 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300007636|Ga0102856_1050705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 656 | Open in IMG/M |
3300007708|Ga0102859_1001393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5504 | Open in IMG/M |
3300007708|Ga0102859_1004253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3361 | Open in IMG/M |
3300007708|Ga0102859_1042975 | Not Available | 1239 | Open in IMG/M |
3300007734|Ga0104986_1032 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10220 | Open in IMG/M |
3300007734|Ga0104986_1079 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10570 | Open in IMG/M |
3300007734|Ga0104986_1140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11317 | Open in IMG/M |
3300007734|Ga0104986_1155 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11428 | Open in IMG/M |
3300007734|Ga0104986_1373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14347 | Open in IMG/M |
3300007734|Ga0104986_1537 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16816 | Open in IMG/M |
3300007735|Ga0104988_10468 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15799 | Open in IMG/M |
3300007960|Ga0099850_1011689 | Not Available | 3962 | Open in IMG/M |
3300007960|Ga0099850_1057648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1647 | Open in IMG/M |
3300007960|Ga0099850_1406992 | Not Available | 503 | Open in IMG/M |
3300007972|Ga0105745_1056949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
3300007972|Ga0105745_1263753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300008055|Ga0108970_11156856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 997 | Open in IMG/M |
3300008055|Ga0108970_11172645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8477 | Open in IMG/M |
3300008072|Ga0110929_1028806 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4502 | Open in IMG/M |
3300008072|Ga0110929_1028807 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 788 | Open in IMG/M |
3300008072|Ga0110929_1096802 | Not Available | 986 | Open in IMG/M |
3300008107|Ga0114340_1026970 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4283 | Open in IMG/M |
3300008107|Ga0114340_1065018 | Not Available | 1554 | Open in IMG/M |
3300008107|Ga0114340_1133386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1421 | Open in IMG/M |
3300008107|Ga0114340_1147850 | Not Available | 870 | Open in IMG/M |
3300008108|Ga0114341_10311432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1405 | Open in IMG/M |
3300008108|Ga0114341_10412948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300008110|Ga0114343_1032241 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2175 | Open in IMG/M |
3300008110|Ga0114343_1096345 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1033 | Open in IMG/M |
3300008111|Ga0114344_1004284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10782 | Open in IMG/M |
3300008111|Ga0114344_1011350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3686 | Open in IMG/M |
3300008113|Ga0114346_1094302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1386 | Open in IMG/M |
3300008113|Ga0114346_1125784 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1866 | Open in IMG/M |
3300008113|Ga0114346_1222471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 731 | Open in IMG/M |
3300008113|Ga0114346_1289464 | Not Available | 573 | Open in IMG/M |
3300008114|Ga0114347_1002397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11899 | Open in IMG/M |
3300008114|Ga0114347_1209880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
3300008116|Ga0114350_1062840 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2126 | Open in IMG/M |
3300008116|Ga0114350_1086931 | Not Available | 1023 | Open in IMG/M |
3300008116|Ga0114350_1127498 | Not Available | 753 | Open in IMG/M |
3300008117|Ga0114351_1096059 | Not Available | 2835 | Open in IMG/M |
3300008120|Ga0114355_1043768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2097 | Open in IMG/M |
3300008120|Ga0114355_1215476 | Not Available | 600 | Open in IMG/M |
3300008259|Ga0114841_1135091 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1005 | Open in IMG/M |
3300008261|Ga0114336_1005330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11321 | Open in IMG/M |
3300008261|Ga0114336_1097480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1389 | Open in IMG/M |
3300008263|Ga0114349_1019758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4483 | Open in IMG/M |
3300008266|Ga0114363_1001268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15163 | Open in IMG/M |
3300008266|Ga0114363_1002710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15230 | Open in IMG/M |
3300008266|Ga0114363_1021705 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5072 | Open in IMG/M |
3300008266|Ga0114363_1033978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2129 | Open in IMG/M |
3300008266|Ga0114363_1035538 | All Organisms → cellular organisms → Bacteria | 2764 | Open in IMG/M |
3300008266|Ga0114363_1054900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1570 | Open in IMG/M |
3300008266|Ga0114363_1058128 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2203 | Open in IMG/M |
3300008266|Ga0114363_1084331 | Not Available | 1176 | Open in IMG/M |
3300008266|Ga0114363_1099470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1048 | Open in IMG/M |
3300008266|Ga0114363_1112627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
3300008266|Ga0114363_1123087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 898 | Open in IMG/M |
3300008266|Ga0114363_1175833 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 684 | Open in IMG/M |
3300008266|Ga0114363_1188208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300008266|Ga0114363_1207710 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
3300008266|Ga0114363_1214916 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 576 | Open in IMG/M |
3300008266|Ga0114363_1232618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 535 | Open in IMG/M |
3300008267|Ga0114364_1006556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5765 | Open in IMG/M |
3300008267|Ga0114364_1009390 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6501 | Open in IMG/M |
3300008339|Ga0114878_1144388 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
3300008448|Ga0114876_1017511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3811 | Open in IMG/M |
3300008448|Ga0114876_1040926 | All Organisms → Viruses → Predicted Viral | 2175 | Open in IMG/M |
3300008448|Ga0114876_1052714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1825 | Open in IMG/M |
3300008448|Ga0114876_1073790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1441 | Open in IMG/M |
3300008448|Ga0114876_1086488 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1287 | Open in IMG/M |
3300008448|Ga0114876_1234735 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300008448|Ga0114876_1238507 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300008450|Ga0114880_1001511 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13689 | Open in IMG/M |
3300008450|Ga0114880_1007474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5557 | Open in IMG/M |
3300008450|Ga0114880_1010556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4564 | Open in IMG/M |
3300008450|Ga0114880_1032965 | All Organisms → Viruses → Predicted Viral | 2302 | Open in IMG/M |
3300008450|Ga0114880_1044283 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1914 | Open in IMG/M |
3300008450|Ga0114880_1097633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
3300008450|Ga0114880_1116391 | Not Available | 1010 | Open in IMG/M |
3300008450|Ga0114880_1133068 | Not Available | 918 | Open in IMG/M |
3300008450|Ga0114880_1133641 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 915 | Open in IMG/M |
3300008450|Ga0114880_1147250 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 852 | Open in IMG/M |
3300008450|Ga0114880_1155955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 816 | Open in IMG/M |
3300008450|Ga0114880_1163947 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 785 | Open in IMG/M |
3300008450|Ga0114880_1181877 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 724 | Open in IMG/M |
3300008450|Ga0114880_1224136 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 609 | Open in IMG/M |
3300008450|Ga0114880_1229919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300008450|Ga0114880_1240969 | Not Available | 572 | Open in IMG/M |
3300008450|Ga0114880_1257690 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300008459|Ga0114865_1010646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4589 | Open in IMG/M |
3300008962|Ga0104242_1019026 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1192 | Open in IMG/M |
3300009068|Ga0114973_10005972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8229 | Open in IMG/M |
3300009068|Ga0114973_10010282 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6082 | Open in IMG/M |
3300009068|Ga0114973_10014928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4919 | Open in IMG/M |
3300009068|Ga0114973_10020821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4079 | Open in IMG/M |
3300009068|Ga0114973_10032803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3135 | Open in IMG/M |
3300009075|Ga0105090_10187499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1283 | Open in IMG/M |
3300009075|Ga0105090_11016290 | Not Available | 506 | Open in IMG/M |
3300009081|Ga0105098_10052870 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1659 | Open in IMG/M |
3300009081|Ga0105098_10206486 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 909 | Open in IMG/M |
3300009081|Ga0105098_10394648 | Not Available | 685 | Open in IMG/M |
3300009081|Ga0105098_10578574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300009082|Ga0105099_10182913 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1193 | Open in IMG/M |
3300009082|Ga0105099_10349754 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
3300009085|Ga0105103_10214942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1031 | Open in IMG/M |
3300009085|Ga0105103_10302551 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 872 | Open in IMG/M |
3300009085|Ga0105103_10318811 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 850 | Open in IMG/M |
3300009085|Ga0105103_10437319 | Not Available | 728 | Open in IMG/M |
3300009085|Ga0105103_10552129 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 651 | Open in IMG/M |
3300009085|Ga0105103_10910278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300009091|Ga0102851_12197348 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300009131|Ga0115027_11662605 | Not Available | 530 | Open in IMG/M |
3300009146|Ga0105091_10424484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 665 | Open in IMG/M |
3300009146|Ga0105091_10532318 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 600 | Open in IMG/M |
3300009151|Ga0114962_10005767 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9656 | Open in IMG/M |
3300009151|Ga0114962_10231959 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1061 | Open in IMG/M |
3300009151|Ga0114962_10431376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 708 | Open in IMG/M |
3300009152|Ga0114980_10002805 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12137 | Open in IMG/M |
3300009152|Ga0114980_10052399 | Not Available | 2473 | Open in IMG/M |
3300009152|Ga0114980_10353260 | Not Available | 847 | Open in IMG/M |
3300009152|Ga0114980_10669508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300009155|Ga0114968_10001594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17425 | Open in IMG/M |
3300009155|Ga0114968_10008524 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7474 | Open in IMG/M |
3300009155|Ga0114968_10022601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4308 | Open in IMG/M |
3300009155|Ga0114968_10025347 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4033 | Open in IMG/M |
3300009155|Ga0114968_10122843 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1566 | Open in IMG/M |
3300009155|Ga0114968_10181420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1230 | Open in IMG/M |
3300009155|Ga0114968_10241610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
3300009155|Ga0114968_10424082 | Not Available | 723 | Open in IMG/M |
3300009155|Ga0114968_10635349 | Not Available | 563 | Open in IMG/M |
3300009158|Ga0114977_10004954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8460 | Open in IMG/M |
3300009158|Ga0114977_10007189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7065 | Open in IMG/M |
3300009158|Ga0114977_10028638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3491 | Open in IMG/M |
3300009158|Ga0114977_10103182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1728 | Open in IMG/M |
3300009158|Ga0114977_10140090 | Not Available | 1447 | Open in IMG/M |
3300009158|Ga0114977_10143425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1427 | Open in IMG/M |
3300009158|Ga0114977_10252218 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1018 | Open in IMG/M |
3300009159|Ga0114978_10003139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13540 | Open in IMG/M |
3300009159|Ga0114978_10051685 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2834 | Open in IMG/M |
3300009159|Ga0114978_10237916 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1136 | Open in IMG/M |
3300009159|Ga0114978_10861885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300009160|Ga0114981_10018637 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4021 | Open in IMG/M |
3300009160|Ga0114981_10200988 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1093 | Open in IMG/M |
3300009161|Ga0114966_10002950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15089 | Open in IMG/M |
3300009161|Ga0114966_10135482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1617 | Open in IMG/M |
3300009161|Ga0114966_10513290 | Not Available | 681 | Open in IMG/M |
3300009163|Ga0114970_10017435 | All Organisms → Viruses → Predicted Viral | 4898 | Open in IMG/M |
3300009163|Ga0114970_10023802 | All Organisms → cellular organisms → Bacteria | 4125 | Open in IMG/M |
3300009163|Ga0114970_10095113 | Not Available | 1850 | Open in IMG/M |
3300009163|Ga0114970_10441317 | Not Available | 718 | Open in IMG/M |
3300009163|Ga0114970_10581454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300009164|Ga0114975_10045335 | Not Available | 2603 | Open in IMG/M |
3300009164|Ga0114975_10085428 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1834 | Open in IMG/M |
3300009164|Ga0114975_10223595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
3300009164|Ga0114975_10449556 | Not Available | 698 | Open in IMG/M |
3300009165|Ga0105102_10333862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 792 | Open in IMG/M |
3300009165|Ga0105102_10687507 | Not Available | 573 | Open in IMG/M |
3300009168|Ga0105104_10318048 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300009168|Ga0105104_10472575 | Not Available | 703 | Open in IMG/M |
3300009168|Ga0105104_10548275 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 654 | Open in IMG/M |
3300009168|Ga0105104_10572797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 641 | Open in IMG/M |
3300009169|Ga0105097_10010716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4741 | Open in IMG/M |
3300009169|Ga0105097_10050292 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2243 | Open in IMG/M |
3300009169|Ga0105097_10062260 | All Organisms → Viruses → Predicted Viral | 2018 | Open in IMG/M |
3300009169|Ga0105097_10146753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1297 | Open in IMG/M |
3300009169|Ga0105097_10176402 | Not Available | 1176 | Open in IMG/M |
3300009169|Ga0105097_10306502 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 878 | Open in IMG/M |
3300009169|Ga0105097_10365421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 800 | Open in IMG/M |
3300009169|Ga0105097_10492008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300009169|Ga0105097_10573562 | Not Available | 634 | Open in IMG/M |
3300009169|Ga0105097_10666332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300009169|Ga0105097_10756376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 552 | Open in IMG/M |
3300009180|Ga0114979_10327990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
3300009180|Ga0114979_10556531 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
3300009181|Ga0114969_10080830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2117 | Open in IMG/M |
3300009181|Ga0114969_10105008 | Not Available | 1816 | Open in IMG/M |
3300009181|Ga0114969_10111020 | Not Available | 1757 | Open in IMG/M |
3300009181|Ga0114969_10680958 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 555 | Open in IMG/M |
3300009183|Ga0114974_10003798 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11357 | Open in IMG/M |
3300009183|Ga0114974_10163714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1383 | Open in IMG/M |
3300009183|Ga0114974_10558399 | Not Available | 636 | Open in IMG/M |
3300009183|Ga0114974_10574173 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 624 | Open in IMG/M |
3300009184|Ga0114976_10313191 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
3300009184|Ga0114976_10432107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 686 | Open in IMG/M |
3300009184|Ga0114976_10569743 | Not Available | 577 | Open in IMG/M |
3300009185|Ga0114971_10352665 | Not Available | 842 | Open in IMG/M |
3300009187|Ga0114972_10639727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300009194|Ga0114983_1037815 | Not Available | 1182 | Open in IMG/M |
3300009194|Ga0114983_1059408 | Not Available | 887 | Open in IMG/M |
3300009194|Ga0114983_1067099 | Not Available | 821 | Open in IMG/M |
3300009194|Ga0114983_1098069 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 647 | Open in IMG/M |
3300009218|Ga0103848_1082567 | Not Available | 642 | Open in IMG/M |
3300009419|Ga0114982_1052262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1289 | Open in IMG/M |
3300009419|Ga0114982_1164442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 685 | Open in IMG/M |
3300009419|Ga0114982_1294289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 509 | Open in IMG/M |
3300009833|Ga0131968_102435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
3300009915|Ga0132236_102473 | Not Available | 696 | Open in IMG/M |
3300010157|Ga0114964_10048628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2232 | Open in IMG/M |
3300010160|Ga0114967_10017955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5046 | Open in IMG/M |
3300010160|Ga0114967_10061471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2314 | Open in IMG/M |
3300010160|Ga0114967_10428006 | Not Available | 656 | Open in IMG/M |
3300010160|Ga0114967_10573139 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 544 | Open in IMG/M |
3300010354|Ga0129333_10127876 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2338 | Open in IMG/M |
3300010354|Ga0129333_10904473 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
3300010354|Ga0129333_11012252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 698 | Open in IMG/M |
3300010354|Ga0129333_11052661 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 682 | Open in IMG/M |
3300010354|Ga0129333_11424031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → unclassified Micromonospora → Micromonospora sp. C51 | 569 | Open in IMG/M |
3300010368|Ga0129324_10241599 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
3300010374|Ga0114986_1050339 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 756 | Open in IMG/M |
3300010374|Ga0114986_1072329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300010388|Ga0136551_1000253 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15420 | Open in IMG/M |
3300010388|Ga0136551_1026484 | All Organisms → Viruses → Predicted Viral | 1107 | Open in IMG/M |
3300010388|Ga0136551_1057757 | Not Available | 701 | Open in IMG/M |
3300010388|Ga0136551_1073055 | Not Available | 613 | Open in IMG/M |
3300010885|Ga0133913_10924939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2262 | Open in IMG/M |
3300010885|Ga0133913_11003414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2158 | Open in IMG/M |
3300010885|Ga0133913_11156839 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1988 | Open in IMG/M |
3300010885|Ga0133913_11409477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1772 | Open in IMG/M |
3300010885|Ga0133913_11789049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1538 | Open in IMG/M |
3300010885|Ga0133913_11978999 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1449 | Open in IMG/M |
3300010885|Ga0133913_13222121 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
3300010885|Ga0133913_13394033 | Not Available | 1044 | Open in IMG/M |
3300010965|Ga0138308_105803 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8982 | Open in IMG/M |
3300010966|Ga0137675_1000030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14648 | Open in IMG/M |
3300010966|Ga0137675_1008172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300011113|Ga0151517_1423 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15847 | Open in IMG/M |
3300011113|Ga0151517_1451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15160 | Open in IMG/M |
3300011114|Ga0151515_10602 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15253 | Open in IMG/M |
3300011116|Ga0151516_10432 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 20653 | Open in IMG/M |
3300011116|Ga0151516_10633 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16423 | Open in IMG/M |
3300011184|Ga0136709_1025428 | Not Available | 819 | Open in IMG/M |
3300011334|Ga0153697_1279 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17083 | Open in IMG/M |
3300011335|Ga0153698_1525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15883 | Open in IMG/M |
3300011335|Ga0153698_1566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15073 | Open in IMG/M |
3300011335|Ga0153698_1574 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14970 | Open in IMG/M |
3300011335|Ga0153698_1709 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13023 | Open in IMG/M |
3300011335|Ga0153698_1737 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12506 | Open in IMG/M |
3300011335|Ga0153698_1834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11312 | Open in IMG/M |
3300011336|Ga0153703_1454 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14060 | Open in IMG/M |
3300011336|Ga0153703_1617 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11336 | Open in IMG/M |
3300011337|Ga0153702_1561 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12419 | Open in IMG/M |
3300011338|Ga0153699_1954 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10199 | Open in IMG/M |
3300011339|Ga0153700_10736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15711 | Open in IMG/M |
3300011339|Ga0153700_10768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15341 | Open in IMG/M |
3300011339|Ga0153700_10980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13227 | Open in IMG/M |
3300011381|Ga0102688_1542478 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 523 | Open in IMG/M |
3300011984|Ga0119931_1027022 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 671 | Open in IMG/M |
3300012012|Ga0153799_1007474 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2554 | Open in IMG/M |
3300012013|Ga0153805_1072636 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 583 | Open in IMG/M |
3300012017|Ga0153801_1002159 | All Organisms → cellular organisms → Bacteria | 3941 | Open in IMG/M |
3300012266|Ga0136712_1044305 | Not Available | 522 | Open in IMG/M |
3300012663|Ga0157203_1001985 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4745 | Open in IMG/M |
3300012663|Ga0157203_1046409 | Not Available | 591 | Open in IMG/M |
3300012665|Ga0157210_1000520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15635 | Open in IMG/M |
3300012665|Ga0157210_1003753 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3402 | Open in IMG/M |
3300012665|Ga0157210_1006295 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2318 | Open in IMG/M |
3300012666|Ga0157498_1001408 | Not Available | 4320 | Open in IMG/M |
3300012667|Ga0157208_10001436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5354 | Open in IMG/M |
3300012964|Ga0153916_11004885 | Not Available | 914 | Open in IMG/M |
3300012990|Ga0159060_1011930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2244 | Open in IMG/M |
3300012990|Ga0159060_1025838 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1514 | Open in IMG/M |
3300013004|Ga0164293_10062892 | All Organisms → cellular organisms → Bacteria | 2945 | Open in IMG/M |
3300013004|Ga0164293_10251157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1249 | Open in IMG/M |
3300013004|Ga0164293_10699989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
3300013004|Ga0164293_10702144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 648 | Open in IMG/M |
3300013005|Ga0164292_10269381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1177 | Open in IMG/M |
3300013005|Ga0164292_10343763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
3300013005|Ga0164292_10436987 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
3300013006|Ga0164294_10026809 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4652 | Open in IMG/M |
3300013006|Ga0164294_10030027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4360 | Open in IMG/M |
3300013006|Ga0164294_10290017 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1137 | Open in IMG/M |
3300013010|Ga0129327_10098200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1443 | Open in IMG/M |
(restricted) 3300013122|Ga0172374_1026930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2559 | Open in IMG/M |
3300013295|Ga0170791_12443975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 732 | Open in IMG/M |
3300014050|Ga0119952_1095587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 704 | Open in IMG/M |
3300014711|Ga0134314_101699 | Not Available | 1653 | Open in IMG/M |
3300014711|Ga0134314_104448 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300014711|Ga0134314_104959 | Not Available | 876 | Open in IMG/M |
3300014711|Ga0134314_109845 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 627 | Open in IMG/M |
3300014711|Ga0134314_113262 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
(restricted) 3300014720|Ga0172376_10043288 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3687 | Open in IMG/M |
3300014811|Ga0119960_1081858 | Not Available | 576 | Open in IMG/M |
3300014960|Ga0134316_1016143 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 813 | Open in IMG/M |
3300014962|Ga0134315_1000278 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12741 | Open in IMG/M |
3300014962|Ga0134315_1000314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11817 | Open in IMG/M |
3300014962|Ga0134315_1013773 | Not Available | 1270 | Open in IMG/M |
3300017716|Ga0181350_1072796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 879 | Open in IMG/M |
3300017716|Ga0181350_1128368 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300017722|Ga0181347_1040723 | All Organisms → Viruses → Predicted Viral | 1424 | Open in IMG/M |
3300017723|Ga0181362_1054247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 830 | Open in IMG/M |
3300017754|Ga0181344_1007648 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3548 | Open in IMG/M |
3300017754|Ga0181344_1233089 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300017766|Ga0181343_1034500 | All Organisms → Viruses → Predicted Viral | 1521 | Open in IMG/M |
3300017774|Ga0181358_1024828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2371 | Open in IMG/M |
3300017777|Ga0181357_1082358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1231 | Open in IMG/M |
3300017780|Ga0181346_1086293 | Not Available | 1231 | Open in IMG/M |
3300017784|Ga0181348_1013431 | All Organisms → Viruses → Predicted Viral | 3528 | Open in IMG/M |
3300017784|Ga0181348_1276768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 570 | Open in IMG/M |
3300017784|Ga0181348_1301321 | Not Available | 536 | Open in IMG/M |
3300017785|Ga0181355_1176935 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 849 | Open in IMG/M |
3300017963|Ga0180437_10207731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1536 | Open in IMG/M |
3300017971|Ga0180438_10346464 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1134 | Open in IMG/M |
3300018420|Ga0181563_10176782 | Not Available | 1320 | Open in IMG/M |
3300018420|Ga0181563_10392544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 793 | Open in IMG/M |
3300018815|Ga0187845_1060270 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1313 | Open in IMG/M |
3300019784|Ga0181359_1000198 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12649 | Open in IMG/M |
3300019784|Ga0181359_1001520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6262 | Open in IMG/M |
3300019784|Ga0181359_1001950 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5800 | Open in IMG/M |
3300019784|Ga0181359_1008200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3599 | Open in IMG/M |
3300019784|Ga0181359_1010609 | All Organisms → Viruses → Predicted Viral | 3277 | Open in IMG/M |
3300019784|Ga0181359_1029786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2103 | Open in IMG/M |
3300019784|Ga0181359_1052112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1577 | Open in IMG/M |
3300019784|Ga0181359_1069550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1335 | Open in IMG/M |
3300019784|Ga0181359_1170482 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300019784|Ga0181359_1219299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 599 | Open in IMG/M |
3300019784|Ga0181359_1271905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
3300020159|Ga0211734_11208631 | Not Available | 751 | Open in IMG/M |
3300020161|Ga0211726_10289442 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
3300020162|Ga0211735_11408994 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 739 | Open in IMG/M |
3300020183|Ga0194115_10287240 | Not Available | 758 | Open in IMG/M |
3300020205|Ga0211731_10897889 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15337 | Open in IMG/M |
3300020205|Ga0211731_11351077 | All Organisms → cellular organisms → Bacteria | 5887 | Open in IMG/M |
3300020498|Ga0208050_1016369 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 789 | Open in IMG/M |
3300020505|Ga0208088_1001144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4363 | Open in IMG/M |
3300020516|Ga0207935_1009983 | Not Available | 1458 | Open in IMG/M |
3300020530|Ga0208235_1028097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 678 | Open in IMG/M |
3300020533|Ga0208364_1001014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5852 | Open in IMG/M |
3300020542|Ga0208857_1029098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 891 | Open in IMG/M |
3300020549|Ga0207942_1028341 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 706 | Open in IMG/M |
3300020549|Ga0207942_1032257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 657 | Open in IMG/M |
3300020549|Ga0207942_1041461 | Not Available | 571 | Open in IMG/M |
3300020551|Ga0208360_1003717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2486 | Open in IMG/M |
3300020553|Ga0208855_1013208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1312 | Open in IMG/M |
3300020554|Ga0208599_1064137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 506 | Open in IMG/M |
3300020570|Ga0208465_1000240 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16950 | Open in IMG/M |
3300021091|Ga0194133_10155435 | Not Available | 1618 | Open in IMG/M |
3300021108|Ga0214162_1062948 | Not Available | 608 | Open in IMG/M |
3300021438|Ga0213920_1001538 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12555 | Open in IMG/M |
3300021438|Ga0213920_1002322 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9184 | Open in IMG/M |
3300021438|Ga0213920_1004112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5838 | Open in IMG/M |
3300021438|Ga0213920_1004967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5017 | Open in IMG/M |
3300021438|Ga0213920_1008609 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3208 | Open in IMG/M |
3300021438|Ga0213920_1023378 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1493 | Open in IMG/M |
3300021438|Ga0213920_1057555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 791 | Open in IMG/M |
3300021519|Ga0194048_10001618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11230 | Open in IMG/M |
3300021519|Ga0194048_10026790 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2452 | Open in IMG/M |
3300021519|Ga0194048_10039213 | All Organisms → Viruses → Predicted Viral | 1953 | Open in IMG/M |
3300021519|Ga0194048_10054452 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1605 | Open in IMG/M |
3300021519|Ga0194048_10063319 | All Organisms → Viruses → Predicted Viral | 1467 | Open in IMG/M |
3300021602|Ga0194060_10103851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1561 | Open in IMG/M |
3300021602|Ga0194060_10166522 | All Organisms → Viruses → Predicted Viral | 1157 | Open in IMG/M |
3300021602|Ga0194060_10384026 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
3300021952|Ga0213921_1000328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16841 | Open in IMG/M |
3300021952|Ga0213921_1000662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10532 | Open in IMG/M |
3300021952|Ga0213921_1000828 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9193 | Open in IMG/M |
3300021952|Ga0213921_1007289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2154 | Open in IMG/M |
3300021952|Ga0213921_1028727 | Not Available | 895 | Open in IMG/M |
3300021952|Ga0213921_1048058 | Not Available | 634 | Open in IMG/M |
3300021956|Ga0213922_1041738 | Not Available | 1052 | Open in IMG/M |
3300021956|Ga0213922_1051779 | Not Available | 911 | Open in IMG/M |
3300021956|Ga0213922_1061302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300021956|Ga0213922_1107216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 559 | Open in IMG/M |
3300021956|Ga0213922_1115010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
3300021956|Ga0213922_1120879 | Not Available | 516 | Open in IMG/M |
3300021956|Ga0213922_1122850 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 510 | Open in IMG/M |
3300021960|Ga0222715_10210675 | Not Available | 1156 | Open in IMG/M |
3300021961|Ga0222714_10020195 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5232 | Open in IMG/M |
3300021961|Ga0222714_10079650 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2140 | Open in IMG/M |
3300021961|Ga0222714_10116174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1661 | Open in IMG/M |
3300021962|Ga0222713_10011247 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8007 | Open in IMG/M |
3300021962|Ga0222713_10171353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1478 | Open in IMG/M |
3300021962|Ga0222713_10354357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 917 | Open in IMG/M |
3300021962|Ga0222713_10681721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300021963|Ga0222712_10003303 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17665 | Open in IMG/M |
3300021963|Ga0222712_10088264 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2198 | Open in IMG/M |
3300021963|Ga0222712_10161661 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1501 | Open in IMG/M |
3300021963|Ga0222712_10218117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1238 | Open in IMG/M |
3300021963|Ga0222712_10337638 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 933 | Open in IMG/M |
3300022176|Ga0212031_1020545 | Not Available | 1025 | Open in IMG/M |
3300022179|Ga0181353_1004868 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3131 | Open in IMG/M |
3300022179|Ga0181353_1160500 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300022190|Ga0181354_1148011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300022190|Ga0181354_1219925 | Not Available | 556 | Open in IMG/M |
3300022190|Ga0181354_1229835 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300022200|Ga0196901_1007185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4860 | Open in IMG/M |
3300022407|Ga0181351_1089059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1214 | Open in IMG/M |
3300022543|Ga0212119_1007018 | All Organisms → Viruses → Predicted Viral | 2437 | Open in IMG/M |
3300022746|Ga0228701_1005220 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6126 | Open in IMG/M |
3300022746|Ga0228701_1103975 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 581 | Open in IMG/M |
3300022747|Ga0228703_1002621 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9873 | Open in IMG/M |
3300022747|Ga0228703_1012751 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3005 | Open in IMG/M |
3300022748|Ga0228702_1062571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
3300022752|Ga0214917_10004263 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16025 | Open in IMG/M |
3300022752|Ga0214917_10081819 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1968 | Open in IMG/M |
3300022752|Ga0214917_10130527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1375 | Open in IMG/M |
3300022752|Ga0214917_10285413 | Not Available | 744 | Open in IMG/M |
3300022752|Ga0214917_10319307 | Not Available | 680 | Open in IMG/M |
3300022752|Ga0214917_10362581 | Not Available | 614 | Open in IMG/M |
3300023174|Ga0214921_10006972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15230 | Open in IMG/M |
3300023174|Ga0214921_10007114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15030 | Open in IMG/M |
3300023174|Ga0214921_10012420 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10182 | Open in IMG/M |
3300023174|Ga0214921_10074150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2748 | Open in IMG/M |
3300023174|Ga0214921_10085756 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2456 | Open in IMG/M |
3300023174|Ga0214921_10091074 | All Organisms → Viruses → Predicted Viral | 2344 | Open in IMG/M |
3300023174|Ga0214921_10278467 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 953 | Open in IMG/M |
3300023179|Ga0214923_10032714 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4289 | Open in IMG/M |
3300023184|Ga0214919_10003948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21981 | Open in IMG/M |
3300023184|Ga0214919_10003948 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 21981 | Open in IMG/M |
3300023184|Ga0214919_10047702 | All Organisms → Viruses → Predicted Viral | 4139 | Open in IMG/M |
3300023184|Ga0214919_10048196 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4110 | Open in IMG/M |
3300023184|Ga0214919_10114197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2253 | Open in IMG/M |
3300023301|Ga0209414_1013722 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2865 | Open in IMG/M |
3300024289|Ga0255147_1037236 | Not Available | 973 | Open in IMG/M |
3300024306|Ga0255148_1008321 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2116 | Open in IMG/M |
3300024343|Ga0244777_10661215 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 628 | Open in IMG/M |
3300024348|Ga0244776_10020181 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5504 | Open in IMG/M |
3300024348|Ga0244776_10430192 | Not Available | 868 | Open in IMG/M |
3300024348|Ga0244776_10930430 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300024352|Ga0255142_1056796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
3300024352|Ga0255142_1068872 | Not Available | 536 | Open in IMG/M |
3300024513|Ga0255144_1029745 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 937 | Open in IMG/M |
3300025075|Ga0209615_103460 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 951 | Open in IMG/M |
3300025091|Ga0209616_1013939 | Not Available | 822 | Open in IMG/M |
3300025091|Ga0209616_1032570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 533 | Open in IMG/M |
3300025451|Ga0208426_1066955 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
3300025543|Ga0208303_1024834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1657 | Open in IMG/M |
3300025543|Ga0208303_1049733 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1023 | Open in IMG/M |
3300025585|Ga0208546_1000425 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15751 | Open in IMG/M |
3300025585|Ga0208546_1000608 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12516 | Open in IMG/M |
3300025585|Ga0208546_1017470 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1835 | Open in IMG/M |
3300025635|Ga0208147_1003384 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4734 | Open in IMG/M |
3300025635|Ga0208147_1019291 | Not Available | 1835 | Open in IMG/M |
3300025645|Ga0208643_1114804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 721 | Open in IMG/M |
3300025645|Ga0208643_1116937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 712 | Open in IMG/M |
3300025645|Ga0208643_1124276 | Not Available | 680 | Open in IMG/M |
3300025646|Ga0208161_1006397 | Not Available | 5279 | Open in IMG/M |
3300025687|Ga0208019_1109491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 834 | Open in IMG/M |
3300025687|Ga0208019_1142858 | Not Available | 683 | Open in IMG/M |
3300025872|Ga0208783_10066074 | Not Available | 1629 | Open in IMG/M |
3300025889|Ga0208644_1045171 | All Organisms → Viruses → Predicted Viral | 2492 | Open in IMG/M |
3300025889|Ga0208644_1143691 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1105 | Open in IMG/M |
3300025889|Ga0208644_1150627 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1067 | Open in IMG/M |
3300025889|Ga0208644_1158260 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1030 | Open in IMG/M |
3300025889|Ga0208644_1170932 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 974 | Open in IMG/M |
3300025889|Ga0208644_1326850 | Not Available | 596 | Open in IMG/M |
3300025896|Ga0208916_10013980 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3138 | Open in IMG/M |
3300025896|Ga0208916_10014011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3134 | Open in IMG/M |
3300025896|Ga0208916_10164363 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 956 | Open in IMG/M |
3300025896|Ga0208916_10260226 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
3300025896|Ga0208916_10336014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 658 | Open in IMG/M |
3300025896|Ga0208916_10404490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 595 | Open in IMG/M |
3300025896|Ga0208916_10475986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300025896|Ga0208916_10489248 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 536 | Open in IMG/M |
3300025896|Ga0208916_10496434 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 531 | Open in IMG/M |
3300026478|Ga0255156_1010189 | Not Available | 1902 | Open in IMG/M |
3300026570|Ga0255274_1159072 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
3300026993|Ga0209975_1000946 | All Organisms → cellular organisms → Bacteria | 2940 | Open in IMG/M |
3300027114|Ga0208009_1069900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
3300027121|Ga0255074_1028429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
3300027365|Ga0209300_1041720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 829 | Open in IMG/M |
3300027631|Ga0208133_1063652 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 880 | Open in IMG/M |
3300027631|Ga0208133_1121909 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
3300027659|Ga0208975_1038465 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1502 | Open in IMG/M |
3300027659|Ga0208975_1116935 | Not Available | 763 | Open in IMG/M |
3300027659|Ga0208975_1179986 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300027708|Ga0209188_1052095 | Not Available | 1812 | Open in IMG/M |
3300027708|Ga0209188_1096381 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1196 | Open in IMG/M |
3300027710|Ga0209599_10086189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 825 | Open in IMG/M |
3300027710|Ga0209599_10127647 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 673 | Open in IMG/M |
3300027712|Ga0209499_1001469 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16234 | Open in IMG/M |
3300027721|Ga0209492_1001687 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6872 | Open in IMG/M |
3300027721|Ga0209492_1003880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4804 | Open in IMG/M |
3300027721|Ga0209492_1235664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 622 | Open in IMG/M |
3300027721|Ga0209492_1277020 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
3300027721|Ga0209492_1294785 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 541 | Open in IMG/M |
3300027732|Ga0209442_1021030 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3028 | Open in IMG/M |
3300027732|Ga0209442_1083467 | Not Available | 1314 | Open in IMG/M |
3300027733|Ga0209297_1008038 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5256 | Open in IMG/M |
3300027733|Ga0209297_1046752 | Not Available | 1964 | Open in IMG/M |
3300027733|Ga0209297_1095138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1282 | Open in IMG/M |
3300027733|Ga0209297_1134973 | Not Available | 1027 | Open in IMG/M |
3300027733|Ga0209297_1244460 | Not Available | 691 | Open in IMG/M |
3300027733|Ga0209297_1273323 | Not Available | 640 | Open in IMG/M |
3300027734|Ga0209087_1001022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16825 | Open in IMG/M |
3300027734|Ga0209087_1001797 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12468 | Open in IMG/M |
3300027734|Ga0209087_1013021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4206 | Open in IMG/M |
3300027734|Ga0209087_1085677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1360 | Open in IMG/M |
3300027734|Ga0209087_1302419 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 570 | Open in IMG/M |
3300027734|Ga0209087_1357967 | Not Available | 502 | Open in IMG/M |
3300027736|Ga0209190_1132887 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1100 | Open in IMG/M |
3300027743|Ga0209593_10233200 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300027749|Ga0209084_1091666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1355 | Open in IMG/M |
3300027754|Ga0209596_1002510 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15147 | Open in IMG/M |
3300027754|Ga0209596_1016107 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4657 | Open in IMG/M |
3300027754|Ga0209596_1165183 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 972 | Open in IMG/M |
3300027754|Ga0209596_1198491 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 857 | Open in IMG/M |
3300027754|Ga0209596_1296296 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 644 | Open in IMG/M |
3300027756|Ga0209444_10084943 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1330 | Open in IMG/M |
3300027759|Ga0209296_1001930 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15188 | Open in IMG/M |
3300027759|Ga0209296_1040070 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2511 | Open in IMG/M |
3300027760|Ga0209598_10178055 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 918 | Open in IMG/M |
3300027763|Ga0209088_10013562 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4339 | Open in IMG/M |
3300027763|Ga0209088_10014882 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4124 | Open in IMG/M |
3300027763|Ga0209088_10115764 | All Organisms → Viruses → Predicted Viral | 1215 | Open in IMG/M |
3300027763|Ga0209088_10315266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 629 | Open in IMG/M |
3300027764|Ga0209134_10006243 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3521 | Open in IMG/M |
3300027769|Ga0209770_10078945 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1372 | Open in IMG/M |
3300027770|Ga0209086_10026530 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3528 | Open in IMG/M |
3300027782|Ga0209500_10032208 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2942 | Open in IMG/M |
3300027782|Ga0209500_10128078 | Not Available | 1221 | Open in IMG/M |
3300027785|Ga0209246_10216637 | Not Available | 746 | Open in IMG/M |
3300027785|Ga0209246_10217804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 744 | Open in IMG/M |
3300027792|Ga0209287_10144841 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 899 | Open in IMG/M |
3300027793|Ga0209972_10002137 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16451 | Open in IMG/M |
3300027793|Ga0209972_10004059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 11200 | Open in IMG/M |
3300027793|Ga0209972_10045833 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2413 | Open in IMG/M |
3300027797|Ga0209107_10008267 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5836 | Open in IMG/M |
3300027798|Ga0209353_10066890 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1640 | Open in IMG/M |
3300027798|Ga0209353_10225227 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300027798|Ga0209353_10270361 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
3300027805|Ga0209229_10002022 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8295 | Open in IMG/M |
3300027805|Ga0209229_10114403 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1216 | Open in IMG/M |
3300027805|Ga0209229_10168445 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 984 | Open in IMG/M |
3300027805|Ga0209229_10212556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 865 | Open in IMG/M |
3300027805|Ga0209229_10374169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300027805|Ga0209229_10404700 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300027808|Ga0209354_10014400 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3153 | Open in IMG/M |
3300027816|Ga0209990_10002740 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13489 | Open in IMG/M |
3300027816|Ga0209990_10066867 | All Organisms → cellular organisms → Bacteria | 1794 | Open in IMG/M |
3300027892|Ga0209550_10356415 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 919 | Open in IMG/M |
3300027899|Ga0209668_10814226 | Not Available | 629 | Open in IMG/M |
3300027917|Ga0209536_101414690 | Not Available | 848 | Open in IMG/M |
3300027956|Ga0209820_1039433 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1239 | Open in IMG/M |
3300027956|Ga0209820_1049206 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
3300027963|Ga0209400_1001794 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16790 | Open in IMG/M |
3300027963|Ga0209400_1003106 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12237 | Open in IMG/M |
3300027963|Ga0209400_1020088 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3950 | Open in IMG/M |
3300027969|Ga0209191_1049394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1931 | Open in IMG/M |
3300027969|Ga0209191_1053969 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1827 | Open in IMG/M |
3300027969|Ga0209191_1142878 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
3300027972|Ga0209079_10331628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 515 | Open in IMG/M |
3300028025|Ga0247723_1001780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12192 | Open in IMG/M |
3300028025|Ga0247723_1002893 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8838 | Open in IMG/M |
3300028025|Ga0247723_1004349 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6747 | Open in IMG/M |
3300028025|Ga0247723_1006589 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5054 | Open in IMG/M |
3300028025|Ga0247723_1011002 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3491 | Open in IMG/M |
3300028025|Ga0247723_1033003 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1610 | Open in IMG/M |
3300028025|Ga0247723_1036421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1501 | Open in IMG/M |
3300028103|Ga0255172_1010348 | Not Available | 1837 | Open in IMG/M |
3300028394|Ga0304730_1001655 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 16537 | Open in IMG/M |
3300028394|Ga0304730_1001907 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15335 | Open in IMG/M |
3300029349|Ga0238435_117593 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
3300029930|Ga0119944_1000066 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15810 | Open in IMG/M |
3300029930|Ga0119944_1026496 | Not Available | 764 | Open in IMG/M |
3300031758|Ga0315907_10000950 | Not Available | 39694 | Open in IMG/M |
3300031758|Ga0315907_10004720 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15167 | Open in IMG/M |
3300031758|Ga0315907_10012328 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 8351 | Open in IMG/M |
3300031758|Ga0315907_10031279 | All Organisms → cellular organisms → Bacteria | 4804 | Open in IMG/M |
3300031758|Ga0315907_10079779 | All Organisms → cellular organisms → Bacteria | 2824 | Open in IMG/M |
3300031758|Ga0315907_10085052 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2724 | Open in IMG/M |
3300031758|Ga0315907_10113916 | All Organisms → cellular organisms → Bacteria | 2311 | Open in IMG/M |
3300031758|Ga0315907_10384466 | Not Available | 1135 | Open in IMG/M |
3300031758|Ga0315907_10427332 | Not Available | 1062 | Open in IMG/M |
3300031758|Ga0315907_10455676 | Not Available | 1020 | Open in IMG/M |
3300031758|Ga0315907_10672359 | Not Available | 792 | Open in IMG/M |
3300031758|Ga0315907_10811893 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 697 | Open in IMG/M |
3300031758|Ga0315907_11013725 | Not Available | 598 | Open in IMG/M |
3300031787|Ga0315900_10036804 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5348 | Open in IMG/M |
3300031787|Ga0315900_10376332 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1133 | Open in IMG/M |
3300031787|Ga0315900_10562800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 845 | Open in IMG/M |
3300031787|Ga0315900_10686695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300031787|Ga0315900_10786860 | Not Available | 658 | Open in IMG/M |
3300031787|Ga0315900_10911453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300031857|Ga0315909_10017504 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7311 | Open in IMG/M |
3300031857|Ga0315909_10017586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7293 | Open in IMG/M |
3300031857|Ga0315909_10033376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4955 | Open in IMG/M |
3300031857|Ga0315909_10038114 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4577 | Open in IMG/M |
3300031857|Ga0315909_10039030 | All Organisms → cellular organisms → Bacteria | 4511 | Open in IMG/M |
3300031857|Ga0315909_10048793 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3937 | Open in IMG/M |
3300031857|Ga0315909_10060682 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3439 | Open in IMG/M |
3300031857|Ga0315909_10286387 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1241 | Open in IMG/M |
3300031857|Ga0315909_10453021 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 901 | Open in IMG/M |
3300031857|Ga0315909_10599477 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 736 | Open in IMG/M |
3300031857|Ga0315909_10981329 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
3300031951|Ga0315904_10020770 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7900 | Open in IMG/M |
3300031951|Ga0315904_10125512 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2647 | Open in IMG/M |
3300031951|Ga0315904_10356938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1342 | Open in IMG/M |
3300031951|Ga0315904_10365684 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1321 | Open in IMG/M |
3300031951|Ga0315904_11221301 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300031963|Ga0315901_10011010 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10221 | Open in IMG/M |
3300031963|Ga0315901_10521232 | Not Available | 921 | Open in IMG/M |
3300031963|Ga0315901_10582629 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300031963|Ga0315901_10683664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300031963|Ga0315901_11055979 | Not Available | 562 | Open in IMG/M |
3300031963|Ga0315901_11102445 | Not Available | 545 | Open in IMG/M |
3300032092|Ga0315905_10019873 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6801 | Open in IMG/M |
3300032092|Ga0315905_10818917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 807 | Open in IMG/M |
3300032092|Ga0315905_11315286 | Not Available | 581 | Open in IMG/M |
3300032093|Ga0315902_10128659 | All Organisms → cellular organisms → Bacteria | 2681 | Open in IMG/M |
3300032093|Ga0315902_10232284 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1814 | Open in IMG/M |
3300032093|Ga0315902_10656172 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 866 | Open in IMG/M |
3300032116|Ga0315903_10039062 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4963 | Open in IMG/M |
3300032116|Ga0315903_10066885 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3564 | Open in IMG/M |
3300032116|Ga0315903_10186718 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1858 | Open in IMG/M |
3300032116|Ga0315903_10436879 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1054 | Open in IMG/M |
3300032116|Ga0315903_10478860 | Not Available | 989 | Open in IMG/M |
3300032116|Ga0315903_10592587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 853 | Open in IMG/M |
3300032116|Ga0315903_10957789 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
3300032116|Ga0315903_11103171 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 544 | Open in IMG/M |
3300033521|Ga0316616_102202474 | Not Available | 734 | Open in IMG/M |
3300033993|Ga0334994_0130799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1435 | Open in IMG/M |
3300033993|Ga0334994_0218851 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
3300033993|Ga0334994_0510972 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
3300033995|Ga0335003_0005471 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6454 | Open in IMG/M |
3300033995|Ga0335003_0043344 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2424 | Open in IMG/M |
3300033996|Ga0334979_0034308 | All Organisms → cellular organisms → Bacteria | 3361 | Open in IMG/M |
3300033996|Ga0334979_0756571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
3300034012|Ga0334986_0013238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5830 | Open in IMG/M |
3300034018|Ga0334985_0002197 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15663 | Open in IMG/M |
3300034018|Ga0334985_0238562 | Not Available | 1175 | Open in IMG/M |
3300034019|Ga0334998_0488782 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 689 | Open in IMG/M |
3300034020|Ga0335002_0316078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 904 | Open in IMG/M |
3300034051|Ga0335024_0450615 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 635 | Open in IMG/M |
3300034061|Ga0334987_0003966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 14157 | Open in IMG/M |
3300034061|Ga0334987_0015592 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6944 | Open in IMG/M |
3300034061|Ga0334987_0224311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1301 | Open in IMG/M |
3300034061|Ga0334987_0686126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
3300034061|Ga0334987_0801392 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300034062|Ga0334995_0257942 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1169 | Open in IMG/M |
3300034062|Ga0334995_0353517 | Not Available | 939 | Open in IMG/M |
3300034062|Ga0334995_0408456 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 847 | Open in IMG/M |
3300034062|Ga0334995_0723407 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 557 | Open in IMG/M |
3300034062|Ga0334995_0769249 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
3300034064|Ga0335001_0245520 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300034066|Ga0335019_0057527 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2651 | Open in IMG/M |
3300034066|Ga0335019_0532535 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 697 | Open in IMG/M |
3300034071|Ga0335028_0433881 | Not Available | 742 | Open in IMG/M |
3300034073|Ga0310130_0001595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12006 | Open in IMG/M |
3300034082|Ga0335020_0217537 | Not Available | 952 | Open in IMG/M |
3300034092|Ga0335010_0331307 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 860 | Open in IMG/M |
3300034101|Ga0335027_0002565 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15873 | Open in IMG/M |
3300034102|Ga0335029_0251480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1142 | Open in IMG/M |
3300034102|Ga0335029_0317421 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 976 | Open in IMG/M |
3300034103|Ga0335030_0001862 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 17013 | Open in IMG/M |
3300034103|Ga0335030_0511342 | Not Available | 755 | Open in IMG/M |
3300034104|Ga0335031_0017508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5252 | Open in IMG/M |
3300034104|Ga0335031_0069525 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2513 | Open in IMG/M |
3300034104|Ga0335031_0232350 | Not Available | 1232 | Open in IMG/M |
3300034104|Ga0335031_0236410 | Not Available | 1218 | Open in IMG/M |
3300034104|Ga0335031_0711153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300034105|Ga0335035_0124061 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1645 | Open in IMG/M |
3300034110|Ga0335055_0011554 | All Organisms → cellular organisms → Bacteria | 4132 | Open in IMG/M |
3300034111|Ga0335063_0016508 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4748 | Open in IMG/M |
3300034116|Ga0335068_0562618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 519 | Open in IMG/M |
3300034119|Ga0335054_0629027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
3300034120|Ga0335056_0596846 | Not Available | 570 | Open in IMG/M |
3300034121|Ga0335058_0002150 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13658 | Open in IMG/M |
3300034121|Ga0335058_0806550 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 511 | Open in IMG/M |
3300034122|Ga0335060_0507131 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 621 | Open in IMG/M |
3300034166|Ga0335016_0004084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13279 | Open in IMG/M |
3300034168|Ga0335061_0382560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 728 | Open in IMG/M |
3300034283|Ga0335007_0749064 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 538 | Open in IMG/M |
3300034356|Ga0335048_0058275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2460 | Open in IMG/M |
3300034356|Ga0335048_0221601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1028 | Open in IMG/M |
3300034523|Ga0310143_00708 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 15369 | Open in IMG/M |
3300034523|Ga0310143_08320 | Not Available | 1288 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 14.98% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 12.65% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.32% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.32% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 6.22% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 4.88% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 4.77% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 3.22% |
Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 2.77% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.66% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 2.22% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.22% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 1.55% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.44% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.44% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.11% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 1.00% |
Surface Water | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Surface Water | 1.00% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.00% |
Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.89% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.78% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.78% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.78% |
Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.78% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 0.67% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.67% |
Marine Plankton | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton | 0.67% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.67% |
Pond Fresh Water | Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water | 0.67% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.67% |
Lake | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Lake | 0.55% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.55% |
Freshwater | Environmental → Aquatic → Freshwater → Pond → Sediment → Freshwater | 0.44% |
Water Bodies | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Water Bodies | 0.33% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 0.33% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.22% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 0.22% |
Meromictic Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond | 0.22% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.22% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 0.22% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.22% |
Hypersaline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline | 0.22% |
Hypersaline Lake Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Sediment → Hypersaline Lake Sediment | 0.22% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.22% |
Wetland | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland | 0.11% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.11% |
Freshwater, Surface Ice | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Surface Ice | 0.11% |
Lake Chemocline | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Chemocline | 0.11% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.11% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.11% |
Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.11% |
Aquatic | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Aquatic | 0.11% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.11% |
Surface Ice | Environmental → Aquatic → Freshwater → Ice → Unclassified → Surface Ice | 0.11% |
Stormwater Retention Pond | Environmental → Aquatic → Freshwater → Pond → Unclassified → Stormwater Retention Pond | 0.11% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Microbialites → Unclassified → Freshwater Lake | 0.11% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.11% |
Estuary Water | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuary Water | 0.11% |
Marine Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Estuarine | 0.11% |
Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.11% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.11% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.11% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000405 | Hypersaline microbial communities from Lake Vida, Antarctica - sample: Brine Hole Two 0.1-0.2 micron | Environmental | Open in IMG/M |
3300000558 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300001371 | Baker-B-sed | Environmental | Open in IMG/M |
3300001605 | Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling Basin | Engineered | Open in IMG/M |
3300001838 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2a | Environmental | Open in IMG/M |
3300001848 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a | Environmental | Open in IMG/M |
3300001849 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM26, ROCA_DNA190_2.0um_MCP-N_C_2b | Environmental | Open in IMG/M |
3300001850 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a | Environmental | Open in IMG/M |
3300002198 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUL 2013 | Environmental | Open in IMG/M |
3300002199 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - JUN 2013 | Environmental | Open in IMG/M |
3300002200 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - APR 2013 | Environmental | Open in IMG/M |
3300002220 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - West In Pit SyncrudeMLSB2011 | Engineered | Open in IMG/M |
3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
3300002465 | Anoxic frehswater biofilm from Lago dell Orsa, Frasassi caves, Italy | Environmental | Open in IMG/M |
3300002471 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - MAY 2013 | Environmental | Open in IMG/M |
3300002476 | Freshwater microbial communities from San Paulo Zoo lake, Brazil - NOV 2012 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300002844 | Stormwater retention pond microbial communities from Williamsburg, VA - Sample from Jamestown High School | Environmental | Open in IMG/M |
3300002930 | Estuary water microbial communities from Pearl Estuary, Zhujiang, China | Environmental | Open in IMG/M |
3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
3300003393 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD | Environmental | Open in IMG/M |
3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003411 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD | Environmental | Open in IMG/M |
3300003412 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD | Environmental | Open in IMG/M |
3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300003430 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD | Environmental | Open in IMG/M |
3300003431 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN | Environmental | Open in IMG/M |
3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
3300003499 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004282 | Freshwater pond sediment microbial communities from the University of Edinburgh, under environmental carbon perturbations - Initial sediment | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300004829 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVs | Environmental | Open in IMG/M |
3300005416 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel2S_0400h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005417 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005421 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
3300006018 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006803 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_>0.8_DNA | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300006863 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_>0.8_DNA | Environmental | Open in IMG/M |
3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
3300007165 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 | Environmental | Open in IMG/M |
3300007169 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Bottom layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007171 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface layer) 8 sequencing projects | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
3300007304 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaT (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300007344 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007622 | Estuarine microbial communities from the Columbia River estuary - metaG 1449A-02 | Environmental | Open in IMG/M |
3300007636 | Estuarine microbial communities from the Columbia River estuary - metaG 1371A-3 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300007734 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Jan | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008072 | Microbial Communities in Water bodies, Singapore - Site MA | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
3300008110 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA | Environmental | Open in IMG/M |
3300008111 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
3300008263 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-53-LTR | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300008459 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - July 8, 2014 all contigs | Environmental | Open in IMG/M |
3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
3300009075 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009091 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300009131 | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Open_0915_D1 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
3300009158 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
3300009163 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG | Environmental | Open in IMG/M |
3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009168 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
3300009185 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG | Environmental | Open in IMG/M |
3300009187 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
3300009833 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 2, 3m depth; RNA IDBA-UD | Environmental | Open in IMG/M |
3300009915 | Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 7, surface; RNA IDBA-UD | Environmental | Open in IMG/M |
3300010157 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG | Environmental | Open in IMG/M |
3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010374 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S-1-Day17 | Environmental | Open in IMG/M |
3300010388 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV, may 2015 | Environmental | Open in IMG/M |
3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
3300010965 | Microbial communities from Lake Cadagno chemocline, Switzerland. Combined Assembly of Gp0156211, Gp0156621 | Environmental | Open in IMG/M |
3300010966 | Freshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1bis, april 2016 | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300011114 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb | Environmental | Open in IMG/M |
3300011116 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Nov | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300011334 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Daesung | Environmental | Open in IMG/M |
3300011335 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Guman | Environmental | Open in IMG/M |
3300011336 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Paldang | Environmental | Open in IMG/M |
3300011337 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Ilsan | Environmental | Open in IMG/M |
3300011338 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Haengju | Environmental | Open in IMG/M |
3300011339 | Lotic viral community from Han River, Hwacheon, Gangwon-do, South Korea - Hannam | Environmental | Open in IMG/M |
3300011381 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel7S_1600h metaT (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300011984 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201107 | Environmental | Open in IMG/M |
3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012013 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 67 - Surface Ice | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012266 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - JTO19cm metaG | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
3300012666 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Surface Ice version 2 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012990 | Tailings pond microbial communities from Northern Alberta -TP6_2010 BML May 2015 | Engineered | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
3300013010 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNA | Environmental | Open in IMG/M |
3300013122 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10.3m | Environmental | Open in IMG/M |
3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
3300014050 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007B | Environmental | Open in IMG/M |
3300014711 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0111 | Environmental | Open in IMG/M |
3300014720 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_35m | Environmental | Open in IMG/M |
3300014811 | Aquatic viral communities from ballast water - Michigan State University - AB_ballast water | Environmental | Open in IMG/M |
3300014960 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0709 | Environmental | Open in IMG/M |
3300014962 | Surface water microbial communities from Bangladesh - BaraHaldiaSW0309 | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017774 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017963 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_1 metaG | Environmental | Open in IMG/M |
3300017971 | Hypersaline lake sediment archaeal communities from the Salton Sea, California, USA - SS_3_D_2 metaG | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018815 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - SP09_SKY_68 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020505 | Freshwater microbial communities from Lake Mendota, WI - 02APR2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020516 | Freshwater microbial communities from Lake Mendota, WI - 30AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020530 | Freshwater microbial communities from Lake Mendota, WI - 22OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020533 | Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020549 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020551 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
3300020553 | Freshwater microbial communities from Lake Mendota, WI - 17MAY2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020554 | Freshwater microbial communities from Lake Mendota, WI - 17AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021108 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
3300021438 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MG | Environmental | Open in IMG/M |
3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
3300021952 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17 MG | Environmental | Open in IMG/M |
3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300022543 | Indian_combined assembly | Environmental | Open in IMG/M |
3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
3300022747 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG | Environmental | Open in IMG/M |
3300022748 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MG | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
3300023301 | Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes) | Environmental | Open in IMG/M |
3300024289 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepA_8h | Environmental | Open in IMG/M |
3300024306 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Miss_RepB_8h | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024352 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepB_0h | Environmental | Open in IMG/M |
3300024513 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepA_8h | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
3300025451 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300026478 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atlam_RepA_8h | Environmental | Open in IMG/M |
3300026570 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300026993 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel4S_1600h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
3300027121 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepC_8h | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027708 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027710 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes) | Environmental | Open in IMG/M |
3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
3300027733 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027743 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027764 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes) | Environmental | Open in IMG/M |
3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027793 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
3300027899 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027956 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028103 | Freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepC_8d | Environmental | Open in IMG/M |
3300028394 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG (v2) | Environmental | Open in IMG/M |
3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034019 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Sep2014-rr0049 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034051 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13May2013-rr0097 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
3300034071 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Oct2008D10-rr0110 | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034092 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069 | Environmental | Open in IMG/M |
3300034101 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19Sep2005-rr0107 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034105 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME15May2014-rr0127 | Environmental | Open in IMG/M |
3300034110 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME01Jun2009D10-rr0171 | Environmental | Open in IMG/M |
3300034111 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Oct2011-rr0186 | Environmental | Open in IMG/M |
3300034116 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-CONTROL-GENDONOR | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034120 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2014-rr0172 | Environmental | Open in IMG/M |
3300034121 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME19May2015-rr0174 | Environmental | Open in IMG/M |
3300034122 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2014-rr0181 | Environmental | Open in IMG/M |
3300034166 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Sep2012-rr0079 | Environmental | Open in IMG/M |
3300034168 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME06Apr2016-rr0183 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
3300034523 | Fracking water microbial communities from deep shales in Oklahoma, United States - K-4-A | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
LV_Brine_h2_0102DRAFT_10065267 | 3300000405 | Hypersaline | MNLKNPVVLSLGAFLAAWSASNFNLDYRAILWSVLSGVFGYISPRKS* |
Draft_100111989 | 3300000558 | Hydrocarbon Resource Environments | MKNMKNPVYLAAGAFLAAWASSNFELDYRAVLWAVLSGVFGYATPKK* |
Draft_101573971 | 3300000558 | Hydrocarbon Resource Environments | MNIKNPYALTAGAFLAAWASSNFSLDHRAVLFAILSGVFGYAT |
Draft_1166988114 | 3300000558 | Hydrocarbon Resource Environments | MNIKNPYLLTAGAFIAAWAGSDFALDHRAILFAILSGVFGYATPKKK* |
JGI12421J11937_100092802 | 3300000756 | Freshwater And Sediment | MKNIKHPAYLAAGAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK* |
JGI12421J11937_100172535 | 3300000756 | Freshwater And Sediment | MNIKNPIFLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
JGI12421J11937_100211474 | 3300000756 | Freshwater And Sediment | MNIKNPVVLTLGAFLSAWAASNFDIDYRAILWAVLAGVFGYATPKK* |
JGI12421J11937_101159972 | 3300000756 | Freshwater And Sediment | MNMKNPYVLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
B570J14230_100463291 | 3300001282 | Freshwater | MNMKNPYVLTLGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
BBDRAFT_102676303 | 3300001371 | Marine Estuarine | MKNPAVLTAGAFLAAWGASNFALDYRAVLWAVLAGVFG |
Draft_1000465915 | 3300001605 | Hydrocarbon Resource Environments | MKNIKNPIYLAAGAFLAAWASSNFELDYRAVLWAVLSGVFGYASPKK* |
RCM33_10094074 | 3300001838 | Marine Plankton | MKNPYVLMLGAFLSAWAGSEFALDYRSILWAVLAGVFGYATPKKK* |
RCM47_10610324 | 3300001848 | Marine Plankton | MKITNKYVLALGGFLAAWAGSNFDLNYRSMLWAVLAGVFGYLPKREDNK* |
RCM26_11576111 | 3300001849 | Marine Plankton | MKHPVVLATGAFLAAWSASNFELDYRSILAALLAGVFGYATPKKK* |
RCM37_11099102 | 3300001850 | Marine Plankton | MNIKSPYVLTLGAFLSAWAGSNFEPDYRSILWAVLAGVFGYATPKKK* |
RCM37_11539063 | 3300001850 | Marine Plankton | MNMKSPYVLTAGAFLSAWAGTNFSPDYRSILWAVLAGVFGYATPKKK* |
RCM37_11697073 | 3300001850 | Marine Plankton | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
metazooDRAFT_12212862 | 3300002198 | Lake | MKIKHPVYLAAGAFLAAWASSNFEADYRAVLWAVLSGIFGYASPKK* |
metazooDRAFT_12467031 | 3300002199 | Lake | YVLALGAFLAAWSGSNFEPDYRAVLASLLAGVFGYVTPKKS* |
metazooDRAFT_12492761 | 3300002200 | Lake | MKHPVVLALGAFLAAWSISDFDLNYKSVLTAILAGVFGYATPKKKK* |
MLSBCLC_1005182010 | 3300002220 | Hydrocarbon Resource Environments | MNIKHPVYLAAGAFLAAWASSNFELDYRAVLWAVLSGVFGYASPKK* |
B570J29032_1087711681 | 3300002408 | Freshwater | MKIKNPLFLAAGAFLAAWSATNFDVDYRAILWSVLSGVFGYASPKR* |
B570J29032_1088627821 | 3300002408 | Freshwater | MKNIKNPVILAGGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
B570J29032_1097661744 | 3300002408 | Freshwater | MNLKNPAILAAGAFLAAWSATNFDADYRAILWSVLSGVFGYASPKR* |
B570J29032_1098443651 | 3300002408 | Freshwater | MKNMKNPVYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
LO132_102315902 | 3300002465 | Freshwater Lake | MNIKNPYFIAAGAFLAAWAASNFAADYRSILWAILAGVFGYATPKK* |
metazooDRAFT_14368782 | 3300002471 | Lake | MKHPVVLALGAFLAAWSISDFDLNYKSVLAAILAGVFGYTTPKKKK* |
metazooDRAFT_107518461 | 3300002476 | Lake | MKHPIVLAIGAFLAAWSGSNFDLDYRAILAAVLAGVFGYATPKKK* |
B570J40625_10001371817 | 3300002835 | Freshwater | MTNYLKHPIFMALGGFLAAWAGSNFELDYRAVLFAILAGVFGYAKPVK* |
B570J40625_1000257259 | 3300002835 | Freshwater | MNLKNPVVLATGAFLAAWSATNFDIDYRAILWSILSGIFGYATPKR* |
B570J40625_1001477435 | 3300002835 | Freshwater | MKHPLFLTAGAFLSAWAASNFALDYRAVLWAILAGVFGYATPKK* |
B570J40625_1001884254 | 3300002835 | Freshwater | MNMKNPLVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
B570J40625_1009286112 | 3300002835 | Freshwater | MKNPIVLAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKR* |
B570J40625_1012472151 | 3300002835 | Freshwater | TRGQVMNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
B570J40625_1013658672 | 3300002835 | Freshwater | MNMKNPYMLTAGAFLAAWAGSNFSLDYKAIMFAILSGVFGYATPKKK* |
contig_102803 | 3300002844 | Stormwater Retention Pond | MNMKNPYVLTAGAFLAAWANSNFAPDYRSVLMAVLAGVFGYATPRKKP* |
Water_1041605 | 3300002930 | Estuary Water | MNMKDPAVLTAGAFLAAWGASNFALDYRAVLWAVLAGVFGYATPKK* |
JGI25908J49247_100262354 | 3300003277 | Freshwater Lake | MNIKNPYILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
JGI25908J49247_100615821 | 3300003277 | Freshwater Lake | MNLKNPAILAAGAFLAAWSATNFNLDYRAVLWSVLSGVFGYATPKR* |
JGI25908J49247_100810914 | 3300003277 | Freshwater Lake | YLAAGAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK* |
JGI25909J50240_10451433 | 3300003393 | Freshwater Lake | MNMKNPAVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPTKR* |
JGI25907J50239_10675371 | 3300003394 | Freshwater Lake | KMKYIKHPVYLAAGAFLAAWGSSNFQIDYRAILFAVLSGVFGYATPKK* |
JGI25907J50239_10731912 | 3300003394 | Freshwater Lake | MNLKNPAILAAGAFLAAWSAXNXXLDYRAXXWSVXSGVFGYATPKR* |
JGI25917J50250_10028126 | 3300003395 | Freshwater Lake | MKNIKHPAYLAAGAFLAAWASTNFEADYRAILWAVLSGVFGYASPKK* |
JGI25911J50253_100308644 | 3300003411 | Freshwater Lake | MNLKNPAILAAGAFLAAWSATNFDXDYRAXXWSVXSGVFGYATPKR* |
JGI25912J50252_100494164 | 3300003412 | Freshwater Lake | MNLKNPAILAAGAFLAAWSASNFNLDYRAILWSVLSGVFGYASPKR* |
JGI25912J50252_100995021 | 3300003412 | Freshwater Lake | MNLKNPAILAAGAFLAAWSASNFNLDYRAILWSVLSGVFGYASPKK* |
JGI25922J50271_100539783 | 3300003413 | Freshwater Lake | MNMKNPLILTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
JGI25922J50271_100866801 | 3300003413 | Freshwater Lake | MNMKNPLILTAGAFLSAWAASNFDVDYRAILWAILAGVFGYATPKK* |
JGI25914J50564_100133211 | 3300003429 | Freshwater Lake | MNYKNPYLLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKK* |
JGI25914J50564_101667591 | 3300003429 | Freshwater Lake | MNYKNPAILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKK* |
JGI25921J50272_100515124 | 3300003430 | Freshwater Lake | YILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
JGI25913J50563_10493572 | 3300003431 | Freshwater Lake | MKNIKNPTYLAAGAFLAAWASSNFDLDYRAVLMAVLSGVFGYATPKK* |
JGI25926J51410_10829791 | 3300003490 | Freshwater Lake | MNYKNPAILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKR* |
JGI25925J51416_1000305912 | 3300003497 | Freshwater Lake | PRRTSQTRRIMNYKNPAILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKK* |
JGI25930J51415_10050138 | 3300003499 | Freshwater Lake | KNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0066179_101749691 | 3300004126 | Freshwater Lake | MNMKNPLVLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0007787_100965994 | 3300004240 | Freshwater Lake | MNMKSPYVLTAGAFLSAWAATNFAADYRSILWAVLAGVFGYATPKK* |
Ga0066599_1000474875 | 3300004282 | Freshwater | MKMKNPLFLAAGAFLAAWSATNFDVDYRAILWSILSGIFGYATPKR* |
Ga0066599_1002848252 | 3300004282 | Freshwater | MKNMKNPVVLAAGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK* |
Ga0066599_1008023681 | 3300004282 | Freshwater | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPVKR* |
Ga0066599_1016249122 | 3300004282 | Freshwater | LNLKNPAIMAAGAFLAAWSASNFDTDYRAILWAILAGVFGFATPKK* |
Ga0065861_11437362 | 3300004448 | Marine | MKNPYFLMSGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK* |
Ga0066222_10019081 | 3300004460 | Marine | YPNARWNCMNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0069718_149776212 | 3300004481 | Sediment | MNMKNPYILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0069718_151842342 | 3300004481 | Sediment | MNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKK* |
Ga0069718_155912821 | 3300004481 | Sediment | MKLKNPAFLAAGAFLAAWSATNFDVDYRAILWSVLSGIFGYATPKR* |
Ga0069718_156263542 | 3300004481 | Sediment | MKNMKNPVVLAGGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0069718_157372692 | 3300004481 | Sediment | MMKNMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0069718_158046262 | 3300004481 | Sediment | MNIKNPIFLTAGAFLSAWAASNFDIDYRAILWAVLAGVFGYATPKK* |
Ga0069718_1609074516 | 3300004481 | Sediment | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPTKR* |
Ga0068515_1158272 | 3300004829 | Marine Water | MNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYASPKR* |
Ga0068880_13866261 | 3300005416 | Freshwater Lake | VTDYMKHPIVLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPYKK* |
Ga0068884_10670302 | 3300005417 | Freshwater Lake | MKHPIFLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPYKK* |
Ga0068884_15758343 | 3300005417 | Freshwater Lake | LPDSLKHPIVLAVGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPYKK* |
Ga0068884_15778853 | 3300005417 | Freshwater Lake | MPDSLKHPIVLAAGAFLAAWAATNFELDYRAILWAVLSGLFGYAKPYKK* |
Ga0068882_17903791 | 3300005421 | Freshwater Lake | VTDYMKHPIVLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPY |
Ga0070374_100231849 | 3300005517 | Freshwater Lake | NYKNPYLLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0070374_102696804 | 3300005517 | Freshwater Lake | MKNIKHPAYLAAGAFLAAWASTNFAADYRAVLWAVLSGVFGYATPKK* |
Ga0068877_100711993 | 3300005525 | Freshwater Lake | MNLKNPAILAAGAFLAAWSATNFDLDYRAILWSVLSGVFGYATPKR* |
Ga0068877_102152181 | 3300005525 | Freshwater Lake | YMKHPAVLALGAFLSAWAATNFDLDYRAILWSVVAGVFGYAKPFKK* |
Ga0068877_103085103 | 3300005525 | Freshwater Lake | LPNELKHPIVLAAGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPFKK* |
Ga0068876_1000179913 | 3300005527 | Freshwater Lake | MNMKNPLVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0068876_100140317 | 3300005527 | Freshwater Lake | MNLKNPAILAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR* |
Ga0068876_100383214 | 3300005527 | Freshwater Lake | MKHPAVLALGAFLSAWAATNFDLDYRAILWSVVAGVFGYAKPFKK* |
Ga0068876_101623381 | 3300005527 | Freshwater Lake | MKLKNPLFLAAGAFLAAWSATNFDIDYRAILWSVLSGIFGYATPKR* |
Ga0068876_104118653 | 3300005527 | Freshwater Lake | MKLKNPAFLAAGAFLAAWSATNFDIDYRAILWSVLSGIFGYATPKR* |
Ga0068876_105742362 | 3300005527 | Freshwater Lake | MNMKNPLVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0068876_106250492 | 3300005527 | Freshwater Lake | MNLKNPAILAAGAFLAAWSATNFDLDYRAVLWSVLSGVFGYATPKR* |
Ga0068876_106983011 | 3300005527 | Freshwater Lake | CFFSSIYVRWRIMKNMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0068876_107892942 | 3300005527 | Freshwater Lake | MKNPVILAGGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0068872_105220942 | 3300005528 | Freshwater Lake | MKNMKNPVILAGGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0049081_1000192310 | 3300005581 | Freshwater Lentic | MNMKNPYVLTAGAFLSAWAATNFAADYRAILWAVLAGVFGYATPKK* |
Ga0049081_100235815 | 3300005581 | Freshwater Lentic | MKHPMFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0049081_101780262 | 3300005581 | Freshwater Lentic | MKHPLFLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0049081_102347962 | 3300005581 | Freshwater Lentic | MKHPLFLTAGAFLSAWAASNFALDYRAILWAILAGVFGYATPKK* |
Ga0049081_103348333 | 3300005581 | Freshwater Lentic | MNMKNPYVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0049080_101932611 | 3300005582 | Freshwater Lentic | MNMKNPYILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0078894_100086926 | 3300005662 | Freshwater Lake | MKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKR* |
Ga0078894_100688562 | 3300005662 | Freshwater Lake | MKNMKNPIVLAAGAFLAAWASSNFDLDYRAILWAVLSGVFGFATPKK* |
Ga0078894_104048801 | 3300005662 | Freshwater Lake | VLTAGAFLAAWAASNFSLDYRAVLLAILSGVFGYATPKK* |
Ga0078894_104079084 | 3300005662 | Freshwater Lake | MNMKNPYFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0078894_104425832 | 3300005662 | Freshwater Lake | MNMKNPYVLTAGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKK* |
Ga0078894_104450393 | 3300005662 | Freshwater Lake | MNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0078894_117228072 | 3300005662 | Freshwater Lake | MKNIKHPAYLAAGAFLAAWASTNFAADYRAILWAVLSGVFGYASPK |
Ga0078894_117938152 | 3300005662 | Freshwater Lake | MNMKNPYLLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0079957_100241012 | 3300005805 | Lake | MKNIKNPVYLAAGAFLAAWASSNFDLDYRAVLWAALSGIFGYATPKK* |
Ga0079957_100253512 | 3300005805 | Lake | MNMKNPYILTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKR* |
Ga0079957_100257813 | 3300005805 | Lake | MKHPIVLALGAFLAAWSGSNFDLDYRSILAAVLAGVFGYATPKKK* |
Ga0079957_10045422 | 3300005805 | Lake | MNMKNPYLLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0079957_100772912 | 3300005805 | Lake | MTNYLKHPIFMALGGFLAAWAGSNFELDYRAVLFAVLAGVFGYAKPVK* |
Ga0079957_10134789 | 3300005805 | Lake | MNMKSPYVLTAGAFLAAWAATNFAADYRSILWAVLAGVFGYATPKK* |
Ga0079957_10145209 | 3300005805 | Lake | MKHPLFLTAGAFLSAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0079957_10176877 | 3300005805 | Lake | MALGGFLAAWAGSNFELDYRAVLFAVLAGVFGYAKPVK* |
Ga0079957_10411854 | 3300005805 | Lake | MNMKNPIFLTAGAFLSAWAASNFEVDYRAILWAVLAGVFGYATPKK* |
Ga0079957_11292542 | 3300005805 | Lake | MNMKNPIVLATGAFLAAWASSNFALDYRAVLWAVLSGVFGYATPKK* |
Ga0079957_11935093 | 3300005805 | Lake | MKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0079957_11974171 | 3300005805 | Lake | MKHPAVLALGAFLSAWAATNFDLDYRAVLWSVVAGVFGYAKPFKK* |
Ga0079957_12680233 | 3300005805 | Lake | MNMKNPAVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0074469_112412754 | 3300005832 | Sediment (Intertidal) | MKTYMKNPIVLAAGAFLAAWASSNFDLDYRAILWAVLSGIFGYATPKK* |
Ga0068875_10126271 | 3300006018 | Freshwater Lake | MKHPIFLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAK |
Ga0075470_1000033313 | 3300006030 | Aqueous | MKIKNPNLLLVGAFLAAWANSEFALDYKSVLLAVLAGVFGYATPKK* |
Ga0075470_100017716 | 3300006030 | Aqueous | MNMKNPYLLTAGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKK* |
Ga0075470_100368261 | 3300006030 | Aqueous | MNMKNPLVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYAT |
Ga0075470_100717221 | 3300006030 | Aqueous | ILTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0075470_100818062 | 3300006030 | Aqueous | MALGGFLAAWAGSNFELDYRAVLFAILAGVFGYAKPVK* |
Ga0075470_100898654 | 3300006030 | Aqueous | MKNPYVLTVGAFLAAWAGSEFALDYRSILWAVVAGVFGYATPTKK* |
Ga0075465_100676694 | 3300006037 | Aqueous | PNDRRHSMNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0075465_100781413 | 3300006037 | Aqueous | MNMKNPYVLTVGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK* |
Ga0070744_100662244 | 3300006484 | Estuarine | MNMKNPLFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0070744_100926491 | 3300006484 | Estuarine | VRHTTNRRQDMNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK* |
Ga0070744_101281121 | 3300006484 | Estuarine | RIMNMKNPYVLTAGAFLSAWAATNFAADYRAILWAVLAGVFGYATPKR* |
Ga0070744_102419463 | 3300006484 | Estuarine | PLVLTAGAFLSAWAASNFDADYRAILWAVLAGVFGYATPKK* |
Ga0075461_102168193 | 3300006637 | Aqueous | MNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0075471_100207754 | 3300006641 | Aqueous | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0075471_104002482 | 3300006641 | Aqueous | MKNMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0070749_1000154611 | 3300006802 | Aqueous | MNLKNPYLLTLGAFLAAWGSSNFSPDYRSILWAVLAGVFGYATPKKK* |
Ga0070749_100390816 | 3300006802 | Aqueous | MTNYLKHPIFMALGGFLAAWAGSNFDLDYRAVLFAILAGVFGYAKPVK* |
Ga0070749_100478045 | 3300006802 | Aqueous | MKNIKNPAYLAAGAFLAAWASSNFDLDYRAVLMAVLSGVFGYATPKK* |
Ga0070749_100523405 | 3300006802 | Aqueous | MNIKNPLFLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0070749_100804442 | 3300006802 | Aqueous | MKNVKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
Ga0070749_100924034 | 3300006802 | Aqueous | MNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKR* |
Ga0070749_100987843 | 3300006802 | Aqueous | VDYLKHPVALAVGAFLSAWAGTNFDLDYRAVLWAVVAGLFGYAKPYRK* |
Ga0070749_101000504 | 3300006802 | Aqueous | MKKINHPIYLAAGAFLAAWSATNFEADYRAILWAVVSGVFGYASPKK* |
Ga0070749_101228412 | 3300006802 | Aqueous | LSNYLKHPIFMALGGFLAAWAGSNFDLDYRAILFAVLAGVFGYAKPVK* |
Ga0070749_102464584 | 3300006802 | Aqueous | MNMKNPYVLTAGAFLAAWASSNFSLDYRAVLLAVLSGVFGYATPKKK* |
Ga0070749_102544941 | 3300006802 | Aqueous | MNMKNPAVLTAGAFLSAWAASNFAADYRSVLWAVLA |
Ga0070749_102785973 | 3300006802 | Aqueous | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPTKR* |
Ga0070749_103425411 | 3300006802 | Aqueous | LTDYLKHPALMALGGFLAAWAGSNFDLDYRAVLFAVVAGVFGYAKPIK* |
Ga0070749_103509272 | 3300006802 | Aqueous | MNMKSHAVLTIGAFLSAWAGTNFQPDYRSVLWAVLAGVFGYATPKKK* |
Ga0070749_104118293 | 3300006802 | Aqueous | MNMKNPYFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0070749_104256494 | 3300006802 | Aqueous | LTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKK* |
Ga0070749_104487861 | 3300006802 | Aqueous | LSNYLKHPIFMALGGFLAAWAGSNFELDYRAVLFAILAGVFGYAKPVK* |
Ga0070749_105258001 | 3300006802 | Aqueous | MNMKNPYILTAGAFLSAWAASNFAADYRSILWAVL |
Ga0070749_106078373 | 3300006802 | Aqueous | AAGAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK* |
Ga0070749_106931183 | 3300006802 | Aqueous | MKHPAVLALGAFLAAWSGSNFDLDYRAVLAAVLAGVFGYATPKKK* |
Ga0070749_107300382 | 3300006802 | Aqueous | MKYKNPAILAVGAFLAAWSASNFNSDYRAILFAVLSGVFGYATPKK* |
Ga0070749_107846302 | 3300006802 | Aqueous | MNMKNPAILTAGAFLSAWAASNFDIDYRAILMAILAGCFGYATPKK* |
Ga0075467_104005141 | 3300006803 | Aqueous | MNMKNPAILTAGAFLAAWGASNFALDYHAVLWGVLAGVFGYATPKK* |
Ga0075467_105417622 | 3300006803 | Aqueous | MKIKNPLFLAGGAFLAAWSATNFDVDYRAILWSVLSGIFGYATPKR* |
Ga0075467_105487442 | 3300006803 | Aqueous | MKNIKHPAYLAAGAFLAAWASSNFDLDYRAILWAALSGIFGYASPKK* |
Ga0075464_100243294 | 3300006805 | Aqueous | MNMKNPVMLTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0075464_100520853 | 3300006805 | Aqueous | MKHPLFLMSGAFLAAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0075464_100614454 | 3300006805 | Aqueous | MNMKNPTILTAGAFLAAWGASNFSLDYRSVLWAVLAGVFGYATPKK* |
Ga0075464_101045224 | 3300006805 | Aqueous | MKHPLFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYAPPKK* |
Ga0075464_101079493 | 3300006805 | Aqueous | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK* |
Ga0075464_101211764 | 3300006805 | Aqueous | MKNPIFLMSGAFLSAWAASNFAADYRAVLWAILAGVFGYATPK |
Ga0075464_102304723 | 3300006805 | Aqueous | MNLKNPIILAAGAFLAAWSATNFDADYRAILWSVLSGVFGYASPKR* |
Ga0075464_102989502 | 3300006805 | Aqueous | MKIKHPVYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
Ga0075464_103053332 | 3300006805 | Aqueous | MKHPLFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0075464_103731692 | 3300006805 | Aqueous | MNMKNPYILTAGAFLSAWAASNFAADYRSILWALLAGVFGYATPKR* |
Ga0075464_103832892 | 3300006805 | Aqueous | MNMKNPVVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0075464_103854614 | 3300006805 | Aqueous | VVLTVGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKKR* |
Ga0075464_104152631 | 3300006805 | Aqueous | MNMKNPFVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0075464_104503731 | 3300006805 | Aqueous | LAGGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK* |
Ga0075464_105054892 | 3300006805 | Aqueous | MNLKNPIFLLAGAFLSAWAASNFAIDYRAVLWAILAGVFGYATPKK* |
Ga0075464_105061804 | 3300006805 | Aqueous | AGGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0075464_105146222 | 3300006805 | Aqueous | MNMKNPYFLTAGAFLAAWAASNFAADYRSVLWALLAGVFGYATPKK* |
Ga0075464_105455423 | 3300006805 | Aqueous | MKIKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
Ga0075464_105678744 | 3300006805 | Aqueous | MNMKNPFVLTAGAFLSAWAATNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0075464_105899382 | 3300006805 | Aqueous | MNMKNPYFLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0075464_106314052 | 3300006805 | Aqueous | MKNPAVLACGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK* |
Ga0075464_106519831 | 3300006805 | Aqueous | NPAVLTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKK* |
Ga0075464_106568552 | 3300006805 | Aqueous | MKNPIFLMSGAFLSAWAASNFAADYRAVLWAILAGVFGYATPKK* |
Ga0075464_107344682 | 3300006805 | Aqueous | MNMKNPYVLTLGAFLSAWAASNFDVDYRAILWALLAGVFGYATPKK* |
Ga0075464_107652083 | 3300006805 | Aqueous | MKIKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGIFGYASPKK* |
Ga0075464_108624552 | 3300006805 | Aqueous | MNIKNPYFLTAGAFLAAWAASNFAADYRSVLWALLAGVFGYATPKK* |
Ga0075464_110070293 | 3300006805 | Aqueous | YPDDRRHIMNMKNPAVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0075464_110193872 | 3300006805 | Aqueous | VLFDTYVRRKLMNMKNPYVLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0075464_110688383 | 3300006805 | Aqueous | RYTTTRGQVMNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0075464_110737701 | 3300006805 | Aqueous | PTILAAGAFLAAWSATNFDLDYRAILWSVLSGVFGYATPKR* |
Ga0075459_10111335 | 3300006863 | Aqueous | MKNPYVLTLGAFLAAWAGSEFALDYRSILWAVVAGVFGYATPTKK* |
Ga0075459_10306643 | 3300006863 | Aqueous | MKIKHPAYLAAGAFLAAWASTNFAADYRAILWAVLSGIFGYASPKK* |
Ga0075472_100882736 | 3300006917 | Aqueous | MKNPYVLTLGAFLAAWAGSEFALDYRSILWAVVAGVFGYA |
Ga0075472_101160984 | 3300006917 | Aqueous | MNMKNPYILTAGAFLSAWAASNFALDYRSVLWALLAGVFGYATPKK* |
Ga0075472_101691822 | 3300006917 | Aqueous | LKIKNPNLLLVGAFLAAWANSEFALDYKSVLLAVLAGVFGYATPKK* |
Ga0075472_102823942 | 3300006917 | Aqueous | MALGGLLAVWADTNFDLDYRAILFAVLAGVFGYAKPTK* |
Ga0075472_105105972 | 3300006917 | Aqueous | MNMKNPYILTAGAFLSAWAASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0070748_10673274 | 3300006920 | Aqueous | MKHPIFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYASPKK* |
Ga0070748_10689902 | 3300006920 | Aqueous | MKNPYFLMSGAFLSAWAASNFAADYRAVLWAILAGVFGYATPKK* |
Ga0070748_10873281 | 3300006920 | Aqueous | NPAYLAAGAFLAAWASSNFDLDYRAILWAALSGIFGYASPKK* |
Ga0070748_10963834 | 3300006920 | Aqueous | MNMKNPLVLTTGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0070748_10965681 | 3300006920 | Aqueous | HKEIYMNMKNPYVLTTGAFLAAWAGSSFAPDYRSILFAVLAGVFGYATPKK* |
Ga0070748_11211652 | 3300006920 | Aqueous | MNMKNPAVLTAGAFLSAWAASNFAADYRSVLWAVLAGVFGYATPKK* |
Ga0070748_11560993 | 3300006920 | Aqueous | MNMKNPYILTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKK* |
Ga0070748_11860382 | 3300006920 | Aqueous | MNMKNPAILTAGAFLAAWGASNFALDYRSIPWAVLAGVFGYATPKK* |
Ga0070748_12354431 | 3300006920 | Aqueous | MNMKNPYVLTAGAFLSAWAASNFAADYRSVLWAVLAGVFGYATPK |
Ga0070748_12482392 | 3300006920 | Aqueous | MKNPYVLTAGAFLSAWAATNFQADYRAILWAVLAGVFGYATPKK* |
Ga0070748_12942202 | 3300006920 | Aqueous | MKNPVVLAGGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0079302_10362024 | 3300007165 | Deep Subsurface | MKLKNPIFLAAGAFLAAWSATNFDIDYRAILWSVLSGIFGYATPKR* |
Ga0102976_10230766 | 3300007169 | Freshwater Lake | LKIKNPNIMLLGAFLAAWANSEFALDYKSVLLAVLAGVFGYATPKK* |
Ga0102977_11092471 | 3300007171 | Freshwater Lake | MKNPYVLLAGAFLAAWANSDFALDYRSILWAVLAGIFGYATPKKK* |
Ga0102977_11180501 | 3300007171 | Freshwater Lake | LSDYLKHPILLALGGFLAAWAGSNFELDYRAVLFAVLAGVFGYAKPVK* |
Ga0075468_101864012 | 3300007229 | Aqueous | MNMKNPYFLTAGAFLSAWAASNFAADYRSVLWAVLAGVFGYATPKR* |
Ga0075460_102570722 | 3300007234 | Aqueous | MNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVF |
Ga0070747_12785482 | 3300007276 | Aqueous | MNMKNPYFLTAGAFLAAWAASNFAADYRSVLWALLAGVFGYATPKR* |
Ga0070747_12794152 | 3300007276 | Aqueous | MNMKNPYVLTLGAFLSAWAASNFTADYRAVLWAVLAGVFGYATPKK* |
Ga0070747_12804831 | 3300007276 | Aqueous | VLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0070747_13116491 | 3300007276 | Aqueous | RIAMNMKNPYVLTAGAFLSAWAASNFAADYRSVLWAVLAGVFGYASPKR* |
Ga0102689_11271292 | 3300007304 | Freshwater Lake | MKHPIVLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPYKK* |
Ga0102689_11883601 | 3300007304 | Freshwater Lake | MKHPIFLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKP |
Ga0070745_10703614 | 3300007344 | Aqueous | MKNPYVLTVGAFLAAWAGSEFALDYRSILWAVVAGVFDYATPTKK* |
Ga0099851_10041995 | 3300007538 | Aqueous | MINDYIKHPALLALGGFLAAWAGSDFALDHRAVLWAVVAGIFGYAKPIK* |
Ga0099851_10907483 | 3300007538 | Aqueous | VKDYLKHPVALAVGAFLSAWAGTNFDLDYRAVLWAVVAGLFGYAKPYKK* |
Ga0099851_10983212 | 3300007538 | Aqueous | MTNIKHPIYLAAGAFLAAWSATNFEADYRAILWAVVSGVFGYASPKK* |
Ga0099851_11271753 | 3300007538 | Aqueous | MKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKK* |
Ga0099847_10602022 | 3300007540 | Aqueous | MINDYVKHPALLAVGGFLAAWAGSDFALDYRAVLWAVVAGIFGYAKPIK* |
Ga0099848_10018438 | 3300007541 | Aqueous | VDYLKHPIALAVGAFLSAWAGTNFDLDYRAVLWAVVAGLFGYAKPYKK* |
Ga0099848_11432923 | 3300007541 | Aqueous | VDYLKHPIALAVGAFLSAWAGTNFDLDYRAVLWAVVAGLFGYAK |
Ga0099848_11852811 | 3300007541 | Aqueous | MINDYIKHPALLAVGGFLAAWAGSDFELDYRAILWAVVAGIFGYAKRNGNPIK* |
Ga0099846_12736391 | 3300007542 | Aqueous | VKDYFKHPVALAVGAFLSAWAGTNFDLDYRAVLWAVVAGLFGYAKPYKK* |
Ga0102863_10493151 | 3300007622 | Estuarine | MNMKNPYVLTAGAFLSAWAATNFAADYRAILWAVLAGVFGY |
Ga0102856_10288244 | 3300007636 | Estuarine | NSMNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0102856_10507053 | 3300007636 | Estuarine | MNIKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKR* |
Ga0102859_10013934 | 3300007708 | Estuarine | MNIKNPYFLTAGAFLSAWAATNFAADYRSILWAVLAGVFGYATPKK* |
Ga0102859_10042534 | 3300007708 | Estuarine | MNMKNPTVLALGAFLAAWAATDFALDYRAVLWAVCSGVFGYASPKR* |
Ga0102859_10429754 | 3300007708 | Estuarine | MNMKNPILLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0104986_103214 | 3300007734 | Freshwater | MKMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0104986_107910 | 3300007734 | Freshwater | MNMKSPYVLTAGAFLSAWAATNFAADYRSVLWALLAGVFGYATPKR* |
Ga0104986_114011 | 3300007734 | Freshwater | MNMKSPYVLTAGAFLSAWAATNFAADYRSVLWALLAGVFGYATPKK* |
Ga0104986_115512 | 3300007734 | Freshwater | MKNPIVLAAGAFLAAWSASNFDIDYRAILFAVLSGVFGYATPKR* |
Ga0104986_137311 | 3300007734 | Freshwater | MNMKNPVVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0104986_153715 | 3300007734 | Freshwater | MKNIKNPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
Ga0104988_1046816 | 3300007735 | Freshwater | MNMKSPYVLTAGAFLSAWAATNFAADYRSVLWAVLAGVFGYATPKK* |
Ga0099850_10116892 | 3300007960 | Aqueous | MINDYVKHPALLAVGGFLAAWAGSDFELDYRAILWAVVAGIFGYAKRNGNPIK* |
Ga0099850_10576481 | 3300007960 | Aqueous | MINDYIEHPALLALGGFLAAWAGTDFEIDHRAILWAIVAGIFGYAKPIK* |
Ga0099850_14069922 | 3300007960 | Aqueous | MINDYIKHPALLAVGGFLAAWAGSDFELDYRAILWAVVAGIFGYAKRN |
Ga0105745_10569493 | 3300007972 | Estuary Water | MKSIKHPAYLAAGAFLAAWASTNFAADYRAVLWAVLSGVFGYATPKK* |
Ga0105745_12637531 | 3300007972 | Estuary Water | TAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0108970_111568561 | 3300008055 | Estuary | MNMKNPYVLTAGAFLSAWAATNFQADYRAILWAVLAGVFGYATPKK* |
Ga0108970_1117264513 | 3300008055 | Estuary | MKNMKNPAVLAGGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK* |
Ga0110929_102880612 | 3300008072 | Water Bodies | MNMKNPAILTAGAFLSAWAASNFSLDYRAVLWAVLAGVFGYATPKK* |
Ga0110929_10288073 | 3300008072 | Water Bodies | MNMKNPYVLTLGAFLAAWAGSNFEPNYRSVLMAVLAGVFGYA |
Ga0110929_10968022 | 3300008072 | Water Bodies | MKEYMKNPIVLAAGAFLAAWASSNFDLDYRAILWAVLSGVFGFATPKK* |
Ga0114340_10269706 | 3300008107 | Freshwater, Plankton | MNLKNPYALTAGAFLAAWASSNFSLDYKAILFAILSGVFGYATPTKK* |
Ga0114340_10650181 | 3300008107 | Freshwater, Plankton | MKDYMKNPIVLATGAFLAAWASSNFDLDYRAVLWAVLSGIFGYATPKK* |
Ga0114340_11333861 | 3300008107 | Freshwater, Plankton | MNMKNPLVLTAGAFLSAWAASNFDVDYRAILWAILAGVFGYATPKK* |
Ga0114340_11478503 | 3300008107 | Freshwater, Plankton | MNMKNPYILTAGAFLSAWAASNFAADYRSILWAILAGVF |
Ga0114341_103114323 | 3300008108 | Freshwater, Plankton | MKIKNPLFLAAGAFLAAWSATNFDVDYRAILWSVLSGIFGYATPKR* |
Ga0114341_104129481 | 3300008108 | Freshwater, Plankton | NPYVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0114343_10322412 | 3300008110 | Freshwater, Plankton | MNMKNPYILTAGAFLSAWAASNFAADYRSILWAVFAGVFGYATPKK* |
Ga0114343_10963451 | 3300008110 | Freshwater, Plankton | GAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0114344_100428410 | 3300008111 | Freshwater, Plankton | MNLKNPYALTAGAFLAAWAGTNFSLDYRAILFSVLSGVFGYATPKKK* |
Ga0114344_10113504 | 3300008111 | Freshwater, Plankton | MKNIKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKT* |
Ga0114346_10943025 | 3300008113 | Freshwater, Plankton | MNLKNPAILAAGAFLAAWSATNFDLDYRAVLWSVLSGVF |
Ga0114346_11257844 | 3300008113 | Freshwater, Plankton | MKNIKHPAYLAAGAFLAAWASSNFEADYRAVLWAVLSGVFGYASPKK* |
Ga0114346_12224711 | 3300008113 | Freshwater, Plankton | MNMKNPYVLTAGAFLSAWAATNFQADYRALLWAVLAGVFGYATPKK* |
Ga0114346_12894642 | 3300008113 | Freshwater, Plankton | MNMKNPYVLTAGAFLSAWAASNFAADYRSTLWAVLAGVFGYATPKR* |
Ga0114347_100239714 | 3300008114 | Freshwater, Plankton | MNLKNPYALTAGAFLAAWASSNFSLDYKAILFAVLSGVFGYATPTKK* |
Ga0114347_12098801 | 3300008114 | Freshwater, Plankton | MNLKNPAILAAGAFLAAWSATNFVADYRAILWSILSGVFGYASPKR* |
Ga0114350_10628401 | 3300008116 | Freshwater, Plankton | MNLKNPAILAAGAFLAAWSATNFDADYRAILWSILSGVF |
Ga0114350_10869312 | 3300008116 | Freshwater, Plankton | MKHPIVLAAGAFLAAWAATNFELDYRTVLWAVVSGVFGYAKPYKK* |
Ga0114350_11274982 | 3300008116 | Freshwater, Plankton | LPDSLKHPIVLAVGAFLSAWAATNFELDYRAILWAVLSGLFGYAKPYKK* |
Ga0114351_10960596 | 3300008117 | Freshwater, Plankton | MPDSLKHPIVLAVGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPYKR* |
Ga0114355_10437685 | 3300008120 | Freshwater, Plankton | MNLKNPAILAAGAFLAAWSATHFDLDYRAVLWSVLSGVFGYATPKR* |
Ga0114355_12154761 | 3300008120 | Freshwater, Plankton | MKHPAVLAVGAFLSAWAATNFDLDYRAVLWSVVAGVFGYAKPFKK* |
Ga0114841_11350911 | 3300008259 | Freshwater, Plankton | NMKNPLVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATP* |
Ga0114336_100533014 | 3300008261 | Freshwater, Plankton | MKNMKNPAVLAAGAFLAAWASSNFELDYRAVLWAVLSGVFGYATPKK* |
Ga0114336_10974801 | 3300008261 | Freshwater, Plankton | MNIKNPYVLTLGAFLAAWAGSDFSLDHRAVLFAILSGVFGYATPKKK* |
Ga0114349_10197589 | 3300008263 | Freshwater, Plankton | LAVGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPYKK* |
Ga0114363_100126813 | 3300008266 | Freshwater, Plankton | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPAKR* |
Ga0114363_100271016 | 3300008266 | Freshwater, Plankton | MKNIKHPAYLAAGAFLAAWASSNFDLDYRAVLWAALSGIFGYASPKK* |
Ga0114363_10217052 | 3300008266 | Freshwater, Plankton | MNMKNPLVLTAGAFLSAWAATNFEVDYRAILWAILAGVFGYATPKK* |
Ga0114363_10339786 | 3300008266 | Freshwater, Plankton | TYVRRRIMNLKNPIVLAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR* |
Ga0114363_10355382 | 3300008266 | Freshwater, Plankton | MKLKNPLFLAAGAFLAAWSATNFDIDYRAILWSLLSGIFGYATPKR* |
Ga0114363_10549002 | 3300008266 | Freshwater, Plankton | MNIKNPYALTAGAFLAAWASSNFSLDHRAILFAILSGVFGYATPKKK* |
Ga0114363_10581284 | 3300008266 | Freshwater, Plankton | MALGGFLAAWAGSNFDLDYRAILFAVLAGVFGYAKPVK* |
Ga0114363_10843314 | 3300008266 | Freshwater, Plankton | MNMKNPYILTAGAFLSAWAASNFAAGYRSILWAILAGVFGYATPKR* |
Ga0114363_10994703 | 3300008266 | Freshwater, Plankton | MNMKNPYILTAGAFLSAWAASNFAADYRSVLWAVLAGVFGYATPKR* |
Ga0114363_11126273 | 3300008266 | Freshwater, Plankton | MALGGFLAAWAGSNFDLDYRAILFAVLAGVFGYAKPTK* |
Ga0114363_11230872 | 3300008266 | Freshwater, Plankton | MALGGFLAAWAGSNFDLDYRAILFAVLAGVFGYAKPSK* |
Ga0114363_11758332 | 3300008266 | Freshwater, Plankton | MKNMKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGIFGYASPKK* |
Ga0114363_11882082 | 3300008266 | Freshwater, Plankton | MKHPVFLTAGAFLSAWAASNFALDYRAGLWDVLDGVFGYATPKK* |
Ga0114363_12077103 | 3300008266 | Freshwater, Plankton | MNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKR* |
Ga0114363_12149162 | 3300008266 | Freshwater, Plankton | LPDSLKHPIVLAVGAFLSAWAATNFDLDYRAILWAVVSGLFGYAKPYKK* |
Ga0114363_12326181 | 3300008266 | Freshwater, Plankton | VTRGKTMKNPYFLMSGAFLSAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0114364_10065564 | 3300008267 | Freshwater, Plankton | MKLKNPIFLATGAFLAAWSATNFDIDYRAILWSVLSGIFGYATPKR* |
Ga0114364_10093906 | 3300008267 | Freshwater, Plankton | MNLKNPAILAAGAFLAAWSATNFDLDYRAVLWSVLSGVFGYLPSRAKAK* |
Ga0114878_11443881 | 3300008339 | Freshwater Lake | PIFMALGGFLAAWAGSNFDLDYRAILFAVLAGVFGYAKPVK* |
Ga0114876_10175113 | 3300008448 | Freshwater Lake | MNNIKNPVYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
Ga0114876_10409262 | 3300008448 | Freshwater Lake | MNIKNPYVLTLGAFLAAWAGSDFSLDHRAILFAILSGVFGYATPKKK* |
Ga0114876_10527142 | 3300008448 | Freshwater Lake | MNLKNPAILAAGAFLAAWSATNFDLDYRAILWSILSGVFGYASPKR* |
Ga0114876_10737903 | 3300008448 | Freshwater Lake | MNLKNPAVLATGAFLAAWSASNFNLDYRAILWSVLSGVFGYASPKR* |
Ga0114876_10864884 | 3300008448 | Freshwater Lake | MKHPLFLTAGAFLSAWAASNFALDYRAVLWAILAGVFGY |
Ga0114876_12347353 | 3300008448 | Freshwater Lake | MKNPYFLMSGAFLSAWAASNFSLDYRAILWAILAGVFGYATPKK* |
Ga0114876_12385073 | 3300008448 | Freshwater Lake | MSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0114880_100151110 | 3300008450 | Freshwater Lake | MNMKNPIVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0114880_10074746 | 3300008450 | Freshwater Lake | MNMKNPYILTAGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKR* |
Ga0114880_10105566 | 3300008450 | Freshwater Lake | MKYKNPAVLAAGAFLAAWSSSNFNSDYRAILFAVLSGVFGYATPKR* |
Ga0114880_10329654 | 3300008450 | Freshwater Lake | MKNPYFLMSGAFLSAWAASNFALDYRAVLWAILAGVFGYATPKK* |
Ga0114880_10442832 | 3300008450 | Freshwater Lake | MKNIKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
Ga0114880_10976334 | 3300008450 | Freshwater Lake | HDRRRIMNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKK* |
Ga0114880_11163913 | 3300008450 | Freshwater Lake | MNMKNPLVLTVGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0114880_11330681 | 3300008450 | Freshwater Lake | MKHPVVLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPYKK* |
Ga0114880_11336411 | 3300008450 | Freshwater Lake | KNPLFLAAGAFLAAWSATNFDVDYRAILWSVLSGVFGYATPKR* |
Ga0114880_11472501 | 3300008450 | Freshwater Lake | STVTRRHSMNMKNPYLLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0114880_11559552 | 3300008450 | Freshwater Lake | MKHPMFLMSGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0114880_11639472 | 3300008450 | Freshwater Lake | MNIKNPYVLTIGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0114880_11818774 | 3300008450 | Freshwater Lake | MNMKNPLILTVGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0114880_12241361 | 3300008450 | Freshwater Lake | MPDSLKHPIVLAAGAFLAAWAATNFELDYRAILWAVLSGLFGYAKPYKR* |
Ga0114880_12299192 | 3300008450 | Freshwater Lake | YVRWRIMKNMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0114880_12409692 | 3300008450 | Freshwater Lake | MNMKNPYFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGY |
Ga0114880_12576902 | 3300008450 | Freshwater Lake | MNLKNPIVLAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR* |
Ga0114865_10106461 | 3300008459 | Freshwater Lake | KNPAILAAGAFLAAWSATNFDLDYRAVLWSVLSGVFGYATPKR* |
Ga0104242_10190263 | 3300008962 | Freshwater | MKHPIVLAVGAFLAAWSATNFTLDYRAILFAVLSGVFGYATPKR* |
Ga0114973_100059728 | 3300009068 | Freshwater Lake | MNMKNPYFLTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKK* |
Ga0114973_100102829 | 3300009068 | Freshwater Lake | MNMKNPYVLTIGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK* |
Ga0114973_100149283 | 3300009068 | Freshwater Lake | MNMKNPYILTAGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK* |
Ga0114973_100208213 | 3300009068 | Freshwater Lake | MNMKNPYLLTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKR* |
Ga0114973_100328035 | 3300009068 | Freshwater Lake | MKHPIFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0105090_101874994 | 3300009075 | Freshwater Sediment | MNLKNPAVLAAGAFLAAWSATNFDIDYRSILWSVLSGIFGYATPKR* |
Ga0105090_110162901 | 3300009075 | Freshwater Sediment | MNIKNPIFLTTGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0105098_100528702 | 3300009081 | Freshwater Sediment | LTEATNKYLKHPAVMALGGFLAAWASSNFDLDYRAVLFAVLAGVFGYAKPVK* |
Ga0105098_102064863 | 3300009081 | Freshwater Sediment | MKNMKHPIYLAAGAFLAAWSATNFDADYRAILWAVLAGVFGYASPKK* |
Ga0105098_103946483 | 3300009081 | Freshwater Sediment | MKLKNPLFLAAGAFLAAWSATNFDIDYRAILWSVLSGIFGY |
Ga0105098_105785743 | 3300009081 | Freshwater Sediment | KNPAILAAGAFLAAWASSNFDLDYRAVLMAVLSGVFGYATPKK* |
Ga0105099_101829134 | 3300009082 | Freshwater Sediment | MNLKNPIVLAAGAFLAAWSATNFDADYRAILWSILSGVFGYA |
Ga0105099_103497544 | 3300009082 | Freshwater Sediment | MNLKNPIILAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR* |
Ga0105103_102149424 | 3300009085 | Freshwater Sediment | MKHPLFLTAGAFLSAWAASNFALDYRSVLWAILAGVFGYATPKK* |
Ga0105103_103025511 | 3300009085 | Freshwater Sediment | TAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0105103_103188113 | 3300009085 | Freshwater Sediment | MKNPIVLAAGAFLAAWSATNFDIDYRAILFAILSGVFGYATPKR* |
Ga0105103_104373193 | 3300009085 | Freshwater Sediment | MKLKNPLFLAAGAFLAAWSATNFDIDYRAILWSVLSGIF |
Ga0105103_105521291 | 3300009085 | Freshwater Sediment | TAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0105103_109102783 | 3300009085 | Freshwater Sediment | MKIKNPLFLAAGAFLAAWSATNFDVDYRAILWSVLSGVFGY |
Ga0102851_121973482 | 3300009091 | Freshwater Wetlands | MMKYKNPAILAAGAFLAAWSSSNFNSDYRAILFAVLSGVFGYATPKK* |
Ga0115027_116626052 | 3300009131 | Wetland | MNLKNPYALTAGAFLAAWAGTNFSLDYRAILFSILSGVFGYATPKKK* |
Ga0105091_104244841 | 3300009146 | Freshwater Sediment | MALGGFLAAWASSNFDLDYRAVLFAVLAGVFGYAKPVK* |
Ga0105091_105323181 | 3300009146 | Freshwater Sediment | MNLKNPAVLAAGAFLAAWSATNFDLDYRAILWSVLSGIFGYATPKR* |
Ga0114962_1000576714 | 3300009151 | Freshwater Lake | MNMKNPYILTVGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK* |
Ga0114962_102319594 | 3300009151 | Freshwater Lake | MKMKNQYSLLAGAFLAAWGASNFAIDYRSILWAVLAGVFGYASPKK* |
Ga0114962_104313762 | 3300009151 | Freshwater Lake | MKNPLFLMSGAFLAAWAGSNFDVNYRAILMAVLAGVFGFATPKKP* |
Ga0114980_1000280512 | 3300009152 | Freshwater Lake | MNIKNPYVLTLGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0114980_100523995 | 3300009152 | Freshwater Lake | MKHPVFLMSGAFLAAWAASNFSLDYRAILWAILAGVFGYATPKK* |
Ga0114980_103532602 | 3300009152 | Freshwater Lake | MNIKNPYILTIGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114980_106695083 | 3300009152 | Freshwater Lake | MNIKNPYFLTAGAFLAAWAASNFAADYRSILWAILAGVFGYATPKR* |
Ga0114968_1000159420 | 3300009155 | Freshwater Lake | MNMKNPYMLTIGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK* |
Ga0114968_1000852412 | 3300009155 | Freshwater Lake | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAILAGVFGYATPKK* |
Ga0114968_1002260111 | 3300009155 | Freshwater Lake | MNIKNPLILTVGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0114968_1002534710 | 3300009155 | Freshwater Lake | MNMKNPLILTAGAFLSAWAASNFDADYRAILWAVLAGVFGYATPKK* |
Ga0114968_101228433 | 3300009155 | Freshwater Lake | MKMKNPYALAAGAFLAAWASTNFDIDYRAILWAVLSGVFGYASPKK* |
Ga0114968_101814201 | 3300009155 | Freshwater Lake | TIGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114968_102416103 | 3300009155 | Freshwater Lake | MNIKNPYFLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKR* |
Ga0114968_104240822 | 3300009155 | Freshwater Lake | MNMKNPYILTVGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK* |
Ga0114968_106353492 | 3300009155 | Freshwater Lake | MNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPK |
Ga0114977_1000495414 | 3300009158 | Freshwater Lake | MKHPVFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0114977_1000718912 | 3300009158 | Freshwater Lake | MNLKNPIFLLAGAFLSAWAASNFAIDYRAVLWAVLAGVFGYATPKK* |
Ga0114977_100286385 | 3300009158 | Freshwater Lake | MNMKNPYILTAGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKK* |
Ga0114977_101031823 | 3300009158 | Freshwater Lake | MNMKNPYVLTTGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK* |
Ga0114977_101400903 | 3300009158 | Freshwater Lake | MKNPMFLMSGAFLSAWAASNFSLDYRAILWAILAGVFGYATPKK* |
Ga0114977_101434254 | 3300009158 | Freshwater Lake | MNMKNPYVLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114977_102522183 | 3300009158 | Freshwater Lake | MNMKNPYILTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0114978_1000313913 | 3300009159 | Freshwater Lake | MKNPYFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0114978_100516851 | 3300009159 | Freshwater Lake | MNIKNPYVLTLGAFLSAWAASNFAADYRSILWAVLAGVFGY |
Ga0114978_102379164 | 3300009159 | Freshwater Lake | MKINNPYVLALGAFLAAWSATNFDIDYRAILLAIVSGIFGYATPKR* |
Ga0114978_108618851 | 3300009159 | Freshwater Lake | NPIVLTLGAFLAAWAGSNFDVDYRTILFAVLAGVFGYATPKK* |
Ga0114981_100186375 | 3300009160 | Freshwater Lake | MSGAFLAAWAASNFSLDYRAILWAILAGVFGYATPKK* |
Ga0114981_102009882 | 3300009160 | Freshwater Lake | MNLKNLIFLLAGAFLSAWAASNFAIDYRAVLWAILAGVFGYATPKK* |
Ga0114966_1000295010 | 3300009161 | Freshwater Lake | MNMKNPYILTAGAFLAAWAGSNFSLDYKAIMFAVLSGVFGYATPTKK* |
Ga0114966_101354824 | 3300009161 | Freshwater Lake | MKYKNPYILAAGAFLAAWSASNFNSDYRAILFAILSGLFGYATPKR* |
Ga0114966_105132903 | 3300009161 | Freshwater Lake | MNMKNPYVLTIGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114970_1001743511 | 3300009163 | Freshwater Lake | MKNIKNPAILAAGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK* |
Ga0114970_100238026 | 3300009163 | Freshwater Lake | MMKYKNPYILAAGAFLAAWSASNFNSDYRAILFAILSGLFGYATPKR* |
Ga0114970_100951136 | 3300009163 | Freshwater Lake | MSGAFLAAWAASNFSLDYRAVLWALLAGVFGYATPKK* |
Ga0114970_104413173 | 3300009163 | Freshwater Lake | MNMKNPYILTAGAFLSAWAASNFAADYRAVLWAVLAG |
Ga0114970_105814543 | 3300009163 | Freshwater Lake | RRQVMNIKNPYILTIGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114975_100453354 | 3300009164 | Freshwater Lake | MKDYMKNPIILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGFATPKK* |
Ga0114975_100854284 | 3300009164 | Freshwater Lake | MNMKNPYVLTIGAFLSAWAASNFAADYRAVLWAILAGVFGYATPKK* |
Ga0114975_102235954 | 3300009164 | Freshwater Lake | MNMKDPAILTAGAFLSAWAASNFDIDYRAILWAVLAGVFGYATPKK* |
Ga0114975_104495561 | 3300009164 | Freshwater Lake | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAVL |
Ga0105102_103338622 | 3300009165 | Freshwater Sediment | MNMKNPIFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0105102_106875072 | 3300009165 | Freshwater Sediment | MKHPLFLTAGAFLSAWAASNFALDYRSVLWAILAGVVGYATPKK* |
Ga0105104_103180483 | 3300009168 | Freshwater Sediment | MNIKNPIFLTAGAFLSAWAASNFEIDYRAILWAVLAGVFGYATPKK* |
Ga0105104_104725752 | 3300009168 | Freshwater Sediment | MNMKNPIFLTAGAFLSAWAASNFAADYRSILWSVLAGVFGYATPKK* |
Ga0105104_105482753 | 3300009168 | Freshwater Sediment | MKHPAVLAAGAVLSAWAATNFELDYRAVLWAVVAGVFGYAKPYKR* |
Ga0105104_105727973 | 3300009168 | Freshwater Sediment | MNIKNPYFLTAGAFLSAWAATNFAADYRAILWAVLAGVFGYATPKK* |
Ga0105097_100107166 | 3300009169 | Freshwater Sediment | MKHPVFLTAGAFLSAWAASNFALDYRAVLWAILAGVFGYATPKK* |
Ga0105097_100502924 | 3300009169 | Freshwater Sediment | MKNMKNPAILAAGAFLAAWASSNFDLDYRAVLMAVLSGVFGYATPKK* |
Ga0105097_100622606 | 3300009169 | Freshwater Sediment | MNMKNPIFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0105097_101467531 | 3300009169 | Freshwater Sediment | PIFLTVGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0105097_101764023 | 3300009169 | Freshwater Sediment | MKNPAVLTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKR* |
Ga0105097_103065021 | 3300009169 | Freshwater Sediment | HPALMALGGFLAAWASSNFDLDYRAVLFAVLAGVFGYAKPVK* |
Ga0105097_103654213 | 3300009169 | Freshwater Sediment | MNIKNPLFLTAGAFLSAWEDSNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0105097_104920081 | 3300009169 | Freshwater Sediment | TGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0105097_105735623 | 3300009169 | Freshwater Sediment | MNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAG |
Ga0105097_106663321 | 3300009169 | Freshwater Sediment | KNPAFLAAGAFLAAWSATNFDVDYRAILWSVLSGIFGYATPKR* |
Ga0105097_107563763 | 3300009169 | Freshwater Sediment | LTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0114979_103279901 | 3300009180 | Freshwater Lake | MKNPYILTAGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114979_105565312 | 3300009180 | Freshwater Lake | MNIKNPYFLTSGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0114969_100808302 | 3300009181 | Freshwater Lake | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAILAGVFGYATPRK* |
Ga0114969_101050086 | 3300009181 | Freshwater Lake | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAVLAG |
Ga0114969_101110201 | 3300009181 | Freshwater Lake | MNIKNPYFLTAGAFLAAWAASNFAADYRSILWAVLAGVFGY |
Ga0114969_106809583 | 3300009181 | Freshwater Lake | LTIGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK* |
Ga0114974_1000379815 | 3300009183 | Freshwater Lake | MNMKNPFILTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0114974_101637142 | 3300009183 | Freshwater Lake | MKNPYVLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114974_105583991 | 3300009183 | Freshwater Lake | MNMKNPYILTAGAFLSAWAASNFAADYRAVLWAVLAGVVGYASPKK* |
Ga0114974_105741733 | 3300009183 | Freshwater Lake | MKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114976_103131911 | 3300009184 | Freshwater Lake | VIFSNPYARRHSMNMKNPYVLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114976_104321071 | 3300009184 | Freshwater Lake | LTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0114976_105697431 | 3300009184 | Freshwater Lake | MKDYMKNPIILAAGAFLAAWASSNFDLDYRAILWAVLSGVFG |
Ga0114971_103526651 | 3300009185 | Freshwater Lake | MNMKSPSVLTAGASLSAWAASNFAADYRAVLWAVLAGVF |
Ga0114972_106397271 | 3300009187 | Freshwater Lake | MNMKNPLVLTAGAFLSAWAASNFALDYRAVLWAVLAGVF |
Ga0114983_10378151 | 3300009194 | Deep Subsurface | MNIKNPYVLTLGAFLAAWAGSEFSLDHKAILFAILSGVFGYATPKKK* |
Ga0114983_10594083 | 3300009194 | Deep Subsurface | MNIKNPLVLTLGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0114983_10670993 | 3300009194 | Deep Subsurface | MNMKNPAVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0114983_10980692 | 3300009194 | Deep Subsurface | MNLKNPIILAAGAFLAAWSATNFELDHKAILWSILSGVFGYASPKR* |
Ga0103848_10825671 | 3300009218 | River Water | MKITNKYVLALGGFLAAWAGSNFDLNYRSMLWAVLAGVFGYFAKRDENK* |
Ga0114982_10522621 | 3300009419 | Deep Subsurface | ITRGQNMNMKNPYILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0114982_11644422 | 3300009419 | Deep Subsurface | MKNIKHPVYLAAGAFLAAWASSNFDLDYRAVLWAALSGIFGYASPKK* |
Ga0114982_12942891 | 3300009419 | Deep Subsurface | MNMKNPYLLTAGAFLSAWAASNFAADYRSILWAVLAGVFA |
Ga0131968_1024352 | 3300009833 | Meromictic Pond | MNIKNPIILTLGAFLAAWAGSNFDLDYRTVLFAVVAGVFGYATPKK* |
Ga0132236_1024731 | 3300009915 | Meromictic Pond | MNIKNPIILTLGAFLAAWAGSNFDLDYRTVLFAVVAGVFGYATPKK |
Ga0114964_100486286 | 3300010157 | Freshwater Lake | MKNPYILTAGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKR* |
Ga0114967_100179554 | 3300010160 | Freshwater Lake | MNMKNPYVLTVGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK* |
Ga0114967_100614712 | 3300010160 | Freshwater Lake | MNIKNPYFLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0114967_104280063 | 3300010160 | Freshwater Lake | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAVLAGV |
Ga0114967_105731393 | 3300010160 | Freshwater Lake | KYKNPYILAAGAFLAAWSASNFNSDYRAILFAILSGLFGYATPKR* |
Ga0129333_101278765 | 3300010354 | Freshwater To Marine Saline Gradient | MKNIKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0129333_109044734 | 3300010354 | Freshwater To Marine Saline Gradient | LTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKK* |
Ga0129333_110122521 | 3300010354 | Freshwater To Marine Saline Gradient | MKNPYVLTVGAFLAAWAGSEFALDYRSILWAVVAGVFGYATPKKK* |
Ga0129333_110526612 | 3300010354 | Freshwater To Marine Saline Gradient | VNDYMKHPAVLALGAFLSAWAATNFDLDYRAVLWSVVSGVFGYAKPFKK* |
Ga0129333_114240312 | 3300010354 | Freshwater To Marine Saline Gradient | MKNPYVLLAGAFLAAWANSDFALDYRAILWAVLAGIFGYATPKKK* |
Ga0129324_102415994 | 3300010368 | Freshwater To Marine Saline Gradient | MKNPLFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK* |
Ga0114986_10503394 | 3300010374 | Deep Subsurface | RRQNMNMKNPYILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0114986_10723293 | 3300010374 | Deep Subsurface | MNLKNPIVLAAGAFLAAWSATNFDADYRAILWSVLSGVFGYASPKR* |
Ga0136551_100025316 | 3300010388 | Pond Fresh Water | MMAAGAFLAAWSASNFDTDYRAILWAILAGVFGFATPKK* |
Ga0136551_10264843 | 3300010388 | Pond Fresh Water | MNMKNPAVLAAGAFLAAWASTNFQADYRAILWAVLSGVFGYATPKK* |
Ga0136551_10577572 | 3300010388 | Pond Fresh Water | MKEHMKNPIVLATGAFLAAWASSNFDLDYRAVLWAVLSGIFGYATPKK* |
Ga0136551_10730552 | 3300010388 | Pond Fresh Water | MKDYMKHPVVLAAGAFLAAWASSNFDLDYRAVLWAVLSGVFGFATPKK* |
Ga0133913_109249396 | 3300010885 | Freshwater Lake | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPRK* |
Ga0133913_110034141 | 3300010885 | Freshwater Lake | MNIKNPYVLTLGAFLSAWAASNFAADYRSILWAVLAGV |
Ga0133913_111568391 | 3300010885 | Freshwater Lake | MNMKNPVILTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0133913_114094773 | 3300010885 | Freshwater Lake | MNMKNPYVLTTGVFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK* |
Ga0133913_117890494 | 3300010885 | Freshwater Lake | MNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFG |
Ga0133913_119789994 | 3300010885 | Freshwater Lake | MNMKNPYILTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0133913_132221214 | 3300010885 | Freshwater Lake | MNIKNPIVLTLGAFLAAWAGSNFDVDYRTILFAVLAGVFGYATPKK* |
Ga0133913_133940333 | 3300010885 | Freshwater Lake | MNMKNPYVLTIGAFLSAWAASNFAADYRAILWAVLAGVFG |
Ga0138308_1058032 | 3300010965 | Lake Chemocline | MNIKNPIFLTAGAFLAAWAGSNFDVDYRTILFAVLAGVFGYATPKK* |
Ga0137675_100003011 | 3300010966 | Pond Fresh Water | MNMKNPAILTLGAFLSAWAASNFEVDYRSILWAVLAGVFGYATPKK* |
Ga0137675_10081723 | 3300010966 | Pond Fresh Water | MNMKNPAFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0151517_142311 | 3300011113 | Freshwater | MKIKHPAYLAAGAFLAAWASSNFALDYRAVLWAVLSGVFGYASPKK* |
Ga0151517_145110 | 3300011113 | Freshwater | MKIKHPAYLAAGAFLAAWASSNFALDYRAVLWAVLSGVFGYATPKK* |
Ga0151515_1060217 | 3300011114 | Freshwater | MNMKNPFVLTAGAFLSAWAASNFDVDYRAILWALLAGVFGYATPKK* |
Ga0151516_1043235 | 3300011116 | Freshwater | MKNPIVLAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKK* |
Ga0151516_1063312 | 3300011116 | Freshwater | MNMKNPAILTAGAFLAAWGASDFALDYRSILWAVLAGVFGYASPKR* |
Ga0136709_10254281 | 3300011184 | Freshwater | MKNPIVLAAGAFLAAWSATNFTLDYRAILFAILSGVFGYATPKK* |
Ga0153697_127913 | 3300011334 | Freshwater | MKNMKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
Ga0153698_152511 | 3300011335 | Freshwater | MNMKNPYVLTAGAFLSAWAASNFAADYRSVLWAVLAGVFGYATPKR* |
Ga0153698_156614 | 3300011335 | Freshwater | MNMKNPAILTGGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPRKK* |
Ga0153698_157411 | 3300011335 | Freshwater | MNMKNPYALTAGAFLAAWAGSNFSLDHKAILFAVLSGVFGYATPKKK* |
Ga0153698_17099 | 3300011335 | Freshwater | MNMKNPYVLTVGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR* |
Ga0153698_173716 | 3300011335 | Freshwater | MMKNMKNPVILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK* |
Ga0153698_18349 | 3300011335 | Freshwater | MKNMKNPAVLAAGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK* |
Ga0153703_145415 | 3300011336 | Freshwater | MKNMKNPVVLAGGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK* |
Ga0153703_161715 | 3300011336 | Freshwater | MKIKHPVYLAAGAFLAAWASSNFEADYRAILWAVLSGIFGYASPKK* |
Ga0153702_156115 | 3300011337 | Freshwater | MKIKHPAYLAGGAFLAAWASSNFEADYRAILWAVLSGIFGYASPKK* |
Ga0153699_195412 | 3300011338 | Freshwater | MNMKNPYVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPRR* |
Ga0153700_1073618 | 3300011339 | Freshwater | MKNPIVLALGAFLAAWAGSDFALDYRAVLWAVCSGVFGYASPKR* |
Ga0153700_1076812 | 3300011339 | Freshwater | MKNMKHPAYLAAGAFLAAWASSNFALDYRAVLWAVLSGVFGYATPKK* |
Ga0153700_1098016 | 3300011339 | Freshwater | MNMKNPAIRTAGAFLAAWGASNFALDYRSILWAVLAGVFGYASPKR* |
Ga0102688_15424781 | 3300011381 | Freshwater Lake | GETLPDSLKHPIVLAVGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPYKK* |
Ga0119931_10270221 | 3300011984 | Drinking Water Treatment Plant | MPDSLKHPIVLAVGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPYKK* |
Ga0153799_10074746 | 3300012012 | Freshwater | MNLKNPAILAAGAFLAAWSASNFNLDYRAILWSVLSGVFGYATPKR* |
Ga0153805_10726362 | 3300012013 | Surface Ice | MKNIKHPAYLAAGAFLAAWASTNFAADYRAILWAVLSGVF |
Ga0153801_10021593 | 3300012017 | Freshwater | LITVTDYMKHPIFLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPYKK* |
Ga0136712_10443052 | 3300012266 | Freshwater | MNMKNPTILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0157203_10019852 | 3300012663 | Freshwater | MNMKSPVVLTLGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0157203_10464091 | 3300012663 | Freshwater | MNMKNPAVLAVGAFLAAWASSNFDVDYRAILWAVLSGVFGYASPKK* |
Ga0157210_100052015 | 3300012665 | Freshwater | MNMKNPYMLTAGAFLAAWAGSNFSLDYKAIMFAILSGVFGYATPTKK* |
Ga0157210_10037534 | 3300012665 | Freshwater | MKNIKHPAYLAAGAFLAAWASSNFEADYRAILWAILSGIFGYASPKK* |
Ga0157210_10062956 | 3300012665 | Freshwater | MNMKDPAILTTGAFLSAWAASNFSLDYRAVLWAVLAGVFGYATPKK* |
Ga0157498_10014084 | 3300012666 | Freshwater, Surface Ice | MKHPIFLAAGAFLAAWAATNFELDYRAILWAVVSGVFGYAKPYKK* |
Ga0157208_100014362 | 3300012667 | Freshwater | MNMKNPAVLTLGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0153916_110048852 | 3300012964 | Freshwater Wetlands | MKEHMKNPIVLAAGAFLAAWASSNFDLDYRAILWAVLSGVFGFATPKK* |
Ga0159060_10119305 | 3300012990 | Hydrocarbon Resource Environments | MNIKNPYALTAGAFLAAWASSNFSLDHRAVLFAILSGVFGYATPKKK* |
Ga0159060_10258381 | 3300012990 | Hydrocarbon Resource Environments | LTMNMKNPIFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK* |
Ga0164293_100628925 | 3300013004 | Freshwater | MKNMKNPAILAAGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK* |
Ga0164293_102511574 | 3300013004 | Freshwater | YPDDRRHSMNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKR* |
Ga0164293_106999892 | 3300013004 | Freshwater | MKNIKNPVYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK* |
Ga0164293_107021443 | 3300013004 | Freshwater | HSMNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0164292_102693814 | 3300013005 | Freshwater | LILTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0164292_103437631 | 3300013005 | Freshwater | NPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK* |
Ga0164292_104369873 | 3300013005 | Freshwater | MKIKNPLFLAAGAFLAAWSATNFDVDYRAILWSVLSGVFGYATPKR* |
Ga0164294_100268093 | 3300013006 | Freshwater | MKNPIVLAAGAFLAAWSATNFQIDYRAILFAILSGVFGYATPKR* |
Ga0164294_100300274 | 3300013006 | Freshwater | MNIKNPAILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKR* |
Ga0164294_102900173 | 3300013006 | Freshwater | YILTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK* |
Ga0129327_100982003 | 3300013010 | Freshwater To Marine Saline Gradient | MINEYIKHPALLAVGGFLAAWAGSDFELDYRAILWAVVAGIFGYAKRNGNPIK* |
(restricted) Ga0172374_10269302 | 3300013122 | Freshwater | MKHPIFLAAGAFLAAWAATNFDLDYRAILWAVVSGVFGYAKPYKK* |
Ga0170791_124439753 | 3300013295 | Freshwater | AFLSAWAASNFAADYRSILWALLAGVFGYATPKK* |
Ga0119952_10955871 | 3300014050 | Freshwater | LVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK* |
Ga0134314_1016994 | 3300014711 | Surface Water | MNMKNPAVLTIGAFLSAWAASNFAADYRSILWAVLAGVFGYATPTKR* |
Ga0134314_1044483 | 3300014711 | Surface Water | MMNMKNPAILAAGAFLAAWASTNFEADYRAILWAVLSGVFGYASPKK* |
Ga0134314_1049593 | 3300014711 | Surface Water | MNMKNPYFLTAGAFLAAWAGSDFAPDYRSILLAILAGVFGYATPKK* |
Ga0134314_1098453 | 3300014711 | Surface Water | LKIKNPNVMLLGAFLAAWANSEFALDYKSVLLAVLAGVFGYATPKK* |
Ga0134314_1132622 | 3300014711 | Surface Water | MNMKNPYILTAGAFLAAWAGSDFEPNYRSVLMAVLAGVFGYATPKKK* |
(restricted) Ga0172376_100432885 | 3300014720 | Freshwater | MKHPIFLAAGAFLAAWAATNFDLDYRAILWTVVSGVFGYAKPYKK* |
Ga0119960_10818582 | 3300014811 | Aquatic | MNMKNPVVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPTKR* |
Ga0134316_10161431 | 3300014960 | Surface Water | MNMKNPYILTLGAFLAAWAGSDFEPNYRSVLMAVLAGVFGYATPKKK |
Ga0134315_100027815 | 3300014962 | Surface Water | MNMKNPYILTLGAFLAAWAGSDFEPNYRSVLMAVLAGVFGYATPKKK* |
Ga0134315_100031416 | 3300014962 | Surface Water | MNMKNPYILTLGAFLAAWAGSDFEPNYRSVLMAVLAGVFGYATPKK |
Ga0134315_10137732 | 3300014962 | Surface Water | MNMKNPAVTTVGAFLAAWASSDFALDYRSVLLAVLAGVFGYTTPKKK* |
Ga0181350_10727963 | 3300017716 | Freshwater Lake | YVRRKLMKNIKHPAYLAAGAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK |
Ga0181350_11283682 | 3300017716 | Freshwater Lake | MNLKNPAILAAGAFLAAWSATNFDLDYRAILWSVLLGVFGYATPKR |
Ga0181347_10407231 | 3300017722 | Freshwater Lake | KMKYIKHPVYLAAGAFLAAWGSSNFQMDYRAILFAVLSGVFGYATPKK |
Ga0181362_10542474 | 3300017723 | Freshwater Lake | TYVRRKLMKNIKHPAYLAAGAFLAAWASTNFAADYRAVLWAVLSGVFGYATPKK |
Ga0181344_10076484 | 3300017754 | Freshwater Lake | MKNPYVLTAGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKK |
Ga0181344_12330893 | 3300017754 | Freshwater Lake | YTTTRGQVMNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0181343_10345005 | 3300017766 | Freshwater Lake | MKNMKNPIVLAAGAFLAAWASSNFDLDYRAILWAVLSGVFGFATPKK |
Ga0181358_10248288 | 3300017774 | Freshwater Lake | RRTMNLKNPAILAAGAFLAAWSATNFNLDYRAVLWSVLSGVFGYATPKR |
Ga0181357_10823582 | 3300017777 | Freshwater Lake | MNLKNPAILAAGAFLAAWSATNFNLDYRAVLWSVLSGVFGYATPKR |
Ga0181346_10862931 | 3300017780 | Freshwater Lake | MSHIKHPLLLAAGAFLAAWGSSNFEIDYRAILWALVSGVFGYASPKK |
Ga0181348_101343111 | 3300017784 | Freshwater Lake | AGAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK |
Ga0181348_12767683 | 3300017784 | Freshwater Lake | AMKHPMFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK |
Ga0181348_13013212 | 3300017784 | Freshwater Lake | MKYIKHPVYLAAGAFLAAWGSSNFQMDYRAILFAVLSGVFGYATPKK |
Ga0181355_11769353 | 3300017785 | Freshwater Lake | HPAYLAAGAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK |
Ga0180437_102077313 | 3300017963 | Hypersaline Lake Sediment | MALGGFLAAWASSNFDLDYRAVLFAVVAGVFGYAKPIK |
Ga0180438_103464644 | 3300017971 | Hypersaline Lake Sediment | LTDYLKHPAFMALGGFLAAWASSNFDLDYRAVLFAVVAGVFGYAKPIK |
Ga0181563_101767824 | 3300018420 | Salt Marsh | MNMKNPLVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0181563_103925444 | 3300018420 | Salt Marsh | MKNPYFLTAGAFLAAWAASNFAADYRSVLWALLAGVFGYATPKK |
Ga0187845_10602703 | 3300018815 | Freshwater | MNIKNPYVLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0181359_100019820 | 3300019784 | Freshwater Lake | MNYKNPAILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKK |
Ga0181359_10015207 | 3300019784 | Freshwater Lake | MKNIKHPAYLAAGAFLAAWASTNFEADYRAILWAVLSGVFGYASPKK |
Ga0181359_10019504 | 3300019784 | Freshwater Lake | MKYIKHPVYLAAGAFLAAWGSSNFQIDYRAILFAVLSGVFGYATPKK |
Ga0181359_10082004 | 3300019784 | Freshwater Lake | MNMKNPYLLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0181359_10106092 | 3300019784 | Freshwater Lake | MNMKNPAVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPTKR |
Ga0181359_10297863 | 3300019784 | Freshwater Lake | MNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0181359_10521123 | 3300019784 | Freshwater Lake | MNMKNPLVLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0181359_10695502 | 3300019784 | Freshwater Lake | MKNIKHPAYLAAGAFLAAWASTNFAADYRAVLWAVLSGVFGYATPKK |
Ga0181359_11704822 | 3300019784 | Freshwater Lake | MNYKNPAILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKR |
Ga0181359_12192992 | 3300019784 | Freshwater Lake | MNLKNPAILAAGAFLAAWSASNFNLDYRAVLWSVLSGVFGYATPKR |
Ga0181359_12719051 | 3300019784 | Freshwater Lake | MNYKNPYLLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0211734_112086313 | 3300020159 | Freshwater | MNLKNPLILTAGAFLSAWAASNFDLDYRAILWAVLAGVFGYATPKK |
Ga0211726_102894422 | 3300020161 | Freshwater | MKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0211735_114089943 | 3300020162 | Freshwater | MNMKNPAILTAGAFLAAWGASNFALDYRSVLWAILAGVFGYATPKR |
Ga0194115_102872402 | 3300020183 | Freshwater Lake | LSDYLKHPIFLAVGGFLAAWAGSNFDLDYRAVLFAVLAGVFGYAKPVK |
Ga0211731_108978899 | 3300020205 | Freshwater | MNIKNPIVLTLGAFLAAWAGSNFDVDYRTILFAVLAGVFGYATPKK |
Ga0211731_113510772 | 3300020205 | Freshwater | MNMKSPYVLTAGAFLSAWAATNFAADYRAVLWAVLAGVFGYATPKK |
Ga0208050_10163691 | 3300020498 | Freshwater | MNMKSPYVLTAGAFLAAWAATNFAADYRSILWAVLAGVFGYATPKK |
Ga0208088_10011443 | 3300020505 | Freshwater | MNMKNPYILTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0207935_10099832 | 3300020516 | Freshwater | PIFMALGGFLAAWAGSNFELDYRAVLFAILAGVFGYAKPVK |
Ga0208235_10280972 | 3300020530 | Freshwater | MNLKNPIVLAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR |
Ga0208364_10010148 | 3300020533 | Freshwater | MNLKNPVVLATGAFLAAWSATNFDIDYRAILWSILSGIFGYATPKR |
Ga0208857_10290984 | 3300020542 | Freshwater | MNMKNPLVLTAGAFLSAWAASNFAADYRSILWAVL |
Ga0207942_10283411 | 3300020549 | Freshwater | LFLTAGAFLSAWAASNFALDYRAVLWAILAGVFGYATPKK |
Ga0207942_10322574 | 3300020549 | Freshwater | AILAAGAFLAAWSATNFDADYRAILWSVLSGVFGYASPKR |
Ga0207942_10414611 | 3300020549 | Freshwater | MNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVL |
Ga0208360_10037177 | 3300020551 | Freshwater | ILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK |
Ga0208855_10132082 | 3300020553 | Freshwater | MKNIKNPVILAGGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0208599_10641371 | 3300020554 | Freshwater | GAFLAAWSATNFDADYRAILWSILSGVFGYASPKR |
Ga0208465_10002409 | 3300020570 | Freshwater | MTNYLKHPIFMALGGFLAAWAGSNFELDYRAVLFAILAGVFGYAKPVK |
Ga0194133_101554352 | 3300021091 | Freshwater Lake | LSNYVKHPIFLALGGFLAAWAGSNFDLDYRAVLFAVLAGVFGYAKPVK |
Ga0214162_10629481 | 3300021108 | Freshwater | MKNPYFLMSGAFLSAWAASNFSLDYRAVLWAILAGVFGYATPK |
Ga0213920_10015386 | 3300021438 | Freshwater | MNMKNPYALTAGAFLAAWAGSNFSLDHKAILFAILSGVFGYATPKKK |
Ga0213920_100232214 | 3300021438 | Freshwater | MNMKNPIILTAGAFLSAWAASNFALDYRAVLWAILAGVFGYATPKK |
Ga0213920_10041122 | 3300021438 | Freshwater | MKNPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK |
Ga0213920_100496710 | 3300021438 | Freshwater | MKNPAYLAAGAFLAAWASSNFEADYRAVLWAVLSGVFGYASPKK |
Ga0213920_10086094 | 3300021438 | Freshwater | MNMKNPAILTAGAFLSAWAASNFDIDYRAILMAILAGCFGYATPKK |
Ga0213920_10233782 | 3300021438 | Freshwater | MNMKNPIVLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0213920_10575551 | 3300021438 | Freshwater | RRIMKNMKNPAYLAAGAFLAAWASSNFEADYRAVLWAVLSGVFGYASPKK |
Ga0194048_100016181 | 3300021519 | Anoxic Zone Freshwater | MKYKNPYILAAGAFLAAWSSSNFNSDYRAILFAVLSGVFGYATPIK |
Ga0194048_100267904 | 3300021519 | Anoxic Zone Freshwater | MNIKNPYFLTAGAFLAAWAASNFAADYRSVLWALLAGVFGYATPKK |
Ga0194048_100392133 | 3300021519 | Anoxic Zone Freshwater | MNIKNPYVLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0194048_100544522 | 3300021519 | Anoxic Zone Freshwater | MNLKNPIFLLAGAFLSAWAASNFAIDYRAVLWAILAGVFGYATPKK |
Ga0194048_100633194 | 3300021519 | Anoxic Zone Freshwater | MNIKNPYVLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKR |
Ga0194060_101038515 | 3300021602 | Anoxic Zone Freshwater | IMNIKNPYFLTAGAFLAAWAASNFAADYRSVLWALLAGVFGYATPKK |
Ga0194060_101665221 | 3300021602 | Anoxic Zone Freshwater | MNIKNPYVLTAGAFLAAWAASNFAADYRSILWALLAGVFG |
Ga0194060_103840261 | 3300021602 | Anoxic Zone Freshwater | MNIKNPYVLTAGAFLAAWAASNFAADYRSILWALLAGVFGYA |
Ga0213921_100032811 | 3300021952 | Freshwater | MNMKNPAILTAGAFLSAWAASNFDIDYRAVLWAVLAGVFGYATPKK |
Ga0213921_100066212 | 3300021952 | Freshwater | MNMKNPAVLTAGAFLSAWAASNFDMDYRAILWAVLAGVFGYATPKK |
Ga0213921_100082813 | 3300021952 | Freshwater | MKNPAVLATGAFLAAWASSNFDLDYRAVLWAVLSGVFGYASPKK |
Ga0213921_10072896 | 3300021952 | Freshwater | MNMKNPIILTAGAFLSAWAASNFDIDYRAVLWAVLAGVFGYATPKK |
Ga0213921_10287273 | 3300021952 | Freshwater | MNMKNPAVLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0213921_10480582 | 3300021952 | Freshwater | MNMKDPAILTAGAFLSAWAASNFDMDYRAVLWAVLAGVFGYATPKK |
Ga0213922_10417381 | 3300021956 | Freshwater | MNMKNPAVLTAGAFLSAWAASNFAADYRSILWAVLAGV |
Ga0213922_10517792 | 3300021956 | Freshwater | MNMKNPVVLTAGAFLSAWAASNFAADYRSVLWAVLAGVFGYATPKK |
Ga0213922_10613024 | 3300021956 | Freshwater | MKNPYVLTTGAFLAAWAGSSFAPDYRSILFAVLAGVFGYATPKK |
Ga0213922_11072161 | 3300021956 | Freshwater | RRHNMNMKNPIILTAGAFLSAWAASNFDIDYRAVLWAVLAGVFGYATPKK |
Ga0213922_11150101 | 3300021956 | Freshwater | YFLTAGAFLAAWAGSNFALDHKAILFAILSGVFGYATPKKK |
Ga0213922_11208791 | 3300021956 | Freshwater | RRQTMNMKNPAILTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0213922_11228502 | 3300021956 | Freshwater | MKNMKNPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK |
Ga0222715_102106752 | 3300021960 | Estuarine Water | MTNYLKHPILLALGGFLAAWAGSNFDLDYRAVLFAVLAGVFGYAKPVK |
Ga0222714_100201956 | 3300021961 | Estuarine Water | MNMKNPYVLTAGAFLSAWAASNFALDYRSVLWAVLAGVFGYATPKR |
Ga0222714_100796503 | 3300021961 | Estuarine Water | MTNYLKHPIFMALGGFLAAWAGSNFELDYRAVLFAVLAGVFGYAKPVK |
Ga0222714_101161744 | 3300021961 | Estuarine Water | MKIKHPAYLAAGAFLAAWASSNFEADYRAVLWAVLSGIFGYASPKK |
Ga0222713_1001124710 | 3300021962 | Estuarine Water | MSNYLKHPILLALGGFLAAWAGSNFDLDYRAVLFAVLAGVFGYAKPVK |
Ga0222713_101713534 | 3300021962 | Estuarine Water | MKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKR |
Ga0222713_103543574 | 3300021962 | Estuarine Water | KNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0222713_106817211 | 3300021962 | Estuarine Water | MNMKSPYVLTAGAFLSAWAATNFAADYRSILWALLAGVF |
Ga0222712_1000330310 | 3300021963 | Estuarine Water | MKNPLVLAAGAFLAAWSATNFEIDYRAILFAVLSGVFGYATPKR |
Ga0222712_100882645 | 3300021963 | Estuarine Water | VKIKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGIFGYASPKK |
Ga0222712_101616614 | 3300021963 | Estuarine Water | MNMKNPYLLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0222712_102181172 | 3300021963 | Estuarine Water | MNLKNPYVLTAGAFLAAWASSNFSPDYRSVLWAVLAGVFGYATPKKS |
Ga0222712_103376381 | 3300021963 | Estuarine Water | MNMKSPYVLTAGAFLSAWAATNFAADYRSILWALLAGVFGYATPKK |
Ga0212031_10205451 | 3300022176 | Aqueous | MINDYIKHPALLALGGFLAAWAGSDFALDHRAVLWAVVAGIFGYAKPIK |
Ga0181353_10048685 | 3300022179 | Freshwater Lake | MNMKNPLILTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0181353_11605001 | 3300022179 | Freshwater Lake | MNMKSPYVLTAGAFLSAWAATNFAADYRSILWAVLAGVFGYATPKK |
Ga0181354_11480111 | 3300022190 | Freshwater Lake | QTRRIMNYKNPYLLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0181354_12199251 | 3300022190 | Freshwater Lake | MKYKNPAVLAAGAFLAAWSSSNFNSDYRAILFAVLSGVFGYATPTK |
Ga0181354_12298352 | 3300022190 | Freshwater Lake | MKAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK |
Ga0196901_10071851 | 3300022200 | Aqueous | MALGGFLAAWAGSNFDLDYRAVLFAVVAGVFGYAKPIK |
Ga0181351_10890594 | 3300022407 | Freshwater Lake | GTRRLTMNMKNPYLLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0212119_10070181 | 3300022543 | Freshwater | FFSSIYVRWRIMKNMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0228701_10052204 | 3300022746 | Freshwater | MKNIKNPVYLAAGAFLAAWASSNFEADYRAVLWAVLSGVFGYASPKK |
Ga0228701_11039751 | 3300022746 | Freshwater | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0228703_100262114 | 3300022747 | Freshwater | MKNPLVLTAGAFLSAWAASNFDVDYRAILWAILAGVFGYATPKK |
Ga0228703_10127518 | 3300022747 | Freshwater | MNMKNPYVLTAGAFLAAWANSNFAPDYRSVLMAVLAGVFGYATPKKKP |
Ga0228702_10625711 | 3300022748 | Freshwater | MNMKNPYVLTAGAFLAAWANSNFAPDYRSVLMAVLAGVFGYATPRKK |
Ga0214917_1000426320 | 3300022752 | Freshwater | MKHPIVLAVGAFLAAWSATNFTLDYRAILFAVLSGVFGYATPKR |
Ga0214917_100818191 | 3300022752 | Freshwater | QVMNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0214917_101305271 | 3300022752 | Freshwater | VRYTTTRGQVMNMKNPYVLTLGAFLSAWAASNFAADYRSILWGLLAGVFGYATPKK |
Ga0214917_102854132 | 3300022752 | Freshwater | MNIKNPYVLTLGAFLSAWAASNFDVDYRAILWAILAGVFGYATPKK |
Ga0214917_103193071 | 3300022752 | Freshwater | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAVLAGVFGY |
Ga0214917_103625813 | 3300022752 | Freshwater | GAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0214921_1000697218 | 3300023174 | Freshwater | MKNPLVLAAGAFLAAWSATNFDLDYRAILFAILSGVFGYATPKK |
Ga0214921_1000711414 | 3300023174 | Freshwater | MNLKNPYALTAGAFLAAWAGSDFALDHRAILFAILSGVFGYATPKKK |
Ga0214921_100124208 | 3300023174 | Freshwater | MKNPIILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKR |
Ga0214921_100741506 | 3300023174 | Freshwater | MKNPLILAAGAFLAAWSASNFNLDYRAILFAVLSGVFGYATPKR |
Ga0214921_100857564 | 3300023174 | Freshwater | MKHPAYLAAGAFLAAWASSNFEADYRAVLWAVLSGVFGYASPKK |
Ga0214921_100910747 | 3300023174 | Freshwater | MNMKNPIILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0214921_102784671 | 3300023174 | Freshwater | MKNPLVLAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKR |
Ga0214923_100327142 | 3300023179 | Freshwater | MNIKNPYVLTLGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0214919_1000394832 | 3300023184 | Freshwater | MNMKNPYVLTAGAFLSAWAASNFAADYRSVLWAILAGVFGYATPRKK |
Ga0214919_100039487 | 3300023184 | Freshwater | MNMKNPYILTAGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK |
Ga0214919_100477025 | 3300023184 | Freshwater | MKNPLVLAAGAFLAAWSASNFNLDYRAILFAVLSGVFGYATPKR |
Ga0214919_100481969 | 3300023184 | Freshwater | MRSHKLKNPIVLAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKR |
Ga0214919_101141971 | 3300023184 | Freshwater | TAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0209414_10137226 | 3300023301 | Hypersaline | MNLKNPVVLSLGAFLAAWSASNFNLDYRAILWSVLSGVFGYISPRKS |
Ga0255147_10372364 | 3300024289 | Freshwater | MNMKNPAVLTAGAFLSAWAASNFSLDYRAVLWAVLAGVFGYATPKK |
Ga0255148_10083215 | 3300024306 | Freshwater | MNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGV |
Ga0244777_106612153 | 3300024343 | Estuarine | NSMNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK |
Ga0244776_1002018114 | 3300024348 | Estuarine | MNIKNPYFLTAGAFLSAWAATNFAADYRSILWAVLAGVFGYATPKK |
Ga0244776_104301922 | 3300024348 | Estuarine | MNMKNPILLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0244776_109304301 | 3300024348 | Estuarine | DRRHSMNIKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKR |
Ga0255142_10567962 | 3300024352 | Freshwater | MNMKNPYILTAGAFLSAWAASNFALDYRSVLWALLAGVFGYATPKK |
Ga0255142_10688722 | 3300024352 | Freshwater | MNMKNPAVLTAGAFLSAWAASNFSLDYRAVLWAVLAGVFGYATP |
Ga0255144_10297454 | 3300024513 | Freshwater | KNPYVLTAGAFLAAWASSNFSPDYRSVLWAVLAGVFGYATPKKS |
Ga0209615_1034603 | 3300025075 | Freshwater | MKNMKNPVVLAAGAFLAAWASSNFELDYRAVLWAVLSGVFGYASPKK |
Ga0209616_10139393 | 3300025091 | Freshwater | MKNPIVLAAGAFLAAWSATNFTLDYRAILFAILSGVFGYATPKK |
Ga0209616_10325703 | 3300025091 | Freshwater | LFLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0208426_10669552 | 3300025451 | Aqueous | MNMKNPYVLTVGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK |
Ga0208303_10248344 | 3300025543 | Aqueous | MINEYIKHPALLAVGGFLAAWAGSDFELDYRAILWAVVAGIFGYAKRNGNPIK |
Ga0208303_10497331 | 3300025543 | Aqueous | MINDYVKHPALLAVGGFLAAWAGSDFALDYRAVLWAVVAGIFGYAKPIK |
Ga0208546_100042515 | 3300025585 | Aqueous | MKIKNPNLLLVGAFLAAWANSEFALDYKSVLLAVLAGVFGYATPKK |
Ga0208546_100060814 | 3300025585 | Aqueous | MMKNMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0208546_10174706 | 3300025585 | Aqueous | AGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKK |
Ga0208147_10033842 | 3300025635 | Aqueous | MNLKNPYLLTLGAFLAAWGSSNFSPDYRSILWAVLAGVFGYATPKKK |
Ga0208147_10192914 | 3300025635 | Aqueous | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPTKR |
Ga0208643_11148041 | 3300025645 | Aqueous | YVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0208643_11169373 | 3300025645 | Aqueous | MKNIKHPSYLAAGAFLAAWASSNFDLDYRAILWAALSGIFGYASPKK |
Ga0208643_11242763 | 3300025645 | Aqueous | MNMKNPAVLTAGAFLSAWAASNFAADYRSVLWAVLAGVFGYATPKK |
Ga0208161_10063976 | 3300025646 | Aqueous | VDYLKHPIALAVGAFLSAWAGTNFDLDYRAVLWAVVAGLFGYAKPYKK |
Ga0208019_11094911 | 3300025687 | Aqueous | LALGGFLAAWAGTDFEIDHRAILWAIVAGIFGYAKPIK |
Ga0208019_11428582 | 3300025687 | Aqueous | MINDYVKHPALLAVGGFLAAWAGSDFELDYRAILWAVVAGIFGYAKRNGNPIK |
Ga0208783_100660742 | 3300025872 | Aqueous | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0208644_10451715 | 3300025889 | Aqueous | MTNYLKHPIFMALGGFLAAWAGSNFDLDYRAVLFAILAGVFGYAKPVK |
Ga0208644_11436914 | 3300025889 | Aqueous | MKNVKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK |
Ga0208644_11506271 | 3300025889 | Aqueous | MKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGY |
Ga0208644_11582604 | 3300025889 | Aqueous | MNIKNPLFLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0208644_11709322 | 3300025889 | Aqueous | MKNMKNPVILAGGAFLAAWASSNFDLDYRSILWAVLSGVFGYASPKK |
Ga0208644_13268502 | 3300025889 | Aqueous | MNMKNPYVLTAGAFLAAWASSNFSLDYRAVLLAVLSGVFGYATPKKK |
Ga0208916_100139801 | 3300025896 | Aqueous | MKHPLFLMSGAFLAAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0208916_100140115 | 3300025896 | Aqueous | MNMKNPVMLTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK |
Ga0208916_101643631 | 3300025896 | Aqueous | MKHPLFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYAPPKK |
Ga0208916_102602262 | 3300025896 | Aqueous | MKNPIFLMSGAFLSAWAASNFAADYRAVLWAILAGVFGYATPKK |
Ga0208916_103360141 | 3300025896 | Aqueous | QTMKHPLFLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0208916_104044903 | 3300025896 | Aqueous | PLVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0208916_104759862 | 3300025896 | Aqueous | MNMKNPTILTAGAFLAAWGASNFSLDYRSVLWAVLAGVFGYATPKK |
Ga0208916_104892483 | 3300025896 | Aqueous | SNTYVRRKTMNLKNPIILAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR |
Ga0208916_104964343 | 3300025896 | Aqueous | IMKNPIFLMSGAFLAAWAASNFSLDYRAILWAILAGVFGYATPKK |
Ga0255156_10101891 | 3300026478 | Freshwater | MNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLA |
Ga0255274_11590723 | 3300026570 | Freshwater | MNMKNPAVLTAGAFLSAWAASNFSLDYRAVIWAVLAGVFGYATPKK |
Ga0209975_10009466 | 3300026993 | Freshwater Lake | LPDSLKHPIVLAVGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPYKK |
Ga0208009_10699001 | 3300027114 | Deep Subsurface | MKNIKHPAYLAAGAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK |
Ga0255074_10284292 | 3300027121 | Freshwater | MNMKSPYVLTAGAFLSAWAATNFAADYRSVLWALLAGVFGYATPKK |
Ga0209300_10417203 | 3300027365 | Deep Subsurface | MNIKNPLVLTLGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0208133_10636521 | 3300027631 | Estuarine | MKNPYVLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0208133_11219093 | 3300027631 | Estuarine | MNMKNPYVLTAGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK |
Ga0208975_10384651 | 3300027659 | Freshwater Lentic | MKHPMFLMSGAFLAAWAASNFSLDYRAVLWAILAGVF |
Ga0208975_11169352 | 3300027659 | Freshwater Lentic | MKHPIFLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPYKK |
Ga0208975_11799862 | 3300027659 | Freshwater Lentic | MKHPLFLTAGAFLSAWAASNFALDYRAILWAILAGVFGYATPKK |
Ga0209188_10520954 | 3300027708 | Freshwater Lake | MKNPYILTVGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK |
Ga0209188_10963814 | 3300027708 | Freshwater Lake | MKIKNQYSLLAGAFLAAWGASNFAIDYRSILWAVLAGVFGYATPKK |
Ga0209599_100861891 | 3300027710 | Deep Subsurface | ITRGQNMNMKNPYILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0209599_101276472 | 3300027710 | Deep Subsurface | MKNIKHPVYLAAGAFLAAWASSNFDLDYRAVLWAALSGIFGYASPKK |
Ga0209499_100146917 | 3300027712 | Freshwater Lake | MNMKNPYILTAGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKR |
Ga0209492_10016876 | 3300027721 | Freshwater Sediment | MKHPVFLTAGAFLSAWAASNFALDYRAVLWAILAGVFGYATPKK |
Ga0209492_10038806 | 3300027721 | Freshwater Sediment | MKNPAILAAGAFLAAWASSNFDLDYRAVLMAVLSGVFGYATPKK |
Ga0209492_12356641 | 3300027721 | Freshwater Sediment | MNMKNPLVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0209492_12770201 | 3300027721 | Freshwater Sediment | LTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK |
Ga0209492_12947852 | 3300027721 | Freshwater Sediment | MNIKNPYFLTAGAFLSAWAATNFAPDYRAILWAVLAGVFGYATPKK |
Ga0209442_10210302 | 3300027732 | Freshwater Lake | MNLKNPAILAAGAFLAAWSASNFNLDYRAILWSVLSGVFGYASPKK |
Ga0209442_10834671 | 3300027732 | Freshwater Lake | ARRQTMKHPLFLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0209297_10080386 | 3300027733 | Freshwater Lake | MNLKNPIFLLAGAFLSAWAASNFAIDYRAVLWAVLAGVFGYATPKK |
Ga0209297_10467522 | 3300027733 | Freshwater Lake | MKHPVFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK |
Ga0209297_10951384 | 3300027733 | Freshwater Lake | MKNPYILTAGAFLSAWAASNFAADYRSVLWALLAGVFGYATPKK |
Ga0209297_11349731 | 3300027733 | Freshwater Lake | MNMKNPYVLTIGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK |
Ga0209297_12444603 | 3300027733 | Freshwater Lake | MNMKNPYVLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0209297_12733232 | 3300027733 | Freshwater Lake | MKNPYVLTTGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK |
Ga0209087_100102219 | 3300027734 | Freshwater Lake | MKNPLILAAGAFLAAWSASNFTLDYRAILFAVLSGVFGYATPKK |
Ga0209087_100179717 | 3300027734 | Freshwater Lake | MKNPMFLMSGAFLSAWAASNFSLDYRAILWAILAGVFGYATPKK |
Ga0209087_10130218 | 3300027734 | Freshwater Lake | MNMKNPYVLTVGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK |
Ga0209087_10856773 | 3300027734 | Freshwater Lake | MKNIKNPAILAAGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK |
Ga0209087_13024191 | 3300027734 | Freshwater Lake | MKNPYFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK |
Ga0209087_13579672 | 3300027734 | Freshwater Lake | MNMKNPYILTVGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK |
Ga0209190_11328871 | 3300027736 | Freshwater Lake | NPYVLTAGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK |
Ga0209593_102332002 | 3300027743 | Freshwater Sediment | MNIKNPYFLTAGAFLSAWAATNFAADYRAILWAVLAGVFGYATPKK |
Ga0209084_10916662 | 3300027749 | Freshwater Lake | MKMKNQYSLLAGAFLAAWGASNFAIDYRSILWAVLAGVFGYASPKK |
Ga0209596_10025109 | 3300027754 | Freshwater Lake | MNIKNPYVLTLGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0209596_10161073 | 3300027754 | Freshwater Lake | MNIKNPYFLTAGAFLAAWAASNFAADYRSILWALLAGVFGYATPKR |
Ga0209596_11651834 | 3300027754 | Freshwater Lake | MNMKNPYMLTIGAFLSAWAASNFAADYRAILWAVLAGVFGYATPKK |
Ga0209596_11984912 | 3300027754 | Freshwater Lake | MNIKNPYFLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0209596_12962963 | 3300027754 | Freshwater Lake | KHPMFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK |
Ga0209444_100849431 | 3300027756 | Freshwater Lake | LTMNMKNPYLLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0209296_100193016 | 3300027759 | Freshwater Lake | MKINNPYVLALGAFLAAWSATNFDIDYRAILLAIVSGIFGYATPKR |
Ga0209296_10400708 | 3300027759 | Freshwater Lake | LGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0209598_101780552 | 3300027760 | Freshwater Lake | MNMKNPYFLTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKK |
Ga0209088_100135627 | 3300027763 | Freshwater Lake | MAIGGNTMNIKNPYFLTAGAFLAAWAASNFAADYRSILWAILAGVFGYATPKR |
Ga0209088_100148828 | 3300027763 | Freshwater Lake | MNIKNPYFLTAGAFLAAWAASNFAADYRSILWAILAGVFGYATPKR |
Ga0209088_101157641 | 3300027763 | Freshwater Lake | PYFLTAGAFLAAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0209088_103152663 | 3300027763 | Freshwater Lake | KNPYFLMSGAFLSAWAASNFAADYRAVLWAILAGVFGYATPKK |
Ga0209134_100062434 | 3300027764 | Freshwater Lake | MKNIKNPTYLAAGAFLAAWASSNFDLDYRAVLMAVLSGVFGYATPKK |
Ga0209770_100789454 | 3300027769 | Freshwater Lake | MNMKNPLILTAGAFLSAWAASNFDVDYRAILWAILAGVFGYATPKK |
Ga0209086_100265305 | 3300027770 | Freshwater Lake | MNMKNPYILTAGAFLAAWAGSNFSLDYKAIMFAVLSGVFGYATPTKK |
Ga0209500_100322088 | 3300027782 | Freshwater Lake | MKNPYVLTAGAFLSAWAASNFAADYRAVLWAVLAGVFGYATPKK |
Ga0209500_101280785 | 3300027782 | Freshwater Lake | MNMKNPYILTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0209246_102166373 | 3300027785 | Freshwater Lake | MNIKNPYILTAGAFLSAWAASNFAADYRSILWAVLAG |
Ga0209246_102178043 | 3300027785 | Freshwater Lake | MKHPLFLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYAT |
Ga0209287_101448411 | 3300027792 | Freshwater Sediment | MNLKNPAILAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPK |
Ga0209972_100021375 | 3300027793 | Freshwater Lake | MPDSLKHPIVLAAGAFLAAWAATNFELDYRAILWAVLSGLFGYAKPYKK |
Ga0209972_1000405910 | 3300027793 | Freshwater Lake | LPDSLKHPIVLAVGAFLSAWAATNFELDYRAILWAVLSGLFGYAKPYKK |
Ga0209972_100458333 | 3300027793 | Freshwater Lake | VTDYMKHPIVLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPYKK |
Ga0209107_1000826716 | 3300027797 | Freshwater And Sediment | MNIKNPVVLTLGAFLSAWAASNFDIDYRAILWAVLAGVFGYATPKK |
Ga0209353_100668905 | 3300027798 | Freshwater Lake | GAFLAAWASTNFAADYRAILWAVLSGVFGYASPKK |
Ga0209353_102252274 | 3300027798 | Freshwater Lake | MNIKNPYILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0209353_102703614 | 3300027798 | Freshwater Lake | AILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATPKK |
Ga0209229_1000202211 | 3300027805 | Freshwater And Sediment | MNIKNPYVLTLGAFLAAWAGSDFSLDHRAVLFAILSGVFGYATPKKK |
Ga0209229_101144033 | 3300027805 | Freshwater And Sediment | MKNPYVLTAGAFLAAWAASNFAADYRSVLWALLAGVFGYATPKR |
Ga0209229_101684452 | 3300027805 | Freshwater And Sediment | MKNIKHPAYLAAGAFLAAWASSNFDLDYRAVLWAALSGIFGYASPKK |
Ga0209229_102125563 | 3300027805 | Freshwater And Sediment | MKYKNPYILAAGAFLAAWSSSNFNSDYRAILFAVLSGVFGYATPKR |
Ga0209229_103741691 | 3300027805 | Freshwater And Sediment | MNMKSPYVLTAGAFLSAWAATNFAADYRSVLWAVLAGVFGYATPKK |
Ga0209229_104047001 | 3300027805 | Freshwater And Sediment | MMKYKNPYILAAGAFLAAWASTNFAADYRAILWAVLSGVFGYATPKK |
Ga0209354_100144002 | 3300027808 | Freshwater Lake | MNMKSPVVLTLGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0209990_1000274011 | 3300027816 | Freshwater Lake | VTDYMKHPIFLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPYKK |
Ga0209990_100668674 | 3300027816 | Freshwater Lake | MKHPAVLAVGAFLSAWAATNFDLDYRAVLWSVVAGVFGYAKPFKK |
Ga0209550_103564151 | 3300027892 | Freshwater Lake | MNYKNPAILAAGAFLAAWSATNFDIDYRAILFAVLSGVFGYATP |
Ga0209668_108142263 | 3300027899 | Freshwater Lake Sediment | MNMKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYA |
Ga0209536_1014146902 | 3300027917 | Marine Sediment | MNMKNPLILTTGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0209820_10394333 | 3300027956 | Freshwater Sediment | MKHPIYLAAGAFLAAWSATNFDADYRAILWAVLAGVFGYASPKK |
Ga0209820_10492063 | 3300027956 | Freshwater Sediment | MKHPAVLAAGAFLSAWAATNFELDYRAVLWAVVAGVFGYAKPYKR |
Ga0209400_100179423 | 3300027963 | Freshwater Lake | MNMKNPYLLTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKR |
Ga0209400_100310615 | 3300027963 | Freshwater Lake | MNMKNPLILTAGAFLSAWAASNFDADYRAILWAVLAGVFGYATPKK |
Ga0209400_102008813 | 3300027963 | Freshwater Lake | MNIKNPLILTVGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0209191_10493944 | 3300027969 | Freshwater Lake | MNMKNPYVLTIGAFLSAWAASNFAADYRAVLWAILAGVFGYATPKK |
Ga0209191_10539692 | 3300027969 | Freshwater Lake | MKDYMKNPIILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGFATPKK |
Ga0209191_11428782 | 3300027969 | Freshwater Lake | MNMKDPAILTAGAFLSAWAASNFDIDYRAILWAVLAGVFGYATPKK |
Ga0209079_103316282 | 3300027972 | Freshwater Sediment | MNMKNPIFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0247723_100178011 | 3300028025 | Deep Subsurface Sediment | MNIKNPYVLTLGAFLAAWAGSEFSLDHKAILFAILSGVFGYATPKKK |
Ga0247723_10028938 | 3300028025 | Deep Subsurface Sediment | MKNPALLTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKK |
Ga0247723_10043493 | 3300028025 | Deep Subsurface Sediment | MNLKNPIVLAAGAFLAAWSATNFDADYRAILWSVLSGVFGYASPKR |
Ga0247723_10065893 | 3300028025 | Deep Subsurface Sediment | MKMTNPYVLMVGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0247723_10110028 | 3300028025 | Deep Subsurface Sediment | MKNPLFLMSGAFLAAWAASNFSLEYRAVLWAILAGVFGYTTPKK |
Ga0247723_10330034 | 3300028025 | Deep Subsurface Sediment | MMNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKK |
Ga0247723_10364214 | 3300028025 | Deep Subsurface Sediment | MKLKNPAFLAAGAFLAAWSATNFDVDYRAILWSVLSGIFGYATPKR |
Ga0255172_10103485 | 3300028103 | Freshwater | MNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYA |
Ga0304730_10016558 | 3300028394 | Freshwater Lake | MKMKNPYALAAGAFLAAWASTNFDIDYRAILWAVLSGVFGYASPKK |
Ga0304730_10019076 | 3300028394 | Freshwater Lake | MKNPLVLAAGAFLAAWSASNFTLDYRAILFAVLSGVFGYATPKR |
Ga0238435_1175932 | 3300029349 | Freshwater | MKNMKNPAVLACGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK |
Ga0119944_100006614 | 3300029930 | Aquatic | MKNAYFLLAGAFLAAWANSDFALDYRSILWAVLAGIFGYATPKKK |
Ga0119944_10264962 | 3300029930 | Aquatic | LSDYLKHPILLALGGFLAAWAGSNFELDYRAVLFAVLAGVFGYAKPVK |
Ga0315907_1000095042 | 3300031758 | Freshwater | MKDYMKNPIVLATGAFLAAWASSNFDLDYRAVLWAVLSGIFGYATPKK |
Ga0315907_1000472014 | 3300031758 | Freshwater | MNLKNPYALTAGAFLAAWASSNFSLDYKAILFAVLSGVFGYATPTKK |
Ga0315907_1001232810 | 3300031758 | Freshwater | MNLKNPIILAAGAFLAAWSATNFDADYRAILWSVLSGVFGYASPKR |
Ga0315907_100312798 | 3300031758 | Freshwater | MKHPIFLAAGAFLAAWAATNFELDYRAILWAVVSGVFGYAKPYKK |
Ga0315907_100797799 | 3300031758 | Freshwater | PTTRSKLMKLKNPLFLAAGAFLAAWSATNFDIDYRAILWSVLSGIFGYATPKR |
Ga0315907_100850523 | 3300031758 | Freshwater | MNLKNPAILAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR |
Ga0315907_101139168 | 3300031758 | Freshwater | RRKTMNLKNPAILAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR |
Ga0315907_103844662 | 3300031758 | Freshwater | MKHPAVLALGAFLSAWAATNFDLDYRAILWSVVAGVFGYAKPFKK |
Ga0315907_104273322 | 3300031758 | Freshwater | MPDSLKHPIVLAVGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPYKR |
Ga0315907_104556762 | 3300031758 | Freshwater | MKHPIVLAAGAFLAAWAATNFELDYRTVLWAVVSGVFGYAKPYKK |
Ga0315907_106723593 | 3300031758 | Freshwater | IFMALGGFLAAWAGSNFELDYRAVLFAILAGVFGYAKPVK |
Ga0315907_108118931 | 3300031758 | Freshwater | LPNELKHPIVLAAGAFLSAWAATNFELDYRAILWAVVSGLFGYAKPFKK |
Ga0315907_110137252 | 3300031758 | Freshwater | MNMKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYETPKK |
Ga0315900_100368043 | 3300031787 | Freshwater | MKLKNPAFLAAGAFLAAWSATNFDIDYRAILWSVLSGIFGYATPKR |
Ga0315900_103763324 | 3300031787 | Freshwater | YARRNRMNMKNPYILTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKR |
Ga0315900_105628003 | 3300031787 | Freshwater | PIFMALGGFLAAWAGSNFELDYRAVLFAVLAGVFGYAKPVK |
Ga0315900_106866951 | 3300031787 | Freshwater | KLMNMKNPLVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0315900_107868602 | 3300031787 | Freshwater | MNMKNPYILTAGAFLSAWAASNFAADYRSILWAILAGVFGYATPKR |
Ga0315900_109114532 | 3300031787 | Freshwater | AILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0315909_100175048 | 3300031857 | Freshwater | VNDYMKHPAVLAVGAFLSAWAATNFDLDYRAVLWSVVAGVFGYAKPFKK |
Ga0315909_100175867 | 3300031857 | Freshwater | VTDYMKHPIFLAAGAFLAAWAATNFELDYRAILWAVVSGVFGYAKPYKK |
Ga0315909_100333762 | 3300031857 | Freshwater | MKLKNPLFLAAGAFLAAWSATNFDIDYRAILWSLLSGIFGYATPKR |
Ga0315909_100381141 | 3300031857 | Freshwater | NPTTRSKLMKLKNPLFLAAGAFLAAWSATNFDIDYRAILWSVLSGIFGYATPKR |
Ga0315909_100390301 | 3300031857 | Freshwater | MKHPAVLAVGAFLSAWAATNFDLDYRAVLWSVVAGVFGYAK |
Ga0315909_100487936 | 3300031857 | Freshwater | MALGGFLAAWAGSNFDLDYRAILFAVLAGVFGYAKPSK |
Ga0315909_100606825 | 3300031857 | Freshwater | MKHPLFLTAGAFLSAWAASNFSLDYRAVLWAILAGVFGYATPKK |
Ga0315909_102863871 | 3300031857 | Freshwater | MALGGFLAAWAGSNFELDYRAVLFAILAGVFGYAKPVK |
Ga0315909_104530213 | 3300031857 | Freshwater | RIMKNMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0315909_105994772 | 3300031857 | Freshwater | LSNYLKHPIFMALGGFLAAWAGSNFDLDYRAILFAVLAGVFGYAKPVK |
Ga0315909_109813291 | 3300031857 | Freshwater | MKNMKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGIFGYASPKK |
Ga0315904_1002077010 | 3300031951 | Freshwater | MKNPLVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0315904_101255125 | 3300031951 | Freshwater | MKHPLFLTAGAFLSAWAASNFALDYRAVLWAVLAG |
Ga0315904_103569381 | 3300031951 | Freshwater | KNPAILAAGAFLAAWSATNFDADYRAILWSILSGVFGYASPKR |
Ga0315904_103656843 | 3300031951 | Freshwater | LSNYLKHPIFMALGGFLAAWAGSNFELDYRAVLFAILAGVFGYAKPVK |
Ga0315904_107958241 | 3300031951 | Freshwater | GFFSDTYVRRTIMKNMKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGVFGYASPKK |
Ga0315904_112213011 | 3300031951 | Freshwater | IMKNMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0315901_1001101010 | 3300031963 | Freshwater | MNMKNPYVLTAGAFLSAWVASNFAADYRSILWAVLAGVFGYATPKR |
Ga0315901_105212323 | 3300031963 | Freshwater | MKHPIFLAAGAFLAAWAATNFDLDYRAILWAIVSGVFGYAKPYKK |
Ga0315901_105826291 | 3300031963 | Freshwater | NMKNPAILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0315901_106836641 | 3300031963 | Freshwater | YLLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0315901_110559791 | 3300031963 | Freshwater | VNDYMKHPAVLAVGAFLSAWAATNFDLDYRAVLWSVVAGVFGYAKPFK |
Ga0315901_111024452 | 3300031963 | Freshwater | MKHPIFLAAGAFLAAWAATNFELDYRAVLWAVVSGVFGYAKPY |
Ga0315905_100198733 | 3300032092 | Freshwater | MKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGIFGYASPKK |
Ga0315905_108189174 | 3300032092 | Freshwater | HPAYLAAGAFLAAWASSNFEADYRAILWAVLSGIFGYASPKK |
Ga0315905_113152862 | 3300032092 | Freshwater | MKYIKHPIYLAAGAFLAAWGSSNFEIDYRAILFAVLSGVFGYATPKK |
Ga0315902_101286597 | 3300032093 | Freshwater | MNLKNPAILAAGAFLAAWSATNFDLDYRAVLWSVLSGVFG |
Ga0315902_102322841 | 3300032093 | Freshwater | AAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0315902_106561721 | 3300032093 | Freshwater | MKNIKHPAYLAAGAFLAAWASSNFEADYRAILWAVLSGIFGYA |
Ga0315903_1003906214 | 3300032116 | Freshwater | KNPLVLTAGAFLSAWAATNFEVDYRAILWAILAGVFGYATPKK |
Ga0315903_100668859 | 3300032116 | Freshwater | MKNPVFLAGGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0315903_101867185 | 3300032116 | Freshwater | NYLKHPIFMALGGFLAAWAGSNFDLDYRAILFAVLAGVFGYAKPVK |
Ga0315903_104368794 | 3300032116 | Freshwater | MNMKNPLVLTAGAFLSAWAATNFEVDYRAILWAILAGVFGYATPKK |
Ga0315903_104788601 | 3300032116 | Freshwater | MKIKNPLFLAAGAFLAAWSATNFDVDYRAILWSVLSGIFGYATPK |
Ga0315903_105925871 | 3300032116 | Freshwater | MNMKNPIVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0315903_109577891 | 3300032116 | Freshwater | MNMKNPFVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0315903_111031711 | 3300032116 | Freshwater | LAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0316616_1022024742 | 3300033521 | Soil | MKNPVILTAGAFLAAWGASNFALDYRSILWAVLAGVFGYATPKK |
Ga0334994_0130799_1_174 | 3300033993 | Freshwater | VFSNPTSRRQSMKLKNPLFLAAGAFLAAWSATNFDIDYRAILWSVLSGIFGYATPKR |
Ga0334994_0218851_144_284 | 3300033993 | Freshwater | MNLKNPAILAAGAFLAAWSATNFDADYRAVLWSILSGVFGYASPKR |
Ga0334994_0510972_242_382 | 3300033993 | Freshwater | MNIKNPIFLTVGAFLSAWAASNFDIDYRAILWAVLAGVFGYATPKK |
Ga0335003_0005471_3973_4116 | 3300033995 | Freshwater | MKNMKNPALLAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0335003_0043344_407_547 | 3300033995 | Freshwater | MNMKNPAFLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0334979_0034308_811_954 | 3300033996 | Freshwater | MKNMKNPAILAAGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK |
Ga0334979_0756571_9_152 | 3300033996 | Freshwater | MKNMKNPAILAAGAFLAAWASSNFDLDYRAVLWAVLSGVFGYASPKK |
Ga0334986_0013238_5081_5221 | 3300034012 | Freshwater | MNMKNPVILTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK |
Ga0334985_0002197_1114_1254 | 3300034018 | Freshwater | MNLKNPYALTAGAFLAAWASSNFSVDYKAILFAVLSGVFGYATPKK |
Ga0334985_0238562_514_654 | 3300034018 | Freshwater | MNMKNPIVLTLGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKK |
Ga0334998_0488782_3_137 | 3300034019 | Freshwater | KHPAVLALGAFLSAWAATNFDLDYRAILWSVVAGVFGYAKPFKK |
Ga0335002_0316078_32_184 | 3300034020 | Freshwater | LDAAQADKNPYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0335024_0450615_3_119 | 3300034051 | Freshwater | MNMKNPYVLTAGAFLSAWAASNFAADYRSILWAVLAGVF |
Ga0334987_0003966_3748_3891 | 3300034061 | Freshwater | MKNMKNPAMLAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0334987_0015592_4474_4614 | 3300034061 | Freshwater | MNLKNPAILAAGAFLAAWSATNFDLDYRAILWSVLSGVFGYASPKR |
Ga0334987_0224311_1192_1299 | 3300034061 | Freshwater | MNMKNPYLLTAGAFLSAWAASNFAADYRSILWAVLA |
Ga0334987_0686126_395_535 | 3300034061 | Freshwater | MNLKNPAVLAAGAFLAAWSASNFNLDYRAILWSVLSGVFGYASPKR |
Ga0334987_0801392_1_111 | 3300034061 | Freshwater | AGAFLAAWSATNFDVDYRAILWSVLSGIFGYATPKR |
Ga0334995_0257942_516_659 | 3300034062 | Freshwater | MNMKNPYALTAGAFLAAWAGSNFSLDYKAIMFAILSGVFGYATPTKK |
Ga0334995_0353517_3_131 | 3300034062 | Freshwater | MKDYMKNPIVLATGAFLAAWASSNFDLDYRAVLWAVLSGIFGY |
Ga0334995_0408456_4_147 | 3300034062 | Freshwater | MKNIKNPVYLAAGAFLAAWASINFEADYRAILWAVLSGVFGYASPKK |
Ga0334995_0723407_98_238 | 3300034062 | Freshwater | MNMKNPAVLTIGAFLSAWAASNFAVDYRSILWAILAGVFGYATPKK |
Ga0334995_0769249_2_124 | 3300034062 | Freshwater | LVLTAGAFLSAWAASNFDVDYRAILWAVLAGVFGYATPKK |
Ga0335001_0245520_98_211 | 3300034064 | Freshwater | MSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK |
Ga0335019_0057527_2540_2650 | 3300034066 | Freshwater | MNMKNPLVLTAGAFLSAWAASNFAADYRSILWAVLAG |
Ga0335019_0532535_2_130 | 3300034066 | Freshwater | HPLFLTAGAFLSAWAASNFALDYRAVLWAVLAGVFGYATPKK |
Ga0335028_0433881_630_740 | 3300034071 | Freshwater | MNMKNPAILTAGAFLAAWGASNFALDYRSILWAVLAG |
Ga0310130_0001595_239_355 | 3300034073 | Fracking Water | MALGGFLAAWASSNFDLDYRAVLFAVVAGVFGYAKPSK |
Ga0335020_0217537_229_363 | 3300034082 | Freshwater | MKNPAVLTAGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKK |
Ga0335010_0331307_252_389 | 3300034092 | Freshwater | MKHPAVLAVGAFLSAWAATNFDLDYRAVPWSVVAGVFGYAKPFKK |
Ga0335027_0002565_10788_10931 | 3300034101 | Freshwater | MKNMKNPVVLAGGAFLAAWASSNFDLDYRAVLWAVLSGVFGYASPKK |
Ga0335029_0251480_2_118 | 3300034102 | Freshwater | LAAGAFLAAWASSNFDLDYRAVLMAVLSGVFGYATPKK |
Ga0335029_0317421_16_159 | 3300034102 | Freshwater | MKNIKNPVYLAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYASPKK |
Ga0335030_0001862_9464_9607 | 3300034103 | Freshwater | MKNMKNPAMLAAGAFLAAWASSNFDLDYRAILWAVLSGVFGFASPKK |
Ga0335030_0511342_1_111 | 3300034103 | Freshwater | MKNPAILTAGAFLAAWGASNFALDYRSVLWAVLAGVF |
Ga0335031_0017508_2685_2825 | 3300034104 | Freshwater | MNLKNPIVLAAGAFLAAWSASNFNLDYRAVLWSVLSGVFGYASPKK |
Ga0335031_0069525_1639_1779 | 3300034104 | Freshwater | MTMKNPYVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0335031_0232350_512_652 | 3300034104 | Freshwater | MKINNPYVLALGAFLAAWSATNFDIDYRAVLLAIVSGIFGYATPKR |
Ga0335031_0236410_607_753 | 3300034104 | Freshwater | VKEYMKHPAILATGAFLAAWASSNFDLDYRAILWAVLSGVFGFATPKK |
Ga0335031_0711153_35_169 | 3300034104 | Freshwater | MKHPLFLTAGAFLSAWAASNFALDYRSVLWAILAGVFGYATPKK |
Ga0335035_0124061_3_113 | 3300034105 | Freshwater | MNMKNPYVLTAGAFLSAWAASNFAADYRSILWAVLAG |
Ga0335055_0011554_1451_1594 | 3300034110 | Freshwater | MNMKNPAILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPAKR |
Ga0335063_0016508_1_132 | 3300034111 | Freshwater | MKNMKNPVILAAGAFLAAWASSNFDLDYRAILWAVLSGVFGYAS |
Ga0335068_0562618_240_383 | 3300034116 | Freshwater | MKNMKNPVVLAGGAFLAAWASSNFDLDYRAVLWAVLSGVFGYATPKK |
Ga0335054_0629027_1_126 | 3300034119 | Freshwater | PYVLTLGAFLSAWAASNFAADYRSILWALLAGVFGYATPKK |
Ga0335056_0596846_192_332 | 3300034120 | Freshwater | MNMKNPAILTSGAFLAAWGASNFALDYRSVLWAVLAGVFGYATPKR |
Ga0335058_0002150_12459_12593 | 3300034121 | Freshwater | MKNPVYLAAGAFLAAWSATNFSTDYRAILWSVLSGVFGYATPKK |
Ga0335058_0806550_386_511 | 3300034121 | Freshwater | MNMKSPYVLTAGAFLAAWAATNFAADYRSILWAVLAGVFGYA |
Ga0335060_0507131_69_191 | 3300034122 | Freshwater | MFLMSGAFLAAWAASNFSLDYRAVLWAILAGVFGYATPKK |
Ga0335016_0004084_687_827 | 3300034166 | Freshwater | MKIKNPLFLAAGAFLAAWSATNFDVDYRAILWSVLSGVFGYASPKR |
Ga0335061_0382560_210_350 | 3300034168 | Freshwater | MNMKNPFVLTAGAFLSAWAASNFALDYRAILWAVLAGVFGYATPKK |
Ga0335007_0749064_416_538 | 3300034283 | Freshwater | MNLKNPIVLAAGAFLAAWSATNFDADYRAILWSILSGVFGY |
Ga0335048_0058275_3_128 | 3300034356 | Freshwater | MNMKNPLVLTAGAFLSAWAASNFAADYRSILWAVLAGVFGYA |
Ga0335048_0221601_2_130 | 3300034356 | Freshwater | NPYILTAGAFLSAWAASNFAADYRSILWAVLAGVFGYATPKR |
Ga0310143_00708_4522_4665 | 3300034523 | Fracking Water | MNIKNPYVLTLGAFLAAWAGSDFSLDHRAILFAILSGVFGFATPKKK |
Ga0310143_08320_67_204 | 3300034523 | Fracking Water | MKHPAVLATGAFLSAWAATNFELDYRAVLWAVVAGVFGYAKPYKK |
⦗Top⦘ |