Protein Family IF13568

Metagenome Isolate
151 Members
52 Samples
136 Scaffolds
490.34 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|650716102|650883049|
Length
546 aa
Sequence
MSDKTPLTRQFPDPVPVDPVLDKLSRWVENALGIKAGEDALQKLREYMEKQFNPNIFQFPGAFEWSLSSREERFKIARFLTINETYFFREEPHFYLLLKELLPRFARLNRPLRVCSAACSAGCEAYSLAMLMDHYSRTTAFLDFKIEAFDISQDMIEVAKQGRYTSNTFRDDGNHWKYILDEYLTEKDGEYMVNNKLKEKIHFFPHNIMDGLDQASFDLILFRNALIYFSAESRVKLLDSLTKSLTEGGVLLFGIAETPSVSHPLLRNKNAQGAFYFQKDSTPPSEEDRRNSDRQASDRRDQDRRSTDRRVLNMKASELNFPDRRVQDRRAQERRTLDRRFPDIRSEQAAGTAAPKPQPPPNSEAPGKAGLTVNMKTISALIEQGESLQAAERLLMVLKEPAAGPADLPASGRAAVTEEETIAAVISLLSLEDFAGANLVLSLMEKKPKSAFTKFLRGEYNYHLNKVKEAEAGYKEASSLNSAFWPAFYRMSLLAAGGNRTRYEYKIKKALESIDMGKDMYYECLIGGFSPDYYRRILEKRLSAEV

📊 Sample Types

Isolate 9.9%
Metagenome 90.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.0%
Unclassified 30.0%
Kalotermitidae 24.0%
Termopsidae 8.0%
Rhinotermitidae 4.0%

🌳 Taxonomy

Archaea 1
Bacteria 143
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
11 2781125683 Treponema sp. Lab288P1bin34 Isolate Unclassified
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
18 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
19 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
23 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
24 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
25 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
26 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
29 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
30 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
34 650716102 Treponema primitia ZAS-2 Isolate Unclassified
35 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
36 2820013017 Unclassified Spirochaetes Th196P3bin152 Isolate Unclassified
37 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
38 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
39 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
43 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
44 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
45 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
46 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
47 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
48 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
49 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
50 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
51 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
52 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_028310 3300042612 Bacteria 12285
2 Ga0123356_10020801 3300010049 Bacteria 6206
3 Ga0466692_067669 3300042591 Bacteria 7313
4 Ga0466716_091280 3300042605 Bacteria 15463
5 Ga0466719_126169 3300042606 Bacteria 4100
6 Ga0466720_065463 3300042607 Bacteria 6065
7 Ga0466721_224720 3300042608 Bacteria 20051
8 Ga0466722_007779 3300042609 Bacteria 11833
9 Ga0466722_038012 3300042609 Bacteria 18975
10 Ga0466712_009154 3300042614 Bacteria 12593
11 Ga0466712_112533 3300042614 Bacteria 5724
12 Ga0466712_139157 3300042614 Bacteria 70891
13 JGI24698J34947_10033330 3300002449 Unclassified 2703
14 JGI24695J34938_10043045 3300002450 Bacteria 2017
15 Ga0072941_1077300 3300005201 Bacteria 6820
16 Ga0072941_1102810 3300005201 Bacteria 4857
17 Ga0466703_047320 3300042636 Bacteria 4048
18 Ga0123356_10000007 3300010049 Bacteria 240704
19 Ga0466693_075896 3300042592 Bacteria 53125
20 Ga0466693_085701 3300042592 Bacteria 5281
21 Ga0466691_074225 3300042593 Bacteria 14412
22 Ga0466696_063812 3300042596 Bacteria 17398
23 Ga0466699_158308 3300042597 Bacteria 2534
24 Ga0466716_020105 3300042605 Bacteria 4483
25 Ga0466716_320412 3300042605 Bacteria 5216
26 Ga0466719_312216 3300042606 Bacteria 6308
27 Ga0466720_032626 3300042607 Bacteria 13895
28 Ga0466722_112483 3300042609 Bacteria 2865
29 Ga0466712_017533 3300042614 Bacteria 21563
30 JGI24698J34947_10000632 3300002449 Bacteria 16952
31 JGI24699J35502_11091118 3300002509 Unclassified 2139
32 Ga0072941_1047264 3300005201 Bacteria 11760
33 Ga0466727_322795 3300042655 Bacteria 13243
34 Ga0123356_10169674 3300010049 Bacteria 2191
35 Ga0466691_158437 3300042593 Bacteria 18080
36 Ga0466694_173720 3300042594 Bacteria 25304
37 Ga0466720_134808 3300042607 Bacteria 3999
38 Ga0466718_008891 3300042617 Bacteria 16206
39 Ga0466718_017117 3300042617 Bacteria 6410
40 Ga0466718_057705 3300042617 Bacteria 6059
41 Ga0466728_056427 3300042620 Bacteria 11598
42 JGI24698J34947_10004146 3300002449 Bacteria 7865
43 JGI24698J34947_10043597 3300002449 Bacteria 2299
44 JGI24695J34938_10001854 3300002450 Bacteria 17177
45 JGI24695J34938_10003503 3300002450 Bacteria 10904
46 JGI24695J34938_10011603 3300002450 Unclassified 4737
47 Ga0466731_160741 3300042622 Archaea 4710
48 Ga0466735_062955 3300042624 Bacteria 25771
49 Ga0466703_131167 3300042636 Bacteria 8698
50 Ga0466703_289965 3300042636 Bacteria 2702
51 Ga0466727_002127 3300042655 Bacteria 5499
52 Ga0264413_132084 3300024493 Bacteria 2641
53 Ga0466699_402771 3300042597 Bacteria 21868
54 Ga0466712_019495 3300042614 Bacteria 40574
55 Ga0466711_135718 3300042615 Bacteria 16582
56 Ga0466723_014513 3300042618 Bacteria 9794
57 JGI24698J34947_10011455 3300002449 Bacteria 4869
58 JGI24698J34947_10015903 3300002449 Bacteria 4091
59 JGI24695J34938_10000017 3300002450 Bacteria 115659
60 JGI24695J34938_10018211 3300002450 Bacteria 3518
61 JGI24702J35022_10052913 3300002462 Bacteria 2165
62 Ga0072941_1008776 3300005201 Bacteria 26268
63 Ga0072941_1151441 3300005201 Bacteria 3004
64 Ga0072941_1490828 3300005201 Bacteria 2267
65 Ga0466703_121105 3300042636 Bacteria 28007
66 Ga0466704_016389 3300042643 Unclassified 2958
67 Ga0466709_011536 3300042648 Bacteria 10676
68 Ga0466708_396359 3300042652 Bacteria 10107
69 Ga0123356_10000085 3300010049 Bacteria 98249
70 Ga0466694_113637 3300042594 Bacteria 10355
71 Ga0466696_221959 3300042596 Bacteria 15679
72 Ga0466699_259307 3300042597 Bacteria 2202
73 Ga0466719_038092 3300042606 Bacteria 12135
74 Ga0466722_087893 3300042609 Bacteria 1722
75 Ga0466711_343333 3300042615 Bacteria 5945
76 Ga0466726_432681 3300042619 Bacteria 4616
77 AustNasuHG_c1016456 3300000089 Bacteria 2474
78 JGI24698J34947_10012523 3300002449 Bacteria 4648
79 JGI24695J34938_10000021 3300002450 Bacteria 112419
80 JGI24695J34938_10030713 3300002450 Bacteria 2499
81 JGI24702J35022_10000805 3300002462 Bacteria 19405
82 Ga0068302_10084876 3300005071 Bacteria 7972
83 Ga0466703_001584 3300042636 Bacteria 18580
84 Ga0466703_118937 3300042636 Bacteria 14662
85 Ga0466708_038004 3300042652 Bacteria 4450
86 Ga0466705_231320 3300042612 Bacteria 18145
87 Ga0123353_10236956 3300010167 Bacteria 2839
88 Ga0264413_101847 3300024493 Bacteria 86591
89 Ga0466694_105932 3300042594 Bacteria 49364
90 Ga0466696_099585 3300042596 Bacteria 10860
91 Ga0466723_071252 3300042618 Bacteria 58514
92 Ga0466726_287420 3300042619 Bacteria 15009
93 Ga0466728_224245 3300042620 Bacteria 10061
94 JGI24698J34947_10000583 3300002449 Unclassified 17389
95 JGI24698J34947_10013420 3300002449 Bacteria 4474
96 JGI24695J34938_10000186 3300002450 Bacteria 58319
97 JGI24695J34938_10002400 3300002450 Bacteria 14388
98 JGI24695J34938_10006546 3300002450 Bacteria 6967
99 Ga0072940_1016998 3300005200 Bacteria 2268
100 Ga0466704_393069 3300042643 Bacteria 10459
101 Ga0466704_572658 3300042643 Bacteria 6918
102 Ga0466705_151806 3300042612 Bacteria 13756
103 Ga0264413_101607 3300024493 Unclassified 6402
104 Ga0264413_139379 3300024493 Bacteria 5592
105 Ga0466693_060383 3300042592 Bacteria 8217
106 Ga0466694_063835 3300042594 Bacteria 37589
107 Ga0466699_026292 3300042597 Bacteria 3639
108 Ga0466716_062337 3300042605 Bacteria 44297
109 Ga0466716_383735 3300042605 Bacteria 4906
110 Ga0466726_043084 3300042619 Bacteria 5167
111 AustNasuHG_c1001349 3300000089 Bacteria 8801
112 JGI24695J34938_10000016 3300002450 Bacteria 116336
113 Ga0072941_1035939 3300005201 Bacteria 13220
114 Ga0466702_135825 3300042635 Bacteria 3760
115 Ga0466704_411971 3300042643 Bacteria 19295
116 Ga0466708_025661 3300042652 Bacteria 42065
117 Ga0466708_091225 3300042652 Bacteria 16006
118 Ga0466705_050312 3300042612 Bacteria 3788
119 Ga0123356_10000079 3300010049 Bacteria 103173
120 Ga0123356_10000767 3300010049 Bacteria 35460
121 Ga0466696_202776 3300042596 Bacteria 2132
122 Ga0466712_039302 3300042614 Bacteria 20252
123 Ga0466712_107945 3300042614 Unclassified 4929
124 Ga0466718_037157 3300042617 Bacteria 10500
125 Ga0466723_095605 3300042618 Bacteria 14842
126 Ga0466723_294328 3300042618 Bacteria 3841
127 Ga0466726_012780 3300042619 Bacteria 3511
128 Ga0466728_051506 3300042620 Bacteria 15989
129 AustNasuHG_c1000947 3300000089 Bacteria 10494
130 JGI24698J34947_10018305 3300002449 Bacteria 3787
131 JGI24695J34938_10000352 3300002450 Bacteria 45395
132 JGI24695J34938_10000661 3300002450 Bacteria 32544
133 JGI24695J34938_10000788 3300002450 Bacteria 29542
134 JGI24695J34938_10007621 3300002450 Bacteria 6292
135 Ga0466704_150819 3300042643 Bacteria 8238
136 Ga0466708_107150 3300042652 Bacteria 15681

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01739 CheR CheR methyltransferase, SAM binding domain 83 258 0.9

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.