Protein Family IF12058
Metagenome
Isolate
140
Members
41
Samples
135
Scaffolds
364.1
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2820371985|2820373131|
- Length
- 409 aa
- Sequence
- MKRMKTTVAVLLAFVMIFSLAACGSGSSGSGGGGGSSASSGGSGSSGSGSGSSSSAGSSAGSSSGSSATAGLNIGIVTTSGVDDGNFGQDCYNGILAFINDHPDAKVTAIKEPDNSKVNDAVAAVIADYDVLVLPGFQFSPAGAIGLSNPDKKIILVDVYPQDENGEEVELDNIYAMLFKEEESGFFAGIAAAMESKTGKVAVVNGIAFPSNVNYQYGFMAGVNYANKYYGTNTQYVELPSYAGTDVTGANVGGNYIGDFADEATGKIVGNALIDQGVDVLFVAAGASGNGVFAAAKEANNVWLIGCDVDQYDDGAKGNSNIILTSALKVMNLNVTRQLKAISDGSFKGQNAILGADTDSTGYVSASGRQQLGADTLKKMEEAYGALKEGKIVPPANFNGLSPTSFTGL
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
33.3%
Unclassified
20.5%
Termopsidae
7.7%
Rhinotermitidae
5.1%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2820371985 | Unclassified Firmicutes Nt197P3bin100 | Isolate | Unclassified |
| 9 | 2820848511 | Unclassified Actinobacteria Lab288P3bin86 | Isolate | Unclassified |
| 10 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 2820831444 | Unclassified Actinobacteria Nc150P4bin21 | Isolate | Unclassified |
| 21 | 2820916033 | Unclassified Actinobacteria Emb289P3bin63 | Isolate | Unclassified |
| 22 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 2820800812 | Unclassified Actinobacteria Th196P4bin28 | Isolate | Unclassified |
| 34 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_278453 | 3300042612 | Bacteria | 9687 |
| 2 | Ga0466705_311410 | 3300042612 | Bacteria | 7690 |
| 3 | Ga0466707_044543 | 3300042601 | Bacteria | 11459 |
| 4 | Ga0466720_067705 | 3300042607 | Bacteria | 18756 |
| 5 | Ga0466691_027868 | 3300042593 | Bacteria | 6651 |
| 6 | Ga0466695_054104 | 3300042595 | Bacteria | 12771 |
| 7 | Ga0466699_181307 | 3300042597 | Bacteria | 1974 |
| 8 | JGI24702J35022_10074318 | 3300002462 | Bacteria | 1834 |
| 9 | Ga0068305_10203592 | 3300005083 | Bacteria | 20045 |
| 10 | Ga0466705_434088 | 3300042612 | Bacteria | 7916 |
| 11 | Ga0466705_498899 | 3300042612 | Bacteria | 3943 |
| 12 | Ga0466715_427135 | 3300042616 | Bacteria | 5029 |
| 13 | Ga0466723_061750 | 3300042618 | Bacteria | 30747 |
| 14 | Ga0466728_243678 | 3300042620 | Bacteria | 1315 |
| 15 | Ga0466728_457683 | 3300042620 | Bacteria | 1552 |
| 16 | Ga0466704_189406 | 3300042643 | Bacteria | 2134 |
| 17 | Ga0466727_027368 | 3300042655 | Bacteria | 9336 |
| 18 | Ga0466705_039749 | 3300042612 | Bacteria | 30204 |
| 19 | Ga0466732_102542 | 3300042656 | Bacteria | 4038 |
| 20 | Ga0466690_232630 | 3300042590 | Unclassified | 5858 |
| 21 | Ga0466696_123772 | 3300042596 | Bacteria | 21222 |
| 22 | Ga0123353_10289105 | 3300010167 | Bacteria | 2511 |
| 23 | JGI24698J34947_10003389 | 3300002449 | Bacteria | 8652 |
| 24 | Ga0466712_007559 | 3300042614 | Bacteria | 17080 |
| 25 | Ga0466726_174006 | 3300042619 | Bacteria | 13818 |
| 26 | Ga0466708_179612 | 3300042652 | Bacteria | 7198 |
| 27 | Ga0466727_238372 | 3300042655 | Bacteria | 3025 |
| 28 | Ga0466705_377581 | 3300042612 | Bacteria | 3188 |
| 29 | Ga0466699_289983 | 3300042597 | Bacteria | 1913 |
| 30 | Ga0123353_10154303 | 3300010167 | Unclassified | 3663 |
| 31 | Ga0068305_10091520 | 3300005083 | Bacteria | 1549 |
| 32 | Ga0466712_158350 | 3300042614 | Bacteria | 6687 |
| 33 | Ga0466711_160759 | 3300042615 | Bacteria | 26057 |
| 34 | Ga0466711_278249 | 3300042615 | Bacteria | 30666 |
| 35 | Ga0466735_042810 | 3300042624 | Bacteria | 4452 |
| 36 | Ga0466704_377238 | 3300042643 | Bacteria | 6659 |
| 37 | Ga0466705_099239 | 3300042612 | Unclassified | 2351 |
| 38 | Ga0466713_138385 | 3300042602 | Bacteria | 336961 |
| 39 | Ga0466720_012868 | 3300042607 | Bacteria | 4914 |
| 40 | Ga0466720_200411 | 3300042607 | Bacteria | 2755 |
| 41 | Ga0466691_076223 | 3300042593 | Bacteria | 5896 |
| 42 | Ga0466696_050823 | 3300042596 | Bacteria | 14659 |
| 43 | Ga0466696_146770 | 3300042596 | Bacteria | 3380 |
| 44 | Ga0466699_035306 | 3300042597 | Bacteria | 10945 |
| 45 | Ga0466699_126849 | 3300042597 | Bacteria | 15271 |
| 46 | Ga0466699_160528 | 3300042597 | Bacteria | 1265 |
| 47 | Ga0123354_10011674 | 3300010882 | Bacteria | 13597 |
| 48 | JGI24698J34947_10001309 | 3300002449 | Bacteria | 13066 |
| 49 | Ga0466715_427744 | 3300042616 | Bacteria | 31942 |
| 50 | Ga0466718_170529 | 3300042617 | Unclassified | 1027 |
| 51 | Ga0466723_022003 | 3300042618 | Bacteria | 18279 |
| 52 | Ga0466723_195461 | 3300042618 | Bacteria | 56859 |
| 53 | Ga0466726_227479 | 3300042619 | Bacteria | 6610 |
| 54 | Ga0466728_047995 | 3300042620 | Bacteria | 6919 |
| 55 | Ga0466703_414316 | 3300042636 | Bacteria | 6122 |
| 56 | Ga0466704_545342 | 3300042643 | Bacteria | 14429 |
| 57 | Ga0466709_018700 | 3300042648 | Unclassified | 4913 |
| 58 | Ga0466708_023530 | 3300042652 | Bacteria | 1311 |
| 59 | Ga0466708_081607 | 3300042652 | Bacteria | 2286 |
| 60 | Ga0466705_037219 | 3300042612 | Unclassified | 2252 |
| 61 | Ga0466707_167748 | 3300042601 | Bacteria | 2079 |
| 62 | Ga0466713_130567 | 3300042602 | Bacteria | 13992 |
| 63 | Ga0466690_094819 | 3300042590 | Bacteria | 5494 |
| 64 | Ga0466693_115825 | 3300042592 | Bacteria | 2929 |
| 65 | Ga0466691_049078 | 3300042593 | Unclassified | 9467 |
| 66 | Ga0466696_501510 | 3300042596 | Bacteria | 7194 |
| 67 | Ga0466710_127126 | 3300042613 | Bacteria | 2470 |
| 68 | Ga0466712_281832 | 3300042614 | Bacteria | 1018 |
| 69 | Ga0466711_238027 | 3300042615 | Bacteria | 1184 |
| 70 | Ga0466711_271863 | 3300042615 | Bacteria | 5987 |
| 71 | Ga0466711_314542 | 3300042615 | Bacteria | 2084 |
| 72 | Ga0466718_028513 | 3300042617 | Bacteria | 21285 |
| 73 | Ga0466718_065357 | 3300042617 | Bacteria | 4698 |
| 74 | Ga0466718_124745 | 3300042617 | Bacteria | 7073 |
| 75 | Ga0466718_141085 | 3300042617 | Bacteria | 8364 |
| 76 | Ga0466726_047305 | 3300042619 | Bacteria | 3628 |
| 77 | Ga0466728_365309 | 3300042620 | Unclassified | 1903 |
| 78 | Ga0466729_040068 | 3300042621 | Bacteria | 4473 |
| 79 | Ga0466703_063180 | 3300042636 | Bacteria | 20066 |
| 80 | Ga0466704_175905 | 3300042643 | Bacteria | 11494 |
| 81 | Ga0466704_225379 | 3300042643 | Bacteria | 1573 |
| 82 | Ga0466709_144100 | 3300042648 | Bacteria | 6135 |
| 83 | Ga0466708_100861 | 3300042652 | Bacteria | 4478 |
| 84 | Ga0466727_311678 | 3300042655 | Bacteria | 2084 |
| 85 | Ga0466707_211213 | 3300042601 | Bacteria | 4146 |
| 86 | Ga0466690_106800 | 3300042590 | Bacteria | 1742 |
| 87 | Ga0466692_171620 | 3300042591 | Bacteria | 5713 |
| 88 | Ga0466699_208206 | 3300042597 | Bacteria | 4950 |
| 89 | Ga0123353_10073857 | 3300010167 | Bacteria | 5482 |
| 90 | JGI24698J34947_10000951 | 3300002449 | Unclassified | 14737 |
| 91 | JGI24702J35022_10000009 | 3300002462 | Bacteria | 81427 |
| 92 | Ga0466712_076363 | 3300042614 | Bacteria | 19984 |
| 93 | Ga0466712_112999 | 3300042614 | Bacteria | 56841 |
| 94 | Ga0466712_231266 | 3300042614 | Unclassified | 8263 |
| 95 | Ga0466715_156525 | 3300042616 | Bacteria | 8876 |
| 96 | Ga0466723_259585 | 3300042618 | Bacteria | 4671 |
| 97 | Ga0466723_354240 | 3300042618 | Bacteria | 10659 |
| 98 | Ga0466729_116638 | 3300042621 | Unclassified | 2004 |
| 99 | Ga0466735_065511 | 3300042624 | Bacteria | 9261 |
| 100 | Ga0466703_213048 | 3300042636 | Unclassified | 11285 |
| 101 | Ga0466705_105866 | 3300042612 | Bacteria | 5294 |
| 102 | Ga0466705_356902 | 3300042612 | Bacteria | 10254 |
| 103 | Ga0466716_115153 | 3300042605 | Bacteria | 5560 |
| 104 | Ga0466720_100304 | 3300042607 | Bacteria | 1442 |
| 105 | Ga0264413_105118 | 3300024493 | Bacteria | 8717 |
| 106 | Ga0466699_130336 | 3300042597 | Bacteria | 7473 |
| 107 | JGI24698J34947_10002658 | 3300002449 | Bacteria | 9636 |
| 108 | JGI24698J34947_10003994 | 3300002449 | Bacteria | 8025 |
| 109 | Ga0072941_1425917 | 3300005201 | Bacteria | 1342 |
| 110 | Ga0466712_281314 | 3300042614 | Bacteria | 7052 |
| 111 | Ga0466711_043548 | 3300042615 | Bacteria | 3005 |
| 112 | Ga0466718_025507 | 3300042617 | Bacteria | 27042 |
| 113 | Ga0466718_120652 | 3300042617 | Bacteria | 11624 |
| 114 | Ga0466723_048299 | 3300042618 | Bacteria | 5207 |
| 115 | Ga0466703_382179 | 3300042636 | Bacteria | 10644 |
| 116 | Ga0466704_413754 | 3300042643 | Bacteria | 3053 |
| 117 | Ga0466708_228889 | 3300042652 | Bacteria | 2986 |
| 118 | Ga0466707_016519 | 3300042601 | Bacteria | 20976 |
| 119 | Ga0466707_050297 | 3300042601 | Bacteria | 3571 |
| 120 | Ga0466720_109497 | 3300042607 | Bacteria | 28074 |
| 121 | Ga0466691_030900 | 3300042593 | Bacteria | 6532 |
| 122 | Ga0466691_202049 | 3300042593 | Bacteria | 5462 |
| 123 | Ga0123353_10004974 | 3300010167 | Bacteria | 17315 |
| 124 | JGI24696J40584_12957454 | 3300002834 | Bacteria | 3522 |
| 125 | Ga0466718_124135 | 3300042617 | Bacteria | 2216 |
| 126 | Ga0466726_108933 | 3300042619 | Bacteria | 6274 |
| 127 | Ga0466726_407997 | 3300042619 | Bacteria | 4564 |
| 128 | Ga0466729_072262 | 3300042621 | Bacteria | 1948 |
| 129 | Ga0466729_302148 | 3300042621 | Bacteria | 2074 |
| 130 | Ga0466703_034993 | 3300042636 | Bacteria | 12051 |
| 131 | Ga0466703_147002 | 3300042636 | Bacteria | 25312 |
| 132 | Ga0466704_228543 | 3300042643 | Bacteria | 21203 |
| 133 | Ga0466709_017629 | 3300042648 | Bacteria | 12397 |
| 134 | Ga0466708_289217 | 3300042652 | Bacteria | 6913 |
| 135 | Ga0466727_192509 | 3300042655 | Bacteria | 2670 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02608 | Bmp | ABC transporter substrate-binding protein PnrA-like | 73 | 238 | 0.93 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02608 | GO:0005886 | plasma membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.