Protein Family IF11841
Metagenome
Isolate
240
Members
51
Samples
234
Scaffolds
339.57
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125692|2781432375|
- Length
- 387 aa
- Sequence
- VPGTVCIDFYGEKRYYSPMFGIFNQTVSIRTVLTLTGGLFFGILFGLFLPLLVSARSERVVAYEEVAARSAVEDAARIAMEYGVDSPEYGLAYEILPGVEKYDGPGFAQSMPIDSKEAWLSWMRTNNRTDLPVFMEERWFLAKLLVDTGELKRPEDVQAFLLTPREHFVRARNRGYEYADTWLPIGWGATITDPDVVSMMTTTLAVQPGEKVLEIGTGSGYQSAILSYLTPEVYTIEIIKPLFIETDQLYRDLEKSFPSYGSINRKLGDGYYGWEKYAPFEKIIVTCSIDHIPPPLLKQLKPGGIMVLPLGPPGRQYIMEIKKEEAEDGMITLSRRDVYNGLRVSFIPFRDETGHSYSTSEPEPRVTLPVPEAPPPRRYEQEEENEN
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.9%
Kalotermitidae
28.6%
Unclassified
14.3%
Termopsidae
8.2%
Rhinotermitidae
6.1%
Taxonomy
Archaea
0
Bacteria
189
Eukaryota
0
Viruses
0
Unclassified
51
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2228664001 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA | Metagenome | Termitidae |
| 14 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 15 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 23 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 24 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 25 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 26 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 35 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 36 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 37 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 40 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 41 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 42 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 43 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 44 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 45 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 46 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 47 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 48 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 49 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 50 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_445522 | 3300042600 | Bacteria | 8431 |
| 2 | Ga0466707_139539 | 3300042601 | Unclassified | 1896 |
| 3 | Ga0466719_143966 | 3300042606 | Bacteria | 10992 |
| 4 | Ga0415639_027879 | 3300038395 | Bacteria | 7615 |
| 5 | Ga0466692_088542 | 3300042591 | Unclassified | 6977 |
| 6 | Ga0466691_020658 | 3300042593 | Unclassified | 1323 |
| 7 | Ga0466691_127745 | 3300042593 | Bacteria | 4521 |
| 8 | Ga0466695_132722 | 3300042595 | Bacteria | 66949 |
| 9 | Ga0466699_135306 | 3300042597 | Bacteria | 2054 |
| 10 | 2230930191 | 2228664001 | Unclassified | 2281 |
| 11 | JGI24698J34947_10002531 | 3300002449 | Bacteria | 9862 |
| 12 | JGI24698J34947_10008304 | 3300002449 | Bacteria | 5694 |
| 13 | JGI24698J34947_10019265 | 3300002449 | Bacteria | 3684 |
| 14 | JGI24698J34947_10019763 | 3300002449 | Unclassified | 3629 |
| 15 | JGI24698J34947_10030337 | 3300002449 | Unclassified | 2852 |
| 16 | JGI24698J34947_10086535 | 3300002449 | Unclassified | 1452 |
| 17 | JGI24702J35022_10000897 | 3300002462 | Bacteria | 18517 |
| 18 | Ga0072941_1008132 | 3300005201 | Bacteria | 7755 |
| 19 | Ga0466731_185912 | 3300042622 | Bacteria | 1620 |
| 20 | Ga0466702_427098 | 3300042635 | Bacteria | 4232 |
| 21 | Ga0466709_054560 | 3300042648 | Bacteria | 23103 |
| 22 | Ga0466711_241019 | 3300042615 | Bacteria | 5822 |
| 23 | Ga0466711_457306 | 3300042615 | Bacteria | 1803 |
| 24 | Ga0466715_178825 | 3300042616 | Bacteria | 6646 |
| 25 | Ga0466715_286092 | 3300042616 | Bacteria | 15118 |
| 26 | Ga0466718_021842 | 3300042617 | Bacteria | 5421 |
| 27 | Ga0466718_058409 | 3300042617 | Bacteria | 28002 |
| 28 | Ga0466718_067874 | 3300042617 | Bacteria | 57908 |
| 29 | Ga0466726_042769 | 3300042619 | Bacteria | 28047 |
| 30 | Ga0466732_015957 | 3300042656 | Bacteria | 7802 |
| 31 | Ga0466716_514574 | 3300042605 | Bacteria | 2491 |
| 32 | Ga0466720_141456 | 3300042607 | Unclassified | 5923 |
| 33 | Ga0466722_097602 | 3300042609 | Bacteria | 9590 |
| 34 | Ga0264413_105285 | 3300024493 | Bacteria | 17894 |
| 35 | Ga0264413_106267 | 3300024493 | Unclassified | 5217 |
| 36 | Ga0264413_111659 | 3300024493 | Unclassified | 4118 |
| 37 | Ga0466692_098501 | 3300042591 | Bacteria | 2763 |
| 38 | Ga0466696_002478 | 3300042596 | Bacteria | 2137 |
| 39 | Ga0466696_099376 | 3300042596 | Bacteria | 8398 |
| 40 | Ga0466699_059839 | 3300042597 | Bacteria | 5732 |
| 41 | JGI24698J34947_10006982 | 3300002449 | Bacteria | 6207 |
| 42 | JGI24698J34947_10012140 | 3300002449 | Bacteria | 4728 |
| 43 | JGI24702J35022_10001293 | 3300002462 | Bacteria | 15581 |
| 44 | Ga0072941_1073945 | 3300005201 | Bacteria | 3310 |
| 45 | Ga0466705_067993 | 3300042612 | Bacteria | 6191 |
| 46 | Ga0466703_227084 | 3300042636 | Bacteria | 2155 |
| 47 | Ga0466704_245167 | 3300042643 | Bacteria | 2121 |
| 48 | Ga0466727_021330 | 3300042655 | Bacteria | 2687 |
| 49 | Ga0466727_312926 | 3300042655 | Bacteria | 3560 |
| 50 | Ga0466723_143124 | 3300042618 | Unclassified | 2158 |
| 51 | Ga0123354_10077890 | 3300010882 | Unclassified | 4717 |
| 52 | Ga0466720_003577 | 3300042607 | Unclassified | 1572 |
| 53 | Ga0466720_029011 | 3300042607 | Bacteria | 19425 |
| 54 | Ga0466692_176633 | 3300042591 | Bacteria | 2642 |
| 55 | Ga0466691_070181 | 3300042593 | Bacteria | 3451 |
| 56 | Ga0466691_086075 | 3300042593 | Bacteria | 2819 |
| 57 | AustNasuHG_c1002827 | 3300000089 | Bacteria | 6269 |
| 58 | JGI24698J34947_10002770 | 3300002449 | Bacteria | 9487 |
| 59 | JGI24698J34947_10004129 | 3300002449 | Bacteria | 7877 |
| 60 | JGI24697J35500_11269152 | 3300002507 | Unclassified | 3932 |
| 61 | Ga0466705_086011 | 3300042612 | Bacteria | 10166 |
| 62 | Ga0466703_139779 | 3300042636 | Bacteria | 5267 |
| 63 | Ga0466704_015156 | 3300042643 | Bacteria | 7285 |
| 64 | Ga0466704_059111 | 3300042643 | Bacteria | 12430 |
| 65 | Ga0466704_445889 | 3300042643 | Unclassified | 2059 |
| 66 | Ga0466709_021976 | 3300042648 | Bacteria | 11956 |
| 67 | Ga0466708_140634 | 3300042652 | Bacteria | 4276 |
| 68 | Ga0466708_178435 | 3300042652 | Bacteria | 6201 |
| 69 | Ga0466712_039240 | 3300042614 | Bacteria | 23177 |
| 70 | Ga0466712_062734 | 3300042614 | Bacteria | 7499 |
| 71 | Ga0466711_093741 | 3300042615 | Bacteria | 8917 |
| 72 | Ga0466711_206902 | 3300042615 | Unclassified | 1708 |
| 73 | Ga0466715_324416 | 3300042616 | Bacteria | 2463 |
| 74 | Ga0466718_032345 | 3300042617 | Unclassified | 5264 |
| 75 | Ga0466718_061746 | 3300042617 | Unclassified | 3884 |
| 76 | Ga0466723_092733 | 3300042618 | Unclassified | 1299 |
| 77 | Ga0466723_155823 | 3300042618 | Bacteria | 4493 |
| 78 | Ga0466728_065051 | 3300042620 | Bacteria | 2473 |
| 79 | Ga0466728_071486 | 3300042620 | Bacteria | 2424 |
| 80 | Ga0466716_139063 | 3300042605 | Bacteria | 4063 |
| 81 | Ga0466716_264574 | 3300042605 | Bacteria | 6495 |
| 82 | Ga0466716_467044 | 3300042605 | Bacteria | 1304 |
| 83 | Ga0466719_392989 | 3300042606 | Bacteria | 15487 |
| 84 | Ga0466722_022426 | 3300042609 | Bacteria | 3939 |
| 85 | Ga0466722_056317 | 3300042609 | Bacteria | 5627 |
| 86 | Ga0466722_194194 | 3300042609 | Bacteria | 4015 |
| 87 | Ga0466722_207955 | 3300042609 | Bacteria | 7413 |
| 88 | Ga0466690_078031 | 3300042590 | Unclassified | 4351 |
| 89 | Ga0466690_280362 | 3300042590 | Bacteria | 1778 |
| 90 | Ga0466691_220868 | 3300042593 | Unclassified | 3947 |
| 91 | Ga0466699_142262 | 3300042597 | Bacteria | 4328 |
| 92 | Ga0466699_165217 | 3300042597 | Bacteria | 13505 |
| 93 | AustNasuHG_c1000005 | 3300000089 | Bacteria | 56942 |
| 94 | AustNasuHG_c1007555 | 3300000089 | Unclassified | 3859 |
| 95 | JGI24698J34947_10015956 | 3300002449 | Bacteria | 4084 |
| 96 | JGI24698J34947_10094554 | 3300002449 | Unclassified | 1361 |
| 97 | Ga0072941_1001195 | 3300005201 | Unclassified | 6985 |
| 98 | Ga0072941_1002310 | 3300005201 | Bacteria | 31707 |
| 99 | Ga0072941_1089288 | 3300005201 | Unclassified | 3683 |
| 100 | Ga0466705_044686 | 3300042612 | Bacteria | 4458 |
| 101 | Ga0466702_063047 | 3300042635 | Bacteria | 15583 |
| 102 | Ga0466703_048359 | 3300042636 | Bacteria | 10841 |
| 103 | Ga0466708_148537 | 3300042652 | Bacteria | 4334 |
| 104 | Ga0466708_334914 | 3300042652 | Bacteria | 2185 |
| 105 | Ga0466727_061278 | 3300042655 | Bacteria | 12202 |
| 106 | Ga0466712_057870 | 3300042614 | Bacteria | 16713 |
| 107 | Ga0466711_082348 | 3300042615 | Bacteria | 22981 |
| 108 | Ga0466711_474057 | 3300042615 | Bacteria | 1762 |
| 109 | Ga0466715_058967 | 3300042616 | Bacteria | 14222 |
| 110 | Ga0466723_164488 | 3300042618 | Bacteria | 5015 |
| 111 | Ga0466707_191071 | 3300042601 | Bacteria | 1160 |
| 112 | Ga0466719_543688 | 3300042606 | Unclassified | 2377 |
| 113 | Ga0466720_007679 | 3300042607 | Bacteria | 5737 |
| 114 | Ga0466720_081765 | 3300042607 | Bacteria | 1855 |
| 115 | Ga0466720_090368 | 3300042607 | Bacteria | 39301 |
| 116 | Ga0466720_150005 | 3300042607 | Unclassified | 2213 |
| 117 | Ga0466720_166274 | 3300042607 | Bacteria | 16068 |
| 118 | Ga0264413_106509 | 3300024493 | Unclassified | 5709 |
| 119 | Ga0264413_110446 | 3300024493 | Unclassified | 7652 |
| 120 | Ga0466690_061378 | 3300042590 | Bacteria | 6407 |
| 121 | Ga0466696_146278 | 3300042596 | Bacteria | 14080 |
| 122 | Ga0466696_327345 | 3300042596 | Bacteria | 11315 |
| 123 | Ga0466699_184440 | 3300042597 | Unclassified | 3391 |
| 124 | Ga0466699_191907 | 3300042597 | Bacteria | 2579 |
| 125 | Ga0466699_353439 | 3300042597 | Bacteria | 2238 |
| 126 | JGI24698J34947_10001809 | 3300002449 | Bacteria | 11411 |
| 127 | JGI24695J34938_10000034 | 3300002450 | Bacteria | 102252 |
| 128 | Ga0072941_1013942 | 3300005201 | Bacteria | 5868 |
| 129 | Ga0466705_218237 | 3300042612 | Unclassified | 5799 |
| 130 | Ga0466735_130759 | 3300042624 | Bacteria | 2506 |
| 131 | Ga0466703_028993 | 3300042636 | Bacteria | 4486 |
| 132 | Ga0466703_062323 | 3300042636 | Bacteria | 7954 |
| 133 | Ga0466703_086045 | 3300042636 | Bacteria | 10791 |
| 134 | Ga0466703_212840 | 3300042636 | Unclassified | 1714 |
| 135 | Ga0466703_252760 | 3300042636 | Unclassified | 1414 |
| 136 | Ga0466704_033321 | 3300042643 | Bacteria | 22698 |
| 137 | Ga0466704_135516 | 3300042643 | Bacteria | 50760 |
| 138 | Ga0466704_396064 | 3300042643 | Bacteria | 2522 |
| 139 | Ga0466704_439686 | 3300042643 | Bacteria | 95559 |
| 140 | Ga0466709_154583 | 3300042648 | Bacteria | 11901 |
| 141 | Ga0466708_220512 | 3300042652 | Unclassified | 8840 |
| 142 | Ga0466708_228778 | 3300042652 | Bacteria | 2394 |
| 143 | Ga0466712_102427 | 3300042614 | Bacteria | 19651 |
| 144 | Ga0466712_102721 | 3300042614 | Bacteria | 5048 |
| 145 | Ga0466712_274476 | 3300042614 | Bacteria | 13549 |
| 146 | Ga0466711_158052 | 3300042615 | Bacteria | 5716 |
| 147 | Ga0466715_166926 | 3300042616 | Bacteria | 2379 |
| 148 | Ga0466715_265740 | 3300042616 | Bacteria | 4812 |
| 149 | Ga0466715_386205 | 3300042616 | Unclassified | 6034 |
| 150 | Ga0466718_000921 | 3300042617 | Bacteria | 4184 |
| 151 | Ga0466718_029235 | 3300042617 | Bacteria | 16302 |
| 152 | Ga0466723_051294 | 3300042618 | Bacteria | 2641 |
| 153 | Ga0466728_160630 | 3300042620 | Bacteria | 8679 |
| 154 | Ga0123357_10014148 | 3300009784 | Bacteria | 10399 |
| 155 | Ga0466707_319089 | 3300042601 | Bacteria | 7238 |
| 156 | Ga0466719_409339 | 3300042606 | Bacteria | 6206 |
| 157 | Ga0466722_110078 | 3300042609 | Bacteria | 4082 |
| 158 | Ga0466722_130470 | 3300042609 | Unclassified | 1541 |
| 159 | Ga0466690_265368 | 3300042590 | Bacteria | 5509 |
| 160 | Ga0466694_087070 | 3300042594 | Bacteria | 7698 |
| 161 | Ga0466696_203102 | 3300042596 | Bacteria | 7042 |
| 162 | JGI24698J34947_10007437 | 3300002449 | Bacteria | 6021 |
| 163 | JGI24698J34947_10008194 | 3300002449 | Bacteria | 5731 |
| 164 | JGI24698J34947_10014949 | 3300002449 | Unclassified | 4226 |
| 165 | JGI24698J34947_10078324 | 3300002449 | Unclassified | 1560 |
| 166 | Ga0072941_1001733 | 3300005201 | Bacteria | 27546 |
| 167 | Ga0466705_021693 | 3300042612 | Unclassified | 4732 |
| 168 | Ga0466704_169870 | 3300042643 | Bacteria | 5586 |
| 169 | Ga0466712_051240 | 3300042614 | Bacteria | 13922 |
| 170 | Ga0466712_066859 | 3300042614 | Bacteria | 17566 |
| 171 | Ga0466712_096882 | 3300042614 | Bacteria | 42313 |
| 172 | Ga0466712_137945 | 3300042614 | Bacteria | 4884 |
| 173 | Ga0466712_316877 | 3300042614 | Bacteria | 7811 |
| 174 | Ga0466715_144273 | 3300042616 | Unclassified | 3463 |
| 175 | Ga0466718_022948 | 3300042617 | Bacteria | 5861 |
| 176 | Ga0466723_054295 | 3300042618 | Unclassified | 3801 |
| 177 | Ga0466728_112664 | 3300042620 | Bacteria | 1559 |
| 178 | Ga0123356_10182496 | 3300010049 | Bacteria | 2122 |
| 179 | Ga0466720_021273 | 3300042607 | Bacteria | 41620 |
| 180 | Ga0466720_029249 | 3300042607 | Bacteria | 17062 |
| 181 | Ga0466720_039534 | 3300042607 | Bacteria | 41363 |
| 182 | Ga0466722_131895 | 3300042609 | Bacteria | 2619 |
| 183 | Ga0466722_199887 | 3300042609 | Unclassified | 1355 |
| 184 | Ga0466690_013462 | 3300042590 | Bacteria | 2600 |
| 185 | Ga0466690_050356 | 3300042590 | Bacteria | 26222 |
| 186 | Ga0466694_276276 | 3300042594 | Bacteria | 4418 |
| 187 | Ga0466696_391155 | 3300042596 | Unclassified | 4005 |
| 188 | AustNasuHG_c1000418 | 3300000089 | Bacteria | 14754 |
| 189 | JGI24698J34947_10007170 | 3300002449 | Bacteria | 6127 |
| 190 | JGI24698J34947_10066177 | 3300002449 | Unclassified | 1759 |
| 191 | Ga0068302_10191926 | 3300005071 | Bacteria | 2208 |
| 192 | Ga0072941_1034596 | 3300005201 | Bacteria | 7894 |
| 193 | Ga0466705_141427 | 3300042612 | Bacteria | 6337 |
| 194 | Ga0466705_204627 | 3300042612 | Bacteria | 8088 |
| 195 | Ga0466705_227764 | 3300042612 | Bacteria | 3537 |
| 196 | Ga0466703_213291 | 3300042636 | Bacteria | 34230 |
| 197 | Ga0466703_324964 | 3300042636 | Unclassified | 2152 |
| 198 | Ga0466704_013561 | 3300042643 | Bacteria | 8336 |
| 199 | Ga0466704_204522 | 3300042643 | Bacteria | 12543 |
| 200 | Ga0466709_119458 | 3300042648 | Bacteria | 1116 |
| 201 | Ga0466708_028115 | 3300042652 | Bacteria | 4030 |
| 202 | Ga0466708_152614 | 3300042652 | Bacteria | 2938 |
| 203 | Ga0466727_275821 | 3300042655 | Bacteria | 2237 |
| 204 | Ga0466718_000081 | 3300042617 | Bacteria | 10426 |
| 205 | Ga0466718_136874 | 3300042617 | Bacteria | 21083 |
| 206 | Ga0466718_148910 | 3300042617 | Bacteria | 34374 |
| 207 | Ga0466728_049414 | 3300042620 | Bacteria | 5664 |
| 208 | Ga0466729_108414 | 3300042621 | Bacteria | 1497 |
| 209 | Ga0466732_240048 | 3300042656 | Bacteria | 7351 |
| 210 | Ga0466719_187617 | 3300042606 | Unclassified | 4070 |
| 211 | Ga0466719_281352 | 3300042606 | Bacteria | 2385 |
| 212 | Ga0466720_022987 | 3300042607 | Bacteria | 5492 |
| 213 | Ga0466722_131371 | 3300042609 | Bacteria | 1370 |
| 214 | Ga0466698_190431 | 3300042610 | Unclassified | 1426 |
| 215 | Ga0466690_175976 | 3300042590 | Bacteria | 6456 |
| 216 | Ga0466691_027698 | 3300042593 | Bacteria | 8246 |
| 217 | Ga0466691_108767 | 3300042593 | Bacteria | 7556 |
| 218 | Ga0466694_191635 | 3300042594 | Unclassified | 3904 |
| 219 | JGI24698J34947_10002773 | 3300002449 | Bacteria | 9485 |
| 220 | JGI24698J34947_10010063 | 3300002449 | Unclassified | 5181 |
| 221 | Ga0072941_1065832 | 3300005201 | Bacteria | 7968 |
| 222 | Ga0466705_256950 | 3300042612 | Bacteria | 10527 |
| 223 | Ga0466703_030799 | 3300042636 | Bacteria | 2500 |
| 224 | Ga0466704_269250 | 3300042643 | Bacteria | 2125 |
| 225 | Ga0466727_178172 | 3300042655 | Bacteria | 11964 |
| 226 | Ga0466712_023119 | 3300042614 | Bacteria | 6894 |
| 227 | Ga0466712_152932 | 3300042614 | Bacteria | 25376 |
| 228 | Ga0466715_163780 | 3300042616 | Bacteria | 7895 |
| 229 | Ga0466715_232838 | 3300042616 | Bacteria | 12505 |
| 230 | Ga0466715_480121 | 3300042616 | Unclassified | 1288 |
| 231 | Ga0466723_217201 | 3300042618 | Bacteria | 7977 |
| 232 | Ga0466726_139023 | 3300042619 | Bacteria | 48573 |
| 233 | Ga0466728_089413 | 3300042620 | Bacteria | 5231 |
| 234 | Ga0466728_284965 | 3300042620 | Unclassified | 1199 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01135 | PCMT | Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) | 146 | 328 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.