Protein Family IF11822

Metagenome Isolate
111 Members
30 Samples
103 Scaffolds
235.17 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125685|2781417586|
Length
255 aa
Sequence
MLDWGNAARLSGPPTVGTAARLMEEKMKQFVVALCLLSAAFRVGASGIRDDIDITGEKARASYAIGMTVGMDLRESGLDMDFAAFVRGFVSAMQDGEEGLIMDGMEAMELVRAAFDLAAERQTQEFRLREELFLAANADLEGMHSTESGLQYMVLVPGDGGTPSAESTVLVHYEGMLTDGTVFDSSRERGFPETIPLDMVIPGWAEAIQLMRVGGTCRFFIPSHLAYGPQGAGQVIPPYSTLVFTIELLDIVTEE

📊 Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.6%
Unclassified 28.6%
Rhinotermitidae 7.1%
Termopsidae 7.1%
Kalotermitidae 3.6%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
2 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
3 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
4 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
9 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
10 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
14 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
15 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
16 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
19 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
20 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
21 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
22 2781125633 Treponema sp. Co191P1bin38 Isolate Unclassified
23 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
24 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
27 2781125695 Treponema sp. Th196P4bin30 Isolate Unclassified
28 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
29 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
30 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466699_310459 3300042597 Bacteria 1032
2 JGI24698J34947_10025036 3300002449 Bacteria 3179
3 JGI24698J34947_10037951 3300002449 Bacteria 2500
4 JGI24695J34938_10000935 3300002450 Bacteria 26639
5 JGI24695J34938_10002772 3300002450 Bacteria 12851
6 JGI24695J34938_10009569 3300002450 Bacteria 5380
7 JGI24695J34938_10034171 3300002450 Bacteria 2334
8 Ga0072941_1031884 3300005201 Bacteria 3627
9 Ga0466720_042545 3300042607 Bacteria 1428
10 Ga0466720_080512 3300042607 Bacteria 26691
11 Ga0466726_234178 3300042619 Bacteria 12280
12 Ga0466699_045577 3300042597 Bacteria 2888
13 Ga0466699_330628 3300042597 Bacteria 1231
14 AustNasuHG_c1006248 3300000089 Bacteria 4256
15 JGI24698J34947_10026642 3300002449 Bacteria 3071
16 JGI24702J35022_10025481 3300002462 Bacteria 3191
17 Ga0072940_1018711 3300005200 Bacteria 2676
18 Ga0466727_250275 3300042655 Bacteria 1410
19 Ga0466720_012019 3300042607 Bacteria 6614
20 Ga0466712_091151 3300042614 Bacteria 8785
21 Ga0466712_161896 3300042614 Bacteria 1115
22 Ga0466712_285453 3300042614 Bacteria 11443
23 Ga0466718_085672 3300042617 Bacteria 17769
24 Ga0466718_094804 3300042617 Bacteria 21367
25 Ga0466699_150103 3300042597 Bacteria 2037
26 Ga0466699_150342 3300042597 Bacteria 2145
27 AustNasuHG_c1005698 3300000089 Bacteria 4453
28 JGI24698J34947_10051651 3300002449 Bacteria 2066
29 JGI24695J34938_10003171 3300002450 Bacteria 11685
30 JGI24695J34938_10008115 3300002450 Bacteria 6041
31 JGI24695J34938_10052253 3300002450 Bacteria 1783
32 Ga0072940_1004972 3300005200 Bacteria 3257
33 Ga0466720_126501 3300042607 Bacteria 11592
34 Ga0466720_215238 3300042607 Bacteria 1231
35 Ga0466698_466878 3300042610 Bacteria 2717
36 Ga0466726_055570 3300042619 Bacteria 16834
37 Ga0466732_319730 3300042656 Bacteria 7167
38 Ga0264413_126360 3300024493 Bacteria 1411
39 Ga0264413_133057 3300024493 Bacteria 1797
40 JGI24698J34947_10008402 3300002449 Bacteria 5667
41 JGI24695J34938_10003906 3300002450 Unclassified 10080
42 JGI24699J35502_11133077 3300002509 Unclassified 8549
43 Ga0072940_1175847 3300005200 Bacteria 2162
44 Ga0072941_1076431 3300005201 Bacteria 3526
45 Ga0466720_123923 3300042607 Bacteria 34590
46 Ga0466698_412995 3300042610 Bacteria 1042
47 Ga0466712_210516 3300042614 Bacteria 5303
48 Ga0466726_431170 3300042619 Bacteria 1981
49 Ga0264413_102135 3300024493 Unclassified 3583
50 Ga0264413_114290 3300024493 Bacteria 10340
51 Ga0466699_018942 3300042597 Bacteria 7215
52 Ga0466699_048115 3300042597 Bacteria 1093
53 Ga0466699_067974 3300042597 Bacteria 1761
54 JGI24695J34938_10001490 3300002450 Bacteria 19756
55 JGI24695J34938_10028995 3300002450 Bacteria 2592
56 Ga0072940_1015286 3300005200 Bacteria 6390
57 Ga0072941_1031883 3300005201 Bacteria 12634
58 Ga0466704_136029 3300042643 Bacteria 3586
59 Ga0466727_215125 3300042655 Bacteria 1408
60 Ga0466720_011986 3300042607 Bacteria 1794
61 Ga0466720_054389 3300042607 Bacteria 1368
62 Ga0466720_211887 3300042607 Bacteria 1479
63 Ga0466722_094748 3300042609 Bacteria 17006
64 Ga0123356_10004321 3300010049 Bacteria 14697
65 Ga0466712_001072 3300042614 Bacteria 2100
66 Ga0466712_011257 3300042614 Bacteria 7025
67 Ga0466712_184834 3300042614 Bacteria 13444
68 Ga0264413_100176 3300024493 Bacteria 11275
69 Ga0466694_118113 3300042594 Bacteria 18792
70 Ga0466699_075930 3300042597 Bacteria 1367
71 Ga0466699_415783 3300042597 Bacteria 2748
72 JGI24698J34947_10049383 3300002449 Bacteria 2126
73 JGI24695J34938_10034871 3300002450 Bacteria 2305
74 Ga0123356_10045157 3300010049 Bacteria 4100
75 Ga0466712_013310 3300042614 Unclassified 2131
76 Ga0466712_127108 3300042614 Bacteria 13157
77 Ga0466726_119668 3300042619 Bacteria 1618
78 Ga0264413_139093 3300024493 Bacteria 1233
79 Ga0466699_297337 3300042597 Bacteria 2383
80 AustNasuHG_c1001065 3300000089 Bacteria 9863
81 JGI24698J34947_10005287 3300002449 Bacteria 7082
82 JGI24698J34947_10019266 3300002449 Bacteria 3684
83 Ga0072940_1018118 3300005200 Bacteria 3590
84 Ga0072940_1152361 3300005200 Bacteria 2088
85 Ga0072941_1012649 3300005201 Bacteria 3128
86 Ga0072941_1191296 3300005201 Bacteria 1795
87 Ga0466720_015742 3300042607 Bacteria 17121
88 Ga0466720_197808 3300042607 Bacteria 34624
89 Ga0466712_144544 3300042614 Bacteria 6307
90 Ga0264413_104176 3300024493 Bacteria 19342
91 Ga0264413_117291 3300024493 Bacteria 4187
92 Ga0466693_154080 3300042592 Bacteria 3012
93 Ga0466699_426911 3300042597 Bacteria 2960
94 JGI24698J34947_10051690 3300002449 Bacteria 2065
95 JGI24698J34947_10056838 3300002449 Bacteria 1944
96 JGI24695J34938_10066923 3300002450 Bacteria 1513
97 JGI24702J35022_10005228 3300002462 Bacteria 7609
98 Ga0072941_1005267 3300005201 Bacteria 15589
99 Ga0072941_1008806 3300005201 Bacteria 2032
100 Ga0072941_1009285 3300005201 Bacteria 25402
101 Ga0466729_218428 3300042621 Bacteria 2576
102 Ga0466720_099773 3300042607 Bacteria 26193
103 Ga0466712_124636 3300042614 Bacteria 2214

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_161896 Ga0466712_161896_25_630 201
2 3300002450 JGI24695J34938_10003171 JGI24695J34938_100031716 204
3 3300042619 Ga0466726_234178 Ga0466726_234178_4353_5102 215
4 3300002449 JGI24698J34947_10051651 JGI24698J34947_100516512 220
5 3300042614 Ga0466712_011257 Ga0466712_011257_1200_1910 221
6 3300042621 Ga0466729_218428 Ga0466729_218428_1702_2409 222
7 3300002450 JGI24695J34938_10000935 JGI24695J34938_1000093523 223
8 3300005200 Ga0072940_1175847 Ga0072940_11758472 223
9 3300042597 Ga0466699_075930 Ga0466699_075930_624_1337 223
10 3300042607 Ga0466720_211887 Ga0466720_211887_693_1412 225
11 3300042597 Ga0466699_310459 Ga0466699_310459_194_874 226
12 3300042614 Ga0466712_091151 Ga0466712_091151_2987_3667 226
13 3300042614 Ga0466712_184834 Ga0466712_184834_10168_10848 226
14 iso_pr_bacteria 2781125695 2781438269 227
15 3300024493 Ga0264413_114290 Ga0264413_1142909 228
16 3300024493 Ga0264413_126360 Ga0264413_1263601 228
17 3300042597 Ga0466699_150342 Ga0466699_150342_306_992 228
18 3300042597 Ga0466699_297337 Ga0466699_297337_136_822 228
19 3300042607 Ga0466720_123923 Ga0466720_123923_26567_27286 228
20 3300042610 Ga0466698_412995 Ga0466698_412995_12_698 228
21 3300024493 Ga0264413_104176 Ga0264413_10417612 229
22 3300042597 Ga0466699_048115 Ga0466699_048115_37_726 229
23 3300042597 Ga0466699_150103 Ga0466699_150103_1247_1936 229
24 3300042597 Ga0466699_330628 Ga0466699_330628_455_1144 229
25 3300042614 Ga0466712_001072 Ga0466712_001072_329_1051 230
26 3300042592 Ga0466693_154080 Ga0466693_154080_1998_2693 231
27 3300002449 JGI24698J34947_10005287 JGI24698J34947_100052874 232
28 3300024493 Ga0264413_102135 Ga0264413_1021353 232
29 3300042597 Ga0466699_067974 Ga0466699_067974_660_1358 232
30 3300042597 Ga0466699_415783 Ga0466699_415783_1630_2328 232
31 3300042607 Ga0466720_015742 Ga0466720_015742_7438_8136 232
32 3300042607 Ga0466720_197808 Ga0466720_197808_24231_24944 232
33 3300042614 Ga0466712_210516 Ga0466712_210516_2169_2933 232
34 3300042655 Ga0466727_215125 Ga0466727_215125_33_731 232
35 iso_pr_bacteria 2781125696 2781441740 232
36 3300002449 JGI24698J34947_10008402 JGI24698J34947_100084023 233
37 3300002449 JGI24698J34947_10056838 JGI24698J34947_100568383 233
38 3300002450 JGI24695J34938_10009569 JGI24695J34938_100095693 233
39 3300002462 JGI24702J35022_10005228 JGI24702J35022_100052283 233
40 3300002462 JGI24702J35022_10025481 JGI24702J35022_100254812 233
41 3300005201 Ga0072941_1191296 Ga0072941_11912961 233
42 3300010049 Ga0123356_10045157 Ga0123356_100451574 233
43 3300024493 Ga0264413_133057 Ga0264413_1330572 233
44 3300042619 Ga0466726_431170 Ga0466726_431170_1244_1945 233
45 3300042643 Ga0466704_136029 Ga0466704_136029_2002_2703 233
46 3300005201 Ga0072941_1008806 Ga0072941_10088062 234
47 3300042610 Ga0466698_466878 Ga0466698_466878_908_1612 234
48 3300042619 Ga0466726_055570 Ga0466726_055570_1311_2015 234
49 3300042619 Ga0466726_119668 Ga0466726_119668_237_941 234
50 3300042655 Ga0466727_250275 Ga0466727_250275_364_1068 234
51 3300042656 Ga0466732_319730 Ga0466732_319730_3064_3768 234
52 iso_pr_bacteria 2781125633 2781272848 234
53 iso_pr_bacteria 2781125640 2781289595 234
54 iso_pr_bacteria 2781125689 2781426486 234
55 3300000089 AustNasuHG_c1001065 AustNasuHG_10010655 235
56 3300002449 JGI24698J34947_10019266 JGI24698J34947_100192663 235
57 3300002449 JGI24698J34947_10026642 JGI24698J34947_100266422 235
58 3300002450 JGI24695J34938_10003906 JGI24695J34938_100039065 235
59 3300002450 JGI24695J34938_10034871 JGI24695J34938_100348713 235
60 3300002509 JGI24699J35502_11133077 JGI24699J35502_111330773 235
61 3300005200 Ga0072940_1152361 Ga0072940_11523613 235
62 3300042597 Ga0466699_045577 Ga0466699_045577_366_1073 235
63 3300042614 Ga0466712_013310 Ga0466712_013310_31_753 235
64 3300000089 AustNasuHG_c1005698 AustNasuHG_10056983 236
65 3300002449 JGI24698J34947_10051690 JGI24698J34947_100516902 236
66 3300002450 JGI24695J34938_10052253 JGI24695J34938_100522531 236
67 3300042607 Ga0466720_099773 Ga0466720_099773_2269_2979 236
68 iso_pr_bacteria 2781125682 2781408792 236
69 3300042597 Ga0466699_426911 Ga0466699_426911_1639_2352 237
70 3300000089 AustNasuHG_c1006248 AustNasuHG_10062482 238
71 3300005201 Ga0072941_1012649 Ga0072941_10126492 239
72 3300005201 Ga0072941_1031883 Ga0072941_10318835 239
73 3300005201 Ga0072941_1031884 Ga0072941_10318843 239
74 3300005201 Ga0072941_1076431 Ga0072941_10764313 239
75 3300042594 Ga0466694_118113 Ga0466694_118113_13377_14120 239
76 3300002450 JGI24695J34938_10002772 JGI24695J34938_100027726 240
77 3300002450 JGI24695J34938_10008115 JGI24695J34938_100081152 240
78 3300002450 JGI24695J34938_10034171 JGI24695J34938_100341713 240
79 3300042614 Ga0466712_124636 Ga0466712_124636_367_1089 240
80 3300042617 Ga0466718_085672 Ga0466718_085672_11916_12638 240
81 3300002449 JGI24698J34947_10025036 JGI24698J34947_100250364 241
82 3300002449 JGI24698J34947_10049383 JGI24698J34947_100493831 241
83 3300005200 Ga0072940_1004972 Ga0072940_10049722 241
84 3300005201 Ga0072941_1009285 Ga0072941_100928512 241
85 3300024493 Ga0264413_117291 Ga0264413_1172912 241
86 3300042607 Ga0466720_012019 Ga0466720_012019_2948_3673 241
87 3300042614 Ga0466712_127108 Ga0466712_127108_1294_2019 241
88 3300002450 JGI24695J34938_10066923 JGI24695J34938_100669232 242
89 3300042597 Ga0466699_018942 Ga0466699_018942_2725_3453 242
90 3300042607 Ga0466720_011986 Ga0466720_011986_10_738 242
91 3300042607 Ga0466720_080512 Ga0466720_080512_2343_3071 242
92 3300042607 Ga0466720_054389 Ga0466720_054389_361_1092 243
93 3300042607 Ga0466720_126501 Ga0466720_126501_1308_2039 243
94 3300010049 Ga0123356_10004321 Ga0123356_1000432115 244
95 3300042607 Ga0466720_042545 Ga0466720_042545_10_744 244
96 3300042609 Ga0466722_094748 Ga0466722_094748_7797_8531 244
97 iso_pr_bacteria 2781125650 2781309004 244
98 3300002450 JGI24695J34938_10001490 JGI24695J34938_1000149010 245
99 3300002450 JGI24695J34938_10028995 JGI24695J34938_100289953 245
100 3300042607 Ga0466720_215238 Ga0466720_215238_150_887 245
101 3300002449 JGI24698J34947_10037951 JGI24698J34947_100379513 246
102 3300005201 Ga0072941_1005267 Ga0072941_10052676 246
103 3300042617 Ga0466718_094804 Ga0466718_094804_1997_2737 246
104 3300005200 Ga0072940_1015286 Ga0072940_10152867 247
105 3300024493 Ga0264413_100176 Ga0264413_1001766 247
106 3300024493 Ga0264413_139093 Ga0264413_1390932 247
107 3300005200 Ga0072940_1018118 Ga0072940_10181184 249
108 3300005200 Ga0072940_1018711 Ga0072940_10187112 249
109 3300042614 Ga0466712_285453 Ga0466712_285453_7618_8370 250
110 3300042614 Ga0466712_144544 Ga0466712_144544_1695_2474 254
111 iso_pr_bacteria 2781125685 2781417586 255

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase 163 249 0.96
PF01346 FKBP_N Domain amino terminal to FKBP-type peptidyl-prolyl isomerase 59 154 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00254 GO:0003755 peptidyl-prolyl cis-trans isomerase activity MF
PF01346 GO:0006457 protein folding BP

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.82 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.