Protein Family IF11773

Metagenome Isolate
122 Members
38 Samples
105 Scaffolds
232.03 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2781125649|2781306294|
Length
258 aa
Sequence
MDYFLADYALAKNNLGRVNMFDKSRQYSYRAQKNQRNKIFVIIFVFFVLYVSYNCLTAFFFSVWVVDNDTMQPGLNKGDRIVFSSFNAPWNGNDEENQTVFKRGNIVLVDMRHYRDKKLPLRIIDGFARFFTAQRISIFRGEGQYYVKRVIGLGGDEVSMNNYGFRVKASGSTYVLTEYELSNRSYLAQIPQVTEQWNESIPFSGNMNAITLGPNECFVASDDRSNTNDSRTWGPISPSLISARAVFRFWPLNRIGLL

πŸ“Š Sample Types

Isolate 13.9%
Metagenome 86.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 47.2%
Termitidae 41.7%
Kalotermitidae 11.1%

🌳 Taxonomy

Archaea 0
Bacteria 118
Eukaryota 0
Viruses 0
Unclassified 4

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
8 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
9 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
10 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
11 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
12 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
13 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
14 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
15 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
16 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
17 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
18 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
19 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
20 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
21 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
22 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
23 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
24 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
27 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
28 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
29 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
30 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
31 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
32 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
33 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
34 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
37 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
38 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466699_015973 3300042597 Bacteria 123791
2 Ga0123356_10093570 3300010049 Bacteria 2869
3 Ga0466712_233820 3300042614 Bacteria 43972
4 Ga0466718_088323 3300042617 Bacteria 36192
5 AustNasuHG_c1001667 3300000089 Bacteria 8002
6 JGI24695J34938_10000066 3300002450 Bacteria 87156
7 JGI24695J34938_10010236 3300002450 Bacteria 5155
8 Ga0072941_1017928 3300005201 Bacteria 12667
9 Ga0072941_1025952 3300005201 Unclassified 2685
10 Ga0072941_1067570 3300005201 Bacteria 9437
11 Ga0072941_1069075 3300005201 Bacteria 5281
12 Ga0466702_214744 3300042635 Bacteria 6134
13 Ga0466721_353820 3300042608 Bacteria 4042
14 Ga0264413_113193 3300024493 Bacteria 9382
15 Ga0415639_043137 3300038395 Bacteria 3193
16 Ga0415639_078557 3300038395 Bacteria 6103
17 Ga0123356_10411166 3300010049 Bacteria 1493
18 Ga0466712_039776 3300042614 Bacteria 17547
19 Ga0466712_154629 3300042614 Bacteria 40642
20 Nasutiter_Contig15322 2030936001 Unclassified 1358
21 AustNasuHG_c1016318 3300000089 Bacteria 2486
22 JGI24698J34947_10002138 3300002449 Bacteria 10582
23 Ga0072941_1000027 3300005201 Bacteria 15534
24 Ga0072941_1069076 3300005201 Bacteria 1383
25 Ga0466704_342064 3300042643 Bacteria 1376
26 Ga0466720_191438 3300042607 Bacteria 10510
27 Ga0123356_10000504 3300010049 Bacteria 43651
28 Ga0466718_005583 3300042617 Bacteria 5006
29 JGI24698J34947_10002447 3300002449 Bacteria 10004
30 JGI24698J34947_10004830 3300002449 Bacteria 7376
31 JGI24695J34938_10000229 3300002450 Bacteria 53063
32 JGI24695J34938_10000528 3300002450 Bacteria 37117
33 JGI24695J34938_10002101 3300002450 Bacteria 15615
34 JGI24695J34938_10071500 3300002450 Bacteria 1449
35 Ga0466720_229196 3300042607 Bacteria 10304
36 Ga0264413_104757 3300024493 Bacteria 14318
37 Ga0466693_254839 3300042592 Bacteria 37752
38 Ga0466712_249117 3300042614 Bacteria 6815
39 AustNasuHG_c1012992 3300000089 Unclassified 2864
40 JGI24695J34938_10000167 3300002450 Bacteria 61547
41 JGI24695J34938_10010031 3300002450 Bacteria 5223
42 JGI24695J34938_10011713 3300002450 Bacteria 4707
43 JGI24695J34938_10011939 3300002450 Bacteria 4637
44 JGI24695J34938_10077745 3300002450 Bacteria 1376
45 Ga0072941_1081098 3300005201 Bacteria 1625
46 Ga0466731_113282 3300042622 Bacteria 1595
47 Ga0466731_312606 3300042622 Bacteria 1564
48 Ga0466705_152523 3300042612 Bacteria 3246
49 Ga0466696_107093 3300042596 Bacteria 13820
50 Ga0123356_10005998 3300010049 Bacteria 12327
51 Ga0123356_10047669 3300010049 Bacteria 3987
52 Ga0466718_054273 3300042617 Bacteria 11109
53 JGI24698J34947_10001606 3300002449 Bacteria 12017
54 JGI24695J34938_10001201 3300002450 Bacteria 22950
55 JGI24695J34938_10013346 3300002450 Bacteria 4319
56 Ga0072941_1025953 3300005201 Bacteria 2067
57 Ga0264413_102815 3300024493 Bacteria 11006
58 Ga0264413_111052 3300024493 Bacteria 11563
59 Ga0415639_018117 3300038395 Bacteria 21951
60 Ga0415639_211401 3300038395 Bacteria 1029
61 Ga0466693_352391 3300042592 Bacteria 1530
62 Ga0466694_106808 3300042594 Bacteria 82814
63 Ga0123356_10001261 3300010049 Bacteria 27987
64 Ga0466712_048761 3300042614 Bacteria 9533
65 Ga0466718_089060 3300042617 Bacteria 13877
66 AustNasuHG_c1019785 3300000089 Bacteria 2203
67 JGI24695J34938_10000883 3300002450 Bacteria 27695
68 JGI24695J34938_10001559 3300002450 Bacteria 19318
69 JGI24695J34938_10007457 3300002450 Bacteria 6398
70 Ga0072941_1013181 3300005201 Bacteria 13866
71 Ga0466731_436290 3300042622 Bacteria 1814
72 Ga0264413_109988 3300024493 Bacteria 8053
73 Ga0415639_063596 3300038395 Bacteria 3819
74 Ga0123356_10000078 3300010049 Bacteria 103379
75 Ga0123356_10006321 3300010049 Bacteria 11961
76 Ga0123356_10200462 3300010049 Bacteria 2035
77 Ga0466712_080584 3300042614 Bacteria 13793
78 Ga0466718_033388 3300042617 Bacteria 14281
79 JGI24698J34947_10001323 3300002449 Bacteria 13016
80 JGI24698J34947_10003063 3300002449 Bacteria 9049
81 JGI24698J34947_10030307 3300002449 Bacteria 2853
82 JGI24698J34947_10034078 3300002449 Bacteria 2668
83 JGI24698J34947_10034639 3300002449 Bacteria 2640
84 JGI24695J34938_10000004 3300002450 Bacteria 163071
85 JGI24695J34938_10000832 3300002450 Bacteria 28661
86 JGI24695J34938_10031117 3300002450 Bacteria 2480
87 Ga0072941_1017889 3300005201 Bacteria 7923
88 Ga0466720_021614 3300042607 Bacteria 26640
89 Ga0466720_089470 3300042607 Bacteria 14772
90 Ga0466720_180689 3300042607 Bacteria 8308
91 Ga0466694_077871 3300042594 Bacteria 71235
92 Ga0466694_092283 3300042594 Bacteria 41988
93 Ga0123356_10001086 3300010049 Bacteria 30101
94 Ga0123356_10002323 3300010049 Bacteria 20424
95 Ga0466712_296638 3300042614 Bacteria 11842
96 Ga0466711_288437 3300042615 Bacteria 9102
97 Ga0466718_038912 3300042617 Bacteria 18225
98 Ga0466718_083344 3300042617 Bacteria 41687
99 JGI24698J34947_10014829 3300002449 Bacteria 4244
100 JGI24695J34938_10000012 3300002450 Bacteria 126955
101 JGI24695J34938_10001688 3300002450 Bacteria 18269
102 JGI24695J34938_10003053 3300002450 Bacteria 11995
103 Ga0072941_1076261 3300005201 Bacteria 3423
104 Ga0072941_1081097 3300005201 Unclassified 1470
105 Ga0466731_103124 3300042622 Bacteria 1184

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10502 Peptidase_S26 Signal peptidase, peptidase S26 44 250 0.81

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.