Protein Family IF11773
Metagenome
Isolate
122
Members
38
Samples
105
Scaffolds
232.03
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125649|2781306294|
- Length
- 258 aa
- Sequence
- MDYFLADYALAKNNLGRVNMFDKSRQYSYRAQKNQRNKIFVIIFVFFVLYVSYNCLTAFFFSVWVVDNDTMQPGLNKGDRIVFSSFNAPWNGNDEENQTVFKRGNIVLVDMRHYRDKKLPLRIIDGFARFFTAQRISIFRGEGQYYVKRVIGLGGDEVSMNNYGFRVKASGSTYVLTEYELSNRSYLAQIPQVTEQWNESIPFSGNMNAITLGPNECFVASDDRSNTNDSRTWGPISPSLISARAVFRFWPLNRIGLL
Sample Types
Isolate
13.9%
Metagenome
86.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
47.2%
Termitidae
41.7%
Kalotermitidae
11.1%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 8 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 9 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 10 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 11 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 12 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 13 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 14 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 15 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 16 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 17 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 18 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 19 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 20 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 21 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 22 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 29 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 30 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466699_015973 | 3300042597 | Bacteria | 123791 |
| 2 | Ga0123356_10093570 | 3300010049 | Bacteria | 2869 |
| 3 | Ga0466712_233820 | 3300042614 | Bacteria | 43972 |
| 4 | Ga0466718_088323 | 3300042617 | Bacteria | 36192 |
| 5 | AustNasuHG_c1001667 | 3300000089 | Bacteria | 8002 |
| 6 | JGI24695J34938_10000066 | 3300002450 | Bacteria | 87156 |
| 7 | JGI24695J34938_10010236 | 3300002450 | Bacteria | 5155 |
| 8 | Ga0072941_1017928 | 3300005201 | Bacteria | 12667 |
| 9 | Ga0072941_1025952 | 3300005201 | Unclassified | 2685 |
| 10 | Ga0072941_1067570 | 3300005201 | Bacteria | 9437 |
| 11 | Ga0072941_1069075 | 3300005201 | Bacteria | 5281 |
| 12 | Ga0466702_214744 | 3300042635 | Bacteria | 6134 |
| 13 | Ga0466721_353820 | 3300042608 | Bacteria | 4042 |
| 14 | Ga0264413_113193 | 3300024493 | Bacteria | 9382 |
| 15 | Ga0415639_043137 | 3300038395 | Bacteria | 3193 |
| 16 | Ga0415639_078557 | 3300038395 | Bacteria | 6103 |
| 17 | Ga0123356_10411166 | 3300010049 | Bacteria | 1493 |
| 18 | Ga0466712_039776 | 3300042614 | Bacteria | 17547 |
| 19 | Ga0466712_154629 | 3300042614 | Bacteria | 40642 |
| 20 | Nasutiter_Contig15322 | 2030936001 | Unclassified | 1358 |
| 21 | AustNasuHG_c1016318 | 3300000089 | Bacteria | 2486 |
| 22 | JGI24698J34947_10002138 | 3300002449 | Bacteria | 10582 |
| 23 | Ga0072941_1000027 | 3300005201 | Bacteria | 15534 |
| 24 | Ga0072941_1069076 | 3300005201 | Bacteria | 1383 |
| 25 | Ga0466704_342064 | 3300042643 | Bacteria | 1376 |
| 26 | Ga0466720_191438 | 3300042607 | Bacteria | 10510 |
| 27 | Ga0123356_10000504 | 3300010049 | Bacteria | 43651 |
| 28 | Ga0466718_005583 | 3300042617 | Bacteria | 5006 |
| 29 | JGI24698J34947_10002447 | 3300002449 | Bacteria | 10004 |
| 30 | JGI24698J34947_10004830 | 3300002449 | Bacteria | 7376 |
| 31 | JGI24695J34938_10000229 | 3300002450 | Bacteria | 53063 |
| 32 | JGI24695J34938_10000528 | 3300002450 | Bacteria | 37117 |
| 33 | JGI24695J34938_10002101 | 3300002450 | Bacteria | 15615 |
| 34 | JGI24695J34938_10071500 | 3300002450 | Bacteria | 1449 |
| 35 | Ga0466720_229196 | 3300042607 | Bacteria | 10304 |
| 36 | Ga0264413_104757 | 3300024493 | Bacteria | 14318 |
| 37 | Ga0466693_254839 | 3300042592 | Bacteria | 37752 |
| 38 | Ga0466712_249117 | 3300042614 | Bacteria | 6815 |
| 39 | AustNasuHG_c1012992 | 3300000089 | Unclassified | 2864 |
| 40 | JGI24695J34938_10000167 | 3300002450 | Bacteria | 61547 |
| 41 | JGI24695J34938_10010031 | 3300002450 | Bacteria | 5223 |
| 42 | JGI24695J34938_10011713 | 3300002450 | Bacteria | 4707 |
| 43 | JGI24695J34938_10011939 | 3300002450 | Bacteria | 4637 |
| 44 | JGI24695J34938_10077745 | 3300002450 | Bacteria | 1376 |
| 45 | Ga0072941_1081098 | 3300005201 | Bacteria | 1625 |
| 46 | Ga0466731_113282 | 3300042622 | Bacteria | 1595 |
| 47 | Ga0466731_312606 | 3300042622 | Bacteria | 1564 |
| 48 | Ga0466705_152523 | 3300042612 | Bacteria | 3246 |
| 49 | Ga0466696_107093 | 3300042596 | Bacteria | 13820 |
| 50 | Ga0123356_10005998 | 3300010049 | Bacteria | 12327 |
| 51 | Ga0123356_10047669 | 3300010049 | Bacteria | 3987 |
| 52 | Ga0466718_054273 | 3300042617 | Bacteria | 11109 |
| 53 | JGI24698J34947_10001606 | 3300002449 | Bacteria | 12017 |
| 54 | JGI24695J34938_10001201 | 3300002450 | Bacteria | 22950 |
| 55 | JGI24695J34938_10013346 | 3300002450 | Bacteria | 4319 |
| 56 | Ga0072941_1025953 | 3300005201 | Bacteria | 2067 |
| 57 | Ga0264413_102815 | 3300024493 | Bacteria | 11006 |
| 58 | Ga0264413_111052 | 3300024493 | Bacteria | 11563 |
| 59 | Ga0415639_018117 | 3300038395 | Bacteria | 21951 |
| 60 | Ga0415639_211401 | 3300038395 | Bacteria | 1029 |
| 61 | Ga0466693_352391 | 3300042592 | Bacteria | 1530 |
| 62 | Ga0466694_106808 | 3300042594 | Bacteria | 82814 |
| 63 | Ga0123356_10001261 | 3300010049 | Bacteria | 27987 |
| 64 | Ga0466712_048761 | 3300042614 | Bacteria | 9533 |
| 65 | Ga0466718_089060 | 3300042617 | Bacteria | 13877 |
| 66 | AustNasuHG_c1019785 | 3300000089 | Bacteria | 2203 |
| 67 | JGI24695J34938_10000883 | 3300002450 | Bacteria | 27695 |
| 68 | JGI24695J34938_10001559 | 3300002450 | Bacteria | 19318 |
| 69 | JGI24695J34938_10007457 | 3300002450 | Bacteria | 6398 |
| 70 | Ga0072941_1013181 | 3300005201 | Bacteria | 13866 |
| 71 | Ga0466731_436290 | 3300042622 | Bacteria | 1814 |
| 72 | Ga0264413_109988 | 3300024493 | Bacteria | 8053 |
| 73 | Ga0415639_063596 | 3300038395 | Bacteria | 3819 |
| 74 | Ga0123356_10000078 | 3300010049 | Bacteria | 103379 |
| 75 | Ga0123356_10006321 | 3300010049 | Bacteria | 11961 |
| 76 | Ga0123356_10200462 | 3300010049 | Bacteria | 2035 |
| 77 | Ga0466712_080584 | 3300042614 | Bacteria | 13793 |
| 78 | Ga0466718_033388 | 3300042617 | Bacteria | 14281 |
| 79 | JGI24698J34947_10001323 | 3300002449 | Bacteria | 13016 |
| 80 | JGI24698J34947_10003063 | 3300002449 | Bacteria | 9049 |
| 81 | JGI24698J34947_10030307 | 3300002449 | Bacteria | 2853 |
| 82 | JGI24698J34947_10034078 | 3300002449 | Bacteria | 2668 |
| 83 | JGI24698J34947_10034639 | 3300002449 | Bacteria | 2640 |
| 84 | JGI24695J34938_10000004 | 3300002450 | Bacteria | 163071 |
| 85 | JGI24695J34938_10000832 | 3300002450 | Bacteria | 28661 |
| 86 | JGI24695J34938_10031117 | 3300002450 | Bacteria | 2480 |
| 87 | Ga0072941_1017889 | 3300005201 | Bacteria | 7923 |
| 88 | Ga0466720_021614 | 3300042607 | Bacteria | 26640 |
| 89 | Ga0466720_089470 | 3300042607 | Bacteria | 14772 |
| 90 | Ga0466720_180689 | 3300042607 | Bacteria | 8308 |
| 91 | Ga0466694_077871 | 3300042594 | Bacteria | 71235 |
| 92 | Ga0466694_092283 | 3300042594 | Bacteria | 41988 |
| 93 | Ga0123356_10001086 | 3300010049 | Bacteria | 30101 |
| 94 | Ga0123356_10002323 | 3300010049 | Bacteria | 20424 |
| 95 | Ga0466712_296638 | 3300042614 | Bacteria | 11842 |
| 96 | Ga0466711_288437 | 3300042615 | Bacteria | 9102 |
| 97 | Ga0466718_038912 | 3300042617 | Bacteria | 18225 |
| 98 | Ga0466718_083344 | 3300042617 | Bacteria | 41687 |
| 99 | JGI24698J34947_10014829 | 3300002449 | Bacteria | 4244 |
| 100 | JGI24695J34938_10000012 | 3300002450 | Bacteria | 126955 |
| 101 | JGI24695J34938_10001688 | 3300002450 | Bacteria | 18269 |
| 102 | JGI24695J34938_10003053 | 3300002450 | Bacteria | 11995 |
| 103 | Ga0072941_1076261 | 3300005201 | Bacteria | 3423 |
| 104 | Ga0072941_1081097 | 3300005201 | Unclassified | 1470 |
| 105 | Ga0466731_103124 | 3300042622 | Bacteria | 1184 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10502 | Peptidase_S26 | Signal peptidase, peptidase S26 | 44 | 250 | 0.81 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.