Protein Family IF11737
Metagenome
Isolate
120
Members
38
Samples
116
Scaffolds
134.19
Avg Length
Representative Sequence
- ID
- iso_pr_bacteria|2781125631|2781268236|
- Length
- 154 aa
- Sequence
- LPSICIHLPIINLTVTKQMIMSKIALDSNILIYNHSLDHEKKRLIAIGFFNEMPVVSSQVISEYLNVMRKKFKVEKNELMQICSSWLEKCTVQPVVSSTIKHAQNLVAKYDFQLFDGIVVAAALEANCDILYSEDMHDGLVVEKTLTIINPFKE
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
66.7%
Unclassified
16.7%
Kalotermitidae
11.1%
Rhinotermitidae
2.8%
Termopsidae
2.8%
Taxonomy
Archaea
0
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 2 | 2820746860 | Unclassified Bacteroidetes Th196P3bin126 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 14 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 17 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 26 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 27 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 28 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 29 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 30 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 31 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 38 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_289245 | 3300042656 | Bacteria | 2355 |
| 2 | Ga0466708_310231 | 3300042652 | Bacteria | 5306 |
| 3 | Ga0264413_140351 | 3300024493 | Bacteria | 1629 |
| 4 | Ga0466699_349866 | 3300042597 | Unclassified | 4229 |
| 5 | Ga0123356_11852723 | 3300010049 | Unclassified | 750 |
| 6 | Ga0466707_282677 | 3300042601 | Bacteria | 2807 |
| 7 | Ga0466720_162633 | 3300042607 | Bacteria | 2031 |
| 8 | Ga0466720_168744 | 3300042607 | Bacteria | 21244 |
| 9 | JGI24698J34947_10170475 | 3300002449 | Bacteria | 881 |
| 10 | JGI24695J34938_10008381 | 3300002450 | Bacteria | 5903 |
| 11 | JGI24702J35022_10001092 | 3300002462 | Bacteria | 16861 |
| 12 | Ga0466731_084010 | 3300042622 | Bacteria | 2752 |
| 13 | Ga0466712_241360 | 3300042614 | Unclassified | 4305 |
| 14 | Ga0466718_010548 | 3300042617 | Bacteria | 4539 |
| 15 | Ga0466718_027539 | 3300042617 | Bacteria | 5018 |
| 16 | Ga0466718_044538 | 3300042617 | Bacteria | 1132 |
| 17 | Ga0264413_109469 | 3300024493 | Bacteria | 2994 |
| 18 | Ga0264413_118517 | 3300024493 | Unclassified | 1513 |
| 19 | Ga0466694_335211 | 3300042594 | Bacteria | 1037 |
| 20 | Ga0466699_417277 | 3300042597 | Unclassified | 1387 |
| 21 | Ga0123356_10756684 | 3300010049 | Bacteria | 1142 |
| 22 | Ga0466701_052551 | 3300042598 | Bacteria | 1023 |
| 23 | Ga0466721_245155 | 3300042608 | Unclassified | 1376 |
| 24 | AustNasuHG_c1031130 | 3300000089 | Bacteria | 1516 |
| 25 | JGI24698J34947_10022946 | 3300002449 | Unclassified | 3340 |
| 26 | JGI24698J34947_10038281 | 3300002449 | Bacteria | 2488 |
| 27 | JGI24698J34947_10073994 | 3300002449 | Bacteria | 1624 |
| 28 | Ga0466732_424669 | 3300042656 | Bacteria | 1179 |
| 29 | Ga0466733_001006 | 3300042659 | Bacteria | 4650 |
| 30 | Ga0466731_430657 | 3300042622 | Bacteria | 1052 |
| 31 | Ga0466712_115856 | 3300042614 | Unclassified | 1514 |
| 32 | Ga0466712_116662 | 3300042614 | Bacteria | 2124 |
| 33 | Ga0466718_053855 | 3300042617 | Unclassified | 1327 |
| 34 | Ga0264413_111967 | 3300024493 | Bacteria | 2986 |
| 35 | Ga0466694_361464 | 3300042594 | Unclassified | 2770 |
| 36 | Ga0466699_330398 | 3300042597 | Bacteria | 1350 |
| 37 | Ga0466699_403336 | 3300042597 | Bacteria | 1029 |
| 38 | Ga0466713_008244 | 3300042602 | Bacteria | 1492 |
| 39 | Ga0466719_260743 | 3300042606 | Bacteria | 1425 |
| 40 | Ga0466720_004714 | 3300042607 | Bacteria | 3819 |
| 41 | Ga0466721_323906 | 3300042608 | Bacteria | 1173 |
| 42 | JGI24698J34947_10021940 | 3300002449 | Unclassified | 3428 |
| 43 | JGI24698J34947_10096354 | 3300002449 | Bacteria | 1342 |
| 44 | JGI24702J35022_10254221 | 3300002462 | Bacteria | 1023 |
| 45 | JGI24696J40584_12873912 | 3300002834 | Bacteria | 1056 |
| 46 | Ga0072941_1028497 | 3300005201 | Bacteria | 7956 |
| 47 | Ga0466732_387290 | 3300042656 | Bacteria | 1077 |
| 48 | Ga0466729_313094 | 3300042621 | Bacteria | 6886 |
| 49 | Ga0466731_134358 | 3300042622 | Unclassified | 1555 |
| 50 | Ga0466718_003738 | 3300042617 | Bacteria | 2807 |
| 51 | Ga0466718_113973 | 3300042617 | Unclassified | 1172 |
| 52 | Ga0264413_126612 | 3300024493 | Unclassified | 1261 |
| 53 | Ga0466699_127646 | 3300042597 | Bacteria | 2198 |
| 54 | Ga0123356_10014703 | 3300010049 | Bacteria | 7520 |
| 55 | Ga0123356_10101700 | 3300010049 | Bacteria | 2758 |
| 56 | Ga0466700_367816 | 3300042600 | Bacteria | 1025 |
| 57 | Ga0466720_005379 | 3300042607 | Bacteria | 1108 |
| 58 | Nasutiter_Contig03945 | 2030936001 | Bacteria | 870 |
| 59 | Ga0072941_1024367 | 3300005201 | Bacteria | 4886 |
| 60 | Ga0072941_1072800 | 3300005201 | Bacteria | 864 |
| 61 | Ga0466712_080480 | 3300042614 | Bacteria | 6785 |
| 62 | Ga0466718_055008 | 3300042617 | Bacteria | 1142 |
| 63 | Ga0466718_072681 | 3300042617 | Unclassified | 1404 |
| 64 | Ga0466718_106421 | 3300042617 | Unclassified | 5536 |
| 65 | Ga0466728_106910 | 3300042620 | Bacteria | 7761 |
| 66 | Ga0466729_129310 | 3300042621 | Bacteria | 3091 |
| 67 | Ga0466699_294521 | 3300042597 | Bacteria | 1475 |
| 68 | Ga0123356_11638371 | 3300010049 | Bacteria | 797 |
| 69 | Ga0123353_11543641 | 3300010167 | Bacteria | 843 |
| 70 | Ga0466700_303869 | 3300042600 | Bacteria | 2052 |
| 71 | Ga0466719_155505 | 3300042606 | Bacteria | 1408 |
| 72 | AustNasuHG_c1004999 | 3300000089 | Bacteria | 4744 |
| 73 | JGI24698J34947_10115566 | 3300002449 | Unclassified | 1175 |
| 74 | JGI24695J34938_10080316 | 3300002450 | Bacteria | 1348 |
| 75 | JGI24702J35022_10151041 | 3300002462 | Bacteria | 1303 |
| 76 | Ga0072940_1168432 | 3300005200 | Bacteria | 1207 |
| 77 | Ga0466705_026147 | 3300042612 | Bacteria | 1730 |
| 78 | Ga0466732_290650 | 3300042656 | Bacteria | 1380 |
| 79 | Ga0466731_113188 | 3300042622 | Bacteria | 1106 |
| 80 | Ga0466727_301929 | 3300042655 | Bacteria | 5854 |
| 81 | Ga0466712_163763 | 3300042614 | Unclassified | 1184 |
| 82 | Ga0466712_319406 | 3300042614 | Bacteria | 7507 |
| 83 | Ga0466694_000959 | 3300042594 | Bacteria | 4895 |
| 84 | Ga0466694_390876 | 3300042594 | Bacteria | 6650 |
| 85 | Ga0123356_10003785 | 3300010049 | Bacteria | 15752 |
| 86 | Ga0123356_10472071 | 3300010049 | Bacteria | 1406 |
| 87 | Ga0123353_11342645 | 3300010167 | Bacteria | 924 |
| 88 | Ga0466719_519694 | 3300042606 | Bacteria | 1366 |
| 89 | Ga0466720_088577 | 3300042607 | Unclassified | 5624 |
| 90 | Ga0466720_115436 | 3300042607 | Bacteria | 52557 |
| 91 | JGI24698J34947_10000880 | 3300002449 | Unclassified | 15186 |
| 92 | JGI24698J34947_10084957 | 3300002449 | Unclassified | 1472 |
| 93 | JGI24702J35022_10021018 | 3300002462 | Unclassified | 3542 |
| 94 | Ga0466712_126139 | 3300042614 | Bacteria | 3102 |
| 95 | Ga0466712_237996 | 3300042614 | Bacteria | 1776 |
| 96 | Ga0466699_176329 | 3300042597 | Unclassified | 3505 |
| 97 | Ga0123356_10770777 | 3300010049 | Bacteria | 1132 |
| 98 | Ga0123356_12296867 | 3300010049 | Bacteria | 674 |
| 99 | Ga0123354_10599330 | 3300010882 | Bacteria | 808 |
| 100 | Ga0466720_058042 | 3300042607 | Bacteria | 13560 |
| 101 | Ga0466720_238307 | 3300042607 | Unclassified | 1752 |
| 102 | Ga0466698_251926 | 3300042610 | Bacteria | 1339 |
| 103 | AustNasuHG_c1046644 | 3300000089 | Bacteria | 975 |
| 104 | JGI24695J34938_10024593 | 3300002450 | Bacteria | 2890 |
| 105 | JGI24699J35502_10487303 | 3300002509 | Bacteria | 609 |
| 106 | Ga0466712_052009 | 3300042614 | Bacteria | 1501 |
| 107 | Ga0466712_124056 | 3300042614 | Bacteria | 3539 |
| 108 | Ga0466718_016375 | 3300042617 | Bacteria | 3534 |
| 109 | Ga0123356_10083532 | 3300010049 | Bacteria | 3025 |
| 110 | Ga0123356_11630224 | 3300010049 | Bacteria | 799 |
| 111 | Ga0123353_11894081 | 3300010167 | Bacteria | 736 |
| 112 | Ga0466707_227676 | 3300042601 | Bacteria | 1346 |
| 113 | Ga0466720_040873 | 3300042607 | Bacteria | 4370 |
| 114 | Ga0466720_185331 | 3300042607 | Bacteria | 80374 |
| 115 | JGI24698J34947_10070050 | 3300002449 | Bacteria | 1690 |
| 116 | JGI24697J35500_11195195 | 3300002507 | Unclassified | 1621 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 24 | 135 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.