Protein Family IF11256

Metagenome Isolate
201 Members
143 Samples
103 Scaffolds
240.45 Avg Length

🧬 Representative Sequence

ID
iso_pr_bacteria|2663763384|2666812181|
Length
287 aa
Sequence
MAVCAVAVPPLPDDLSCLRSEESFSRRTVNVQETYSKWVDNREMTKPIEASIVVVDDEPSIRDLLVASLHFSGFEVATAASGSEAIEVIEKVQPDLIILDVMLPDIDGFTVTRRIRQEGIEAPVLFLTARDDTQDKVMGLTVGGDDYVTKPFSLEEVVARIRAILRRTHEQEDNNPVISVGDLEINEDSHDVTRAGQPVDLSPTEYKLLRYLMDNEGRVLSKAQILDHVWQYDWGGDAAIVESYISYLRKKVDGVTVRGADGNMHKVAPLIETKRGIGYMIREPKKA

📊 Sample Types

Isolate 48.8%
Metagenome 51.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 24.1%
Apidae 14.3%
Termitidae 11.3%
Anthocoridae 7.5%
Scarabaeidae 6.8%
Culicidae 5.3%
Tenebrionidae 5.3%
Cambaridae 4.5%
Kalotermitidae 3.8%
Formicidae 3.0%
Elmidae 2.3%
Armadillidiidae 2.3%
Dytiscidae 2.3%
Hydrophilidae 1.5%
Cerambycidae 1.5%
Curculionidae 1.5%
Drosophilidae 0.8%
Cimicidae 0.8%
Chironomidae 0.8%
Pyralidae 0.8%

🌳 Taxonomy

Archaea 0
Bacteria 179
Eukaryota 0
Viruses 0
Unclassified 22

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2505679068 Isoptericola variabilis 225 Isolate Unclassified
2 2513237174 Bifidobacterium asteroides ATCC 25910 Isolate Apidae
3 2645727657 Bifidobacterium actinocoloniiforme DSM 22766 Isolate Unclassified
4 2767802234 Cytobacillus kochii BDGP4 Isolate Drosophilidae
5 2820818506 Unclassified Actinobacteria Nt197P3bin3 Isolate Unclassified
6 2820845766 Unclassified Actinobacteria Lab288P3bin96 Isolate Unclassified
7 2824199081 Bifidobacterium commune DSM 28792 Isolate Unclassified
8 2837204985 Lysinimonas sp. 2DFWR-13 Isolate Scarabaeidae
9 2865982043 Bifidobacterium aemilianum XV10 Isolate Apidae
10 2873586004 Sanguibacter sp. HDW7 Isolate Hydrophilidae
11 2894944011 Leucobacter sp. OLAS13 Isolate Anthocoridae
12 2915166107 Leucobacter sp. cx-87 Isolate Cambaridae
13 3300012818 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E0 MG Metagenome
14 3300012834 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E6 MG Metagenome
15 3300012857 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E0 MG Metagenome Culicidae
16 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
17 646564587 Tsukamurella paurometabola 33, DSM 20162 Isolate Cimicidae
18 8077775691 Tsukamurella sp. PLM1 Isolate Formicidae
19 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042613 Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 2084038013 Anoplophora glabripennis gut microbial communities from Worchester, Massachusetts, USA - Larvae Metagenome Cerambycidae
24 2547132042 Pseudonocardia sp. P2 Isolate Formicidae
25 2772190761 Rhodococcus rhodnii NRRL B-16535 Isolate Unclassified
26 2808606957 Bifidobacterium sp. ESL0447 Isolate Unclassified
27 8110341875 Bifidobacterium polysaccharolyticum W8117 Isolate Apidae
28 2847305884 Microbacterium protaetiae DFW100M-13 Isolate Scarabaeidae
29 2864773010 Tsukamurella ocularis S00022 Isolate Elmidae
30 2894981435 Leucobacter sp. OLDS2 Isolate Anthocoridae
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
33 3300012831 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E6 MG Metagenome Culicidae
34 3300012835 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E1 MG Metagenome Culicidae
35 3300012837 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG Metagenome Armadillidiidae
36 3300012850 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG Metagenome Culicidae
37 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
38 2684622918 Bifidobacterium asteroides Bi_198 Isolate Unclassified
39 8118075156 Actinosynnema pretiosum DSM 44131 Isolate Unclassified
40 2820897376 Unclassified Actinobacteria Lab288P1bin101 Isolate Unclassified
41 2836973655 Gryllotalpicola protaetiae 2DFW10M-5 Isolate Scarabaeidae
42 2856652821 Actinomadura rubteroloni RB29 Isolate Unclassified
43 2894926108 Leucobacter sp. OLES1 Isolate Anthocoridae
44 2912817845 Streptomyces griseus SID164 Isolate
45 2918390780 Glutamicibacter protophormiae DSM 20168 Isolate Unclassified
46 3300012828 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG Metagenome
47 3300012852 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E0 MG Metagenome
48 3300056790 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) Metagenome Tenebrionidae
49 3300056856 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) Metagenome Tenebrionidae
50 8024981139 Bifidobacterium asteroides ESL0170 Isolate Apidae
51 8024984606 Bifidobacterium asteroides ESL0199 Isolate Apidae
52 8069511479 Arthrobacter ipsi IA7 Isolate Curculionidae
53 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
54 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
55 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
56 2504756063 Isoptericola variabilis J5 Isolate Unclassified
57 2597490194 Bifidobacterium coryneforme LMG 18911 Isolate Apidae
58 2671180601 Bifidobacterium asteroides DSM 20089 Isolate Unclassified
59 2734481968 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
60 2864964650 Tsukamurella ocularis S00236 Isolate Elmidae
61 2873589062 Phycicoccus sp. HDW14 Isolate Hydrophilidae
62 2884613238 Agromyces intestinalis KACC 19306 Isolate Scarabaeidae
63 2915157839 Leucobacter sp. cx-42 Isolate Cambaridae
64 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
65 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
66 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
67 3300042625 Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 Metagenome Termitidae
68 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
69 3300056564 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) Metagenome Tenebrionidae
70 3300056814 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) Metagenome Tenebrionidae
71 3300056857 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS (version 2) Metagenome Tenebrionidae
72 3300057007 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) Metagenome Tenebrionidae
73 8046957834 Streptomyces coacervatus JCM 17138 Isolate Unclassified
74 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
75 2568526170 Bifidobacterium sp. A11 Isolate Apidae
76 2600255079 Bifidobacterium bombi DSM 19703 Isolate Apidae
77 2684622919 Bifidobacterium asteroides Bi_199 Isolate Unclassified
78 2731957681 Xylanimicrobium pachnodae JCM 13526, NBRC 107786 Isolate Scarabaeidae
79 2818991320 Klugiella xanthotipulae DSM 18031 Isolate Unclassified
80 2861945162 Microbacterium sp. AR7-10 Isolate Culicidae
81 2873617540 Leucobacter insecticola HDW9B Isolate Dytiscidae
82 2883683260 Protaetiibacter larvae KACC 19322 Isolate Scarabaeidae
83 2894900265 Leucobacter sp. OLTLW20 Isolate Anthocoridae
84 2894929448 Leucobacter sp. OAMSW11 Isolate Anthocoridae
85 2898589227 Actinomadura macrotermitis RB68 Isolate Termitidae
86 2915168811 Leucobacter sp. cx-169 Isolate Cambaridae
87 3002678670 Agromyces sp. G127AT Isolate Unclassified
88 3300002501 Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 Metagenome Termitidae
89 3300007129 Ant gut microbial communities from Cephalotes atratus, Brazil Metagenome Formicidae
90 3300012805 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG Metagenome
91 3300012814 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG Metagenome
92 3300012815 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E1 MG Metagenome
93 8024986378 Bifidobacterium asteroides ESL0198 Isolate Apidae
94 8032009961 Bifidobacterium indicum ESL0197 Isolate Apidae
95 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
96 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
97 2519899775 Bifidobacterium asteroides PRL2011 Isolate Apidae
98 2524023214 Leucobacter chironomi DSM 19883 Isolate Chironomidae
99 2597490239 Bifidobacterium bohemicum DSM 22767 Isolate Unclassified
100 2663763384 Bifidobacterium bombi DSM 19703 Isolate Apidae
101 8110340172 Bifidobacterium choladohabitans B14384H11 Isolate Apidae
102 2848356102 Xylanimonas allomyrinae 2JSPR-7 Isolate Scarabaeidae
103 2865983822 Bifidobacterium xylocopae XV2 Isolate Apidae
104 2894932631 Leucobacter sp. OAMLP11 Isolate Anthocoridae
105 2894966443 Leucobacter sp. OLCALW19 Isolate Anthocoridae
106 2910090113 Kocuria sp. cx-116 Isolate Cambaridae
107 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
108 647000328 Streptomyces sp. ACT-1 XylebKG-1 Isolate Curculionidae
109 8067987626 Agromyces larvae CFWR-12 Isolate Unclassified
110 8073544309 Actinomadura sp. RB99 Isolate Termitidae
111 2660238275 Bifidobacterium indicum DSM 20214 Isolate Unclassified
112 2684622916 Bifidobacterium asteroides Bi_170 Isolate Unclassified
113 2684622917 Bifidobacterium coryneforme Bi_197 Isolate Unclassified
114 2693429521 Bifidobacterium coryneforme DSM 20216 Isolate Unclassified
115 2788500098 Bombiscardovia coagulans DSM 22924 Isolate Apidae
116 2816332114 Microbacterium saperdae DSM 20169 Isolate Unclassified
117 2820825283 Unclassified Actinobacteria Nt197P3bin111 Isolate Unclassified
118 2873620646 Leucobacter coleopterorum HDW9A Isolate Dytiscidae
119 2883361506 Luteimicrobium xylanilyticum HY-24 Isolate Cerambycidae
120 2894935787 Leucobacter sp. OLJS4 Isolate Anthocoridae
121 2909881144 Kocuria sp. cx-455 Isolate Cambaridae
122 2915160415 Leucobacter sp. cx-328 Isolate Cambaridae
123 2918394494 Microbacterium imperiale DSM 20530 Isolate Unclassified
124 3300005721 Honey bee gut microbiome from Carl Hayden Bee Research Center, Tucson, Arizona, USA - sample 1, colony 176 Metagenome Apidae
125 3300012825 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG Metagenome
126 3300012845 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG Metagenome Culicidae
127 3300012848 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG Metagenome Armadillidiidae
128 3300012861 Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E0 MG Metagenome Culicidae
129 3300056842 Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) Metagenome Tenebrionidae
130 8012935351 Brevibacterium epidermidis UD i117 Isolate Unclassified
131 8024982947 Bifidobacterium asteroides ESL0200 Isolate Apidae
132 8067071256 Microbispora camponoti 2C-HV3 Isolate Formicidae
133 2684622920 Bifidobacterium asteroides Bi_200 Isolate Unclassified
134 2820867525 Unclassified Actinobacteria Lab288P3bin128 Isolate Unclassified
135 2841168549 Agromyces protaetiae FW100M-8 Isolate Scarabaeidae
136 2864918810 Tsukamurella ocularis S00175 Isolate Elmidae
137 2873614151 Leucobacter viscericola HDW9C Isolate Dytiscidae
138 2879643867 Bifidobacterium sp. wkB344 Isolate Apidae
139 2884351759 Cellulosimicrobium sp. BI34T Isolate Pyralidae
140 2894897082 Leucobacter sp. OLCS4 Isolate Anthocoridae
141 2894974975 Leucobacter sp. OLIS6 Isolate Anthocoridae
142 3300012809 Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971M_E11 MG Metagenome
143 3300012858 Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG Metagenome Armadillidiidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0530661_002108 3300056564 Bacteria 8100
2 Ga0562379_0046 3300056790 Bacteria 565608
3 Ga0562375_4256 3300056856 Bacteria 11204
4 Ga0562376_0325 3300056857 Bacteria 94096
5 Ga0160436_1002712 3300012861 Unclassified 4422
6 Ga0466724_06827 3300042649 Bacteria 229782
7 Ga0466710_200624 3300042613 Bacteria 1050
8 AustNasuHG_c1000517 3300000089 Bacteria 13504
9 AustNasuHG_c1018305 3300000089 Bacteria 2314
10 HBC_ctgsDRAFT_1007058 3300000333 Unclassified 2640
11 Ga0074278_115102 3300005721 Unclassified 3929
12 Ga0466705_041459 3300042612 Bacteria 1245
13 Ga0466705_377749 3300042612 Bacteria 5499
14 Ga0562375_0868 3300056856 Unclassified 49783
15 Ga0562376_0508 3300056857 Bacteria 69785
16 Ga0562376_1986 3300056857 Unclassified 26457
17 Ga0562374_0087 3300057007 Bacteria 263849
18 Ga0160430_113714 3300012852 Bacteria 1272
19 Ga0466730_017522 3300042625 Bacteria 1379
20 Ga0466723_120188 3300042618 Bacteria 25242
21 Ga0123353_10030476 3300010167 Unclassified 8337
22 Ga0123354_10074997 3300010882 Unclassified 4840
23 Ga0160464_101718 3300012805 Unclassified 6140
24 Ga0160466_100013 3300012809 Bacteria 386401
25 Ga0562378_0013 3300056814 Bacteria 998154
26 Ga0562375_2013 3300056856 Bacteria 24400
27 Ga0562374_0036 3300057007 Bacteria 691317
28 Ga0160459_101861 3300012831 Bacteria 3927
29 Ga0160430_100027 3300012852 Bacteria 204805
30 Ga0160435_1000057 3300012857 Bacteria 79976
31 Ga0160435_1001787 3300012857 Unclassified 5314
32 Ga0466693_218291 3300042592 Bacteria 114325
33 Ga0466691_159898 3300042593 Bacteria 15397
34 Ga0466730_013775 3300042625 Bacteria 78685
35 Ga0466730_041849 3300042625 Bacteria 1407
36 Ga0466730_087940 3300042625 Bacteria 3286
37 Ga0466724_19822 3300042649 Bacteria 331658
38 Ga0466724_47439 3300042649 Bacteria 410820
39 Ga0466723_025146 3300042618 Bacteria 20521
40 Ga0466707_061285 3300042601 Bacteria 45531
41 Ga0466713_092579 3300042602 Bacteria 53429
42 Ga0466719_159939 3300042606 Bacteria 5662
43 JGI24703J35330_11416265 3300002501 Unclassified 982
44 Ga0466697_168156 3300042611 Bacteria 11396
45 Ga0562375_0043 3300056856 Bacteria 520629
46 Ga0160446_100060 3300012835 Bacteria 113052
47 Ga0160457_1000032 3300012858 Bacteria 254159
48 Ga0466730_039654 3300042625 Bacteria 1068
49 Ga0466725_025427 3300042654 Bacteria 2561
50 Ga0466723_230249 3300042618 Bacteria 1964
51 AglaG_contig21039 2084038013 Bacteria 2380
52 Ga0102734_1032109 3300007129 Bacteria 1354
53 Ga0530661_000171 3300056564 Unclassified 56377
54 Ga0562377_0076 3300056842 Bacteria 380477
55 Ga0562376_0363 3300056857 Unclassified 86837
56 Ga0160440_104884 3300012815 Unclassified 1251
57 Ga0160432_100308 3300012818 Bacteria 38724
58 Ga0160455_100377 3300012837 Bacteria 25435
59 Ga0160434_100056 3300012850 Bacteria 80790
60 Ga0160430_102689 3300012852 Unclassified 5449
61 Ga0160436_1000020 3300012861 Bacteria 107309
62 Ga0466730_025089 3300042625 Bacteria 2617
63 Ga0466730_030063 3300042625 Bacteria 2066
64 Ga0466724_11286 3300042649 Bacteria 22479
65 Ga0123353_10023221 3300010167 Bacteria 9385
66 Ga0123353_10039092 3300010167 Bacteria 7464
67 Ga0530661_000023 3300056564 Bacteria 193293
68 Ga0530661_000163 3300056564 Bacteria 58031
69 Ga0562379_0012 3300056790 Bacteria 1590196
70 Ga0562379_0776 3300056790 Unclassified 51944
71 Ga0562375_0153 3300056856 Unclassified 202576
72 Ga0160453_101731 3300012814 Unclassified 6665
73 Ga0160452_100998 3300012834 Bacteria 10463
74 Ga0160457_1000489 3300012858 Bacteria 17710
75 Ga0160457_1006037 3300012858 Bacteria 1811
76 Ga0160436_1000017 3300012861 Bacteria 112955
77 Ga0466711_194571 3300042615 Bacteria 1946
78 Ga0123356_10015330 3300010049 Bacteria 7350
79 Ga0123353_10390739 3300010167 Bacteria 2076
80 Ga0074278_100985 3300005721 Unclassified 3674
81 Ga0562378_0637 3300056814 Unclassified 52943
82 Ga0562376_0002 3300056857 Bacteria 3502070
83 Ga0562376_0082 3300056857 Bacteria 224736
84 Ga0562376_0090 3300056857 Bacteria 217989
85 Ga0562376_1612 3300056857 Bacteria 30744
86 Ga0562376_5435 3300056857 Bacteria 8278
87 Ga0160460_106384 3300012845 Bacteria 1618
88 Ga0466657_364432 3300042582 Bacteria 1887
89 Ga0466730_097062 3300042625 Bacteria 1402
90 Ga0466711_496353 3300042615 Bacteria 3943
91 AglaG_contig18733 2084038013 Unclassified 2900
92 JGI24703J35330_11306118 3300002501 Unclassified 854
93 Ga0072940_1139702 3300005200 Bacteria 899
94 Ga0562379_0216 3300056790 Bacteria 161074
95 Ga0562374_0302 3300057007 Bacteria 93359
96 Ga0160441_100148 3300012825 Bacteria 76466
97 Ga0160431_103102 3300012828 Bacteria 3559
98 Ga0160459_100138 3300012831 Bacteria 47276
99 Ga0160452_100003 3300012834 Bacteria 748778
100 Ga0160443_100006 3300012848 Bacteria 647325
101 Ga0160435_1022327 3300012857 Unclassified 1104
102 Ga0466657_006791 3300042582 Bacteria 1051
103 Ga0466730_009850 3300042625 Bacteria 1280

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00072 Response_reg Response regulator receiver domain 52 162 0.99
PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal 196 280 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00072 GO:0000160 phosphorelay signal transduction system BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.