Protein Family IF10236
Metagenome
Isolate
114
Members
37
Samples
111
Scaffolds
300.34
Avg Length
Representative Sequence
- ID
- 3300042656|Ga0466732_112176|Ga0466732_112176_18042_19001
- Length
- 319 aa
- Sequence
- MNAIVITGATGMIGSAIARCAFEQDIDVLCIIRKGTSRFDNLPKSERLKIVYAGISEYADLDVSGSYDVFYHLAWEKTSGPSRDDVDTQAANIRYTLDAVRLAKRLGCKKFIGAGSQAEYGIVTEPLKPETPVNPQSGYGIAKYTAGKLSRLLCVQFGLQFNWVRILSVYGPLDGAHTLIMYTINELQAGRSPEFTKCEQVWDYLYCDDAAKAFLAIGENGVDGKSYPLGSGNKKKLSEYLEVIKNIVYPDAMLQFGKKEYYPHQPMYLCADISELTHDTGWKPEVPFEEGVKVINSTPRPPPSHPPLLHFLIFLNISS
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
37.1%
Unclassified
8.6%
Termopsidae
5.7%
Rhinotermitidae
2.9%
Taxonomy
Archaea
3
Bacteria
98
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 12 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 32 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 35 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_293213 | 3300042606 | Unclassified | 1833 |
| 2 | Ga0466722_080466 | 3300042609 | Bacteria | 2248 |
| 3 | Ga0466696_498077 | 3300042596 | Unclassified | 2282 |
| 4 | Ga0466712_089027 | 3300042614 | Bacteria | 5790 |
| 5 | Ga0466715_138626 | 3300042616 | Unclassified | 9137 |
| 6 | Ga0466718_121002 | 3300042617 | Bacteria | 22554 |
| 7 | Ga0466726_311503 | 3300042619 | Bacteria | 2104 |
| 8 | Ga0466728_383692 | 3300042620 | Bacteria | 5957 |
| 9 | AustNasuHG_c1009292 | 3300000089 | Archaea | 3453 |
| 10 | Ga0466702_011961 | 3300042635 | Bacteria | 1978 |
| 11 | Ga0466704_401737 | 3300042643 | Bacteria | 2371 |
| 12 | Ga0466704_407753 | 3300042643 | Bacteria | 3652 |
| 13 | Ga0466720_015515 | 3300042607 | Bacteria | 13320 |
| 14 | Ga0466720_046917 | 3300042607 | Bacteria | 61630 |
| 15 | Ga0466721_345673 | 3300042608 | Bacteria | 42375 |
| 16 | Ga0466722_249625 | 3300042609 | Bacteria | 6949 |
| 17 | Ga0264413_122993 | 3300024493 | Bacteria | 5382 |
| 18 | Ga0466690_133899 | 3300042590 | Bacteria | 17989 |
| 19 | Ga0466699_064929 | 3300042597 | Bacteria | 24291 |
| 20 | Ga0123356_10000062 | 3300010049 | Bacteria | 112695 |
| 21 | Ga0123356_10024561 | 3300010049 | Bacteria | 5670 |
| 22 | Ga0466726_482962 | 3300042619 | Bacteria | 1032 |
| 23 | Ga0072941_1046104 | 3300005201 | Bacteria | 25131 |
| 24 | Ga0072941_1617129 | 3300005201 | Bacteria | 1560 |
| 25 | Ga0466731_048131 | 3300042622 | Bacteria | 17747 |
| 26 | Ga0466705_105183 | 3300042612 | Bacteria | 3319 |
| 27 | Ga0466732_112176 | 3300042656 | Bacteria | 19030 |
| 28 | Ga0466720_037586 | 3300042607 | Bacteria | 39008 |
| 29 | Ga0466721_183657 | 3300042608 | Bacteria | 6026 |
| 30 | Ga0466711_195488 | 3300042615 | Bacteria | 13064 |
| 31 | Ga0466723_026694 | 3300042618 | Bacteria | 11475 |
| 32 | Ga0466728_200013 | 3300042620 | Bacteria | 2562 |
| 33 | JGI24698J34947_10005155 | 3300002449 | Bacteria | 7161 |
| 34 | Ga0466735_100539 | 3300042624 | Bacteria | 1059 |
| 35 | Ga0466708_426573 | 3300042652 | Unclassified | 4647 |
| 36 | Ga0466720_000599 | 3300042607 | Bacteria | 5905 |
| 37 | Ga0466720_124883 | 3300042607 | Bacteria | 13159 |
| 38 | Ga0264413_145852 | 3300024493 | Bacteria | 2063 |
| 39 | Ga0466690_013839 | 3300042590 | Bacteria | 2595 |
| 40 | Ga0466699_060084 | 3300042597 | Bacteria | 1654 |
| 41 | Ga0123356_10053405 | 3300010049 | Bacteria | 3760 |
| 42 | Ga0466712_055423 | 3300042614 | Bacteria | 4170 |
| 43 | Ga0466718_093507 | 3300042617 | Bacteria | 2945 |
| 44 | Ga0466726_215931 | 3300042619 | Bacteria | 4417 |
| 45 | Ga0466726_464958 | 3300042619 | Bacteria | 5227 |
| 46 | JGI24695J34938_10039537 | 3300002450 | Bacteria | 2130 |
| 47 | Ga0466732_070536 | 3300042656 | Bacteria | 7112 |
| 48 | Ga0264413_130029 | 3300024493 | Bacteria | 11639 |
| 49 | Ga0264413_139257 | 3300024493 | Bacteria | 3352 |
| 50 | Ga0415639_019554 | 3300038395 | Bacteria | 12574 |
| 51 | Ga0466691_109358 | 3300042593 | Bacteria | 16450 |
| 52 | Ga0466694_351177 | 3300042594 | Bacteria | 4455 |
| 53 | Ga0123356_10002210 | 3300010049 | Bacteria | 20938 |
| 54 | Ga0466712_023987 | 3300042614 | Bacteria | 1143 |
| 55 | Ga0466715_597011 | 3300042616 | Bacteria | 4252 |
| 56 | Ga0466718_119823 | 3300042617 | Bacteria | 1007 |
| 57 | Ga0466718_140601 | 3300042617 | Bacteria | 1831 |
| 58 | Ga0466728_046183 | 3300042620 | Bacteria | 22842 |
| 59 | JGI24698J34947_10023100 | 3300002449 | Bacteria | 3328 |
| 60 | JGI24698J34947_10109206 | 3300002449 | Bacteria | 1225 |
| 61 | Ga0466731_160801 | 3300042622 | Bacteria | 1689 |
| 62 | Ga0466708_147763 | 3300042652 | Bacteria | 6149 |
| 63 | Ga0466720_022415 | 3300042607 | Bacteria | 22736 |
| 64 | Ga0415639_121896 | 3300038395 | Bacteria | 3016 |
| 65 | Ga0466691_013606 | 3300042593 | Bacteria | 38402 |
| 66 | Ga0466691_120480 | 3300042593 | Archaea | 2452 |
| 67 | Ga0466691_151076 | 3300042593 | Bacteria | 9158 |
| 68 | Ga0466696_321738 | 3300042596 | Bacteria | 1540 |
| 69 | Ga0466696_400674 | 3300042596 | Bacteria | 2918 |
| 70 | Ga0123356_10040229 | 3300010049 | Bacteria | 4356 |
| 71 | Ga0466711_371264 | 3300042615 | Unclassified | 5608 |
| 72 | Ga0466726_127834 | 3300042619 | Bacteria | 4677 |
| 73 | Ga0466726_160066 | 3300042619 | Bacteria | 1416 |
| 74 | JGI24698J34947_10001955 | 3300002449 | Bacteria | 10988 |
| 75 | JGI24698J34947_10034786 | 3300002449 | Unclassified | 2634 |
| 76 | JGI24695J34938_10000547 | 3300002450 | Bacteria | 36307 |
| 77 | JGI24696J40584_12929195 | 3300002834 | Unclassified | 1450 |
| 78 | Ga0466704_509350 | 3300042643 | Bacteria | 1267 |
| 79 | Ga0466719_099702 | 3300042606 | Bacteria | 2817 |
| 80 | Ga0466720_018719 | 3300042607 | Unclassified | 3001 |
| 81 | Ga0415639_011106 | 3300038395 | Bacteria | 8084 |
| 82 | Ga0415639_018228 | 3300038395 | Bacteria | 2036 |
| 83 | Ga0466711_508985 | 3300042615 | Bacteria | 1850 |
| 84 | AustNasuHG_c1024911 | 3300000089 | Bacteria | 1887 |
| 85 | JGI24695J34938_10003453 | 3300002450 | Bacteria | 11036 |
| 86 | JGI24695J34938_10039733 | 3300002450 | Archaea | 2123 |
| 87 | Ga0072941_1023759 | 3300005201 | Bacteria | 21685 |
| 88 | Ga0466731_411674 | 3300042622 | Bacteria | 5182 |
| 89 | Ga0466702_370896 | 3300042635 | Bacteria | 1052 |
| 90 | Ga0466702_432230 | 3300042635 | Bacteria | 3193 |
| 91 | Ga0466709_403353 | 3300042648 | Bacteria | 14900 |
| 92 | Ga0466708_164241 | 3300042652 | Bacteria | 6829 |
| 93 | Ga0466732_426562 | 3300042656 | Bacteria | 1430 |
| 94 | Ga0466716_054874 | 3300042605 | Unclassified | 6513 |
| 95 | Ga0466720_066358 | 3300042607 | Bacteria | 42331 |
| 96 | Ga0466720_130095 | 3300042607 | Unclassified | 2583 |
| 97 | Ga0264413_105469 | 3300024493 | Bacteria | 17630 |
| 98 | Ga0466690_136187 | 3300042590 | Bacteria | 1615 |
| 99 | Ga0466690_232404 | 3300042590 | Bacteria | 11020 |
| 100 | Ga0466699_046742 | 3300042597 | Unclassified | 15155 |
| 101 | Ga0123353_10038691 | 3300010167 | Unclassified | 7499 |
| 102 | Ga0123353_10174790 | 3300010167 | Bacteria | 3406 |
| 103 | Ga0466712_243309 | 3300042614 | Bacteria | 16700 |
| 104 | Ga0466712_277269 | 3300042614 | Bacteria | 9529 |
| 105 | Ga0466718_035321 | 3300042617 | Unclassified | 5861 |
| 106 | Ga0466718_117815 | 3300042617 | Bacteria | 6335 |
| 107 | Ga0466723_071847 | 3300042618 | Bacteria | 22986 |
| 108 | Ga0466728_178930 | 3300042620 | Bacteria | 2639 |
| 109 | AustNasuHG_c1028341 | 3300000089 | Bacteria | 1675 |
| 110 | JGI24698J34947_10024657 | 3300002449 | Bacteria | 3210 |
| 111 | Ga0072941_1047344 | 3300005201 | Bacteria | 5191 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.