Protein Family IF09873

Metagenome Isolate
133 Members
29 Samples
123 Scaffolds
310.5 Avg Length

🧬 Representative Sequence

ID
3300042652|Ga0466708_083675|Ga0466708_083675_3403_4440
Length
345 aa
Sequence
LTIRLSQNFSFWEKLHINSFYQYDGSEGMNTLFFNTLFFKYALEIERTRSITKAAENLYMAQPNLSKAVKEMEDNVGFSIFERNSKGVIPTPKGILFLGYARKILEEMEQINKLSGADHPERQDFSISIPRGSYIAAGFTNFAMELDFEQEINVNIQETNSICTIDNVINNKFNLGIIRYQTMYENYYFDYLADKHLIHDQIWEFEYLALMSKKHPLAMDDEVEFCKLKSYIEIVHGDTVVPYLNAAELRYPSPEAIPKKRIYLYERFNQFDLLSNLPTTYMWVSPIPDKLLKRYSLVQRKCAFLNNSFKDVLIYRKGYTFTMLDKKFIDKIFESRNEVSLKQYT

📊 Sample Types

Isolate 7.5%
Metagenome 92.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 48.3%
Blattidae 27.6%
Unclassified 10.3%
Termopsidae 10.3%
Rhinotermitidae 3.4%

🌳 Taxonomy

Archaea 0
Bacteria 125
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940361758 Breznakia sp. PFB1-14 Isolate Blattidae
2 650716102 Treponema primitia ZAS-2 Isolate Unclassified
3 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
4 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
5 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
6 2940356891 Breznakia sp. PFB1-11 Isolate Blattidae
7 2940364193 Breznakia sp. PFB1-19 Isolate Blattidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 2940359323 Breznakia sp. PFB1-12 Isolate Blattidae
12 2940366561 Breznakia sp. PFB1-4 Isolate Blattidae
13 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
14 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
15 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
16 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 2940352027 Breznakia sp. PH1-1 Isolate Blattidae
19 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
20 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
21 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
24 2788499854 Breznakia blatticola DSM 28867 Isolate Unclassified
25 2940354458 Breznakia sp. PF1-11 Isolate Blattidae
26 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
27 2940368928 Breznakia sp. PFB2-30 Isolate Blattidae
28 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
29 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_115191 3300042590 Bacteria 3589
2 Ga0466691_119515 3300042593 Bacteria 3089
3 Ga0466696_140542 3300042596 Bacteria 7721
4 Ga0466696_235226 3300042596 Bacteria 3187
5 Ga0466696_236126 3300042596 Bacteria 4189
6 Ga0466722_141727 3300042609 Bacteria 2815
7 Ga0466705_043706 3300042612 Bacteria 3449
8 Ga0466735_058608 3300042624 Bacteria 1790
9 Ga0466735_167560 3300042624 Bacteria 2249
10 Ga0466703_135189 3300042636 Bacteria 24384
11 Ga0466703_276747 3300042636 Bacteria 2209
12 Ga0466704_204092 3300042643 Bacteria 2059
13 Ga0466708_023985 3300042652 Bacteria 3976
14 Ga0466708_088927 3300042652 Bacteria 11390
15 Ga0466708_157201 3300042652 Bacteria 4842
16 Ga0466708_157422 3300042652 Bacteria 26444
17 Ga0466711_069070 3300042615 Bacteria 40971
18 Ga0466711_223983 3300042615 Bacteria 6894
19 Ga0466711_419240 3300042615 Bacteria 4653
20 Ga0466711_438550 3300042615 Bacteria 8641
21 Ga0466715_106522 3300042616 Bacteria 16808
22 Ga0466723_103493 3300042618 Bacteria 19448
23 Ga0466726_441149 3300042619 Bacteria 1808
24 Ga0466690_008479 3300042590 Bacteria 1402
25 Ga0466690_399999 3300042590 Bacteria 6386
26 Ga0466696_022128 3300042596 Bacteria 2452
27 Ga0466716_101925 3300042605 Unclassified 1430
28 Ga0466719_092939 3300042606 Bacteria 3590
29 Ga0466722_004842 3300042609 Bacteria 2850
30 Ga0466705_182487 3300042612 Bacteria 3166
31 Ga0466735_163608 3300042624 Bacteria 1677
32 Ga0466703_043151 3300042636 Bacteria 1582
33 Ga0466704_394125 3300042643 Unclassified 4393
34 Ga0466709_034985 3300042648 Bacteria 42238
35 Ga0466727_290611 3300042655 Unclassified 1525
36 Ga0466711_168978 3300042615 Bacteria 1928
37 Ga0466715_254922 3300042616 Bacteria 30280
38 Ga0466715_337090 3300042616 Unclassified 1704
39 Ga0466727_351775 3300042655 Bacteria 2998
40 Ga0466691_060492 3300042593 Bacteria 6049
41 Ga0466719_265799 3300042606 Bacteria 13261
42 Ga0466719_372933 3300042606 Bacteria 2500
43 Ga0466705_129629 3300042612 Bacteria 31284
44 Ga0466705_153969 3300042612 Bacteria 6517
45 Ga0466705_256631 3300042612 Bacteria 1760
46 Ga0466703_037846 3300042636 Bacteria 4631
47 Ga0466704_140014 3300042643 Bacteria 3439
48 Ga0466704_569361 3300042643 Bacteria 2793
49 Ga0466708_025266 3300042652 Bacteria 1299
50 Ga0466708_357750 3300042652 Bacteria 1477
51 Ga0466708_365100 3300042652 Bacteria 3115
52 Ga0466715_053538 3300042616 Bacteria 19091
53 Ga0466723_012597 3300042618 Unclassified 5225
54 Ga0466723_112320 3300042618 Bacteria 5413
55 Ga0466691_188460 3300042593 Bacteria 12584
56 Ga0466696_014887 3300042596 Bacteria 1058
57 Ga0466719_030693 3300042606 Bacteria 2037
58 Ga0466719_445632 3300042606 Bacteria 6061
59 Ga0466703_042440 3300042636 Bacteria 8186
60 Ga0466703_244302 3300042636 Bacteria 1908
61 Ga0466704_028825 3300042643 Bacteria 12106
62 Ga0466704_146463 3300042643 Bacteria 1611
63 Ga0466709_084895 3300042648 Bacteria 4521
64 Ga0466708_083675 3300042652 Bacteria 5390
65 Ga0466708_178266 3300042652 Bacteria 3830
66 Ga0466711_267604 3300042615 Unclassified 2536
67 Ga0466728_333453 3300042620 Bacteria 1679
68 Ga0466690_032746 3300042590 Bacteria 2309
69 Ga0466691_146475 3300042593 Bacteria 6211
70 Ga0466719_424503 3300042606 Bacteria 1287
71 Ga0466722_067702 3300042609 Unclassified 2154
72 Ga0466705_199290 3300042612 Bacteria 5188
73 Ga0466735_190263 3300042624 Bacteria 22194
74 Ga0466704_398479 3300042643 Bacteria 6888
75 Ga0466709_117740 3300042648 Bacteria 6824
76 Ga0466727_079928 3300042655 Bacteria 1063
77 Ga0466711_252873 3300042615 Bacteria 20669
78 Ga0466723_288692 3300042618 Unclassified 1867
79 Ga0466690_278250 3300042590 Bacteria 1648
80 Ga0466691_169727 3300042593 Bacteria 5501
81 Ga0466696_122339 3300042596 Bacteria 4364
82 Ga0466696_122444 3300042596 Bacteria 2706
83 Ga0466696_316620 3300042596 Bacteria 5904
84 Ga0466719_178972 3300042606 Bacteria 1531
85 Ga0466722_012287 3300042609 Bacteria 1521
86 Ga0466722_134399 3300042609 Bacteria 1602
87 Ga0466703_158262 3300042636 Bacteria 11974
88 Ga0466704_337378 3300042643 Bacteria 2120
89 Ga0466704_390881 3300042643 Bacteria 2633
90 Ga0466709_296805 3300042648 Bacteria 5870
91 Ga0466711_293488 3300042615 Bacteria 6926
92 Ga0466715_032342 3300042616 Bacteria 3300
93 Ga0466723_052723 3300042618 Bacteria 3834
94 Ga0466723_058553 3300042618 Bacteria 3333
95 Ga0466726_120551 3300042619 Bacteria 2409
96 Ga0466726_284597 3300042619 Bacteria 2180
97 Ga0466690_061611 3300042590 Bacteria 23071
98 Ga0466691_138553 3300042593 Bacteria 2866
99 Ga0466707_295700 3300042601 Bacteria 1208
100 Ga0466722_030171 3300042609 Bacteria 1404
101 Ga0466709_123297 3300042648 Bacteria 13052
102 Ga0466709_134396 3300042648 Bacteria 2565
103 Ga0466709_136781 3300042648 Bacteria 13742
104 Ga0466708_070797 3300042652 Bacteria 13985
105 Ga0466723_102470 3300042618 Bacteria 10211
106 Ga0466723_173036 3300042618 Bacteria 1740
107 Ga0466728_041314 3300042620 Bacteria 6076
108 Ga0466690_083334 3300042590 Bacteria 6318
109 Ga0466690_403724 3300042590 Bacteria 2423
110 Ga0466716_138039 3300042605 Bacteria 7178
111 Ga0466716_367638 3300042605 Bacteria 2074
112 Ga0466705_006169 3300042612 Bacteria 1523
113 Ga0466703_014199 3300042636 Bacteria 2482
114 Ga0466703_116840 3300042636 Bacteria 2107
115 Ga0466709_083873 3300042648 Bacteria 13811
116 Ga0466709_361792 3300042648 Bacteria 3727
117 Ga0466708_118373 3300042652 Bacteria 2121
118 Ga0466727_035020 3300042655 Bacteria 2473
119 Ga0466711_045519 3300042615 Bacteria 8923
120 Ga0466711_058137 3300042615 Bacteria 6820
121 Ga0466711_354091 3300042615 Bacteria 27845
122 Ga0466723_241872 3300042618 Bacteria 1154
123 Ga0466726_312784 3300042619 Bacteria 3067

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family 40 94 0.96

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.