Protein Family IF09678
Metagenome
Isolate
152
Members
32
Samples
149
Scaffolds
250.78
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_390673|Ga0466709_390673_2195_2998
- Length
- 267 aa
- Sequence
- MFRGRLKMNGLLDYIGRDSVLHRLNPMTKLVLAFVLCASCFISGSLFFVLGILALNLILAALGGVIRRSLRILLSLVKLSVVLFLAQVFFVREGEIILRFPFDIFITGAGLYFSLLFVCRLIAAAMPLTLMLSVTRMSDISNVLNRYLGIPYKYTFVLTTAIRFIPLFSSEMAGIMEAQTSRGVEFDTKNFFKKIRLLLPLCVPLLISSVRKIEGGAISAELRGFNFRTRTSGYKRYPFAFGDAAFLFLCALIVTAAVLSGAAGQAG
Sample Types
Isolate
2.0%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
43.8%
Termitidae
25.0%
Unclassified
12.5%
Rhinotermitidae
9.4%
Termopsidae
9.4%
Taxonomy
Archaea
1
Bacteria
146
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 5 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 32 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_203021 | 3300042616 | Bacteria | 4488 |
| 2 | Ga0466715_456194 | 3300042616 | Bacteria | 8470 |
| 3 | Ga0466723_020604 | 3300042618 | Bacteria | 20517 |
| 4 | Ga0466723_024509 | 3300042618 | Bacteria | 1333 |
| 5 | Ga0466723_182636 | 3300042618 | Bacteria | 3008 |
| 6 | Ga0466723_245583 | 3300042618 | Bacteria | 1275 |
| 7 | Ga0466726_316957 | 3300042619 | Bacteria | 3983 |
| 8 | Ga0466728_230404 | 3300042620 | Bacteria | 4888 |
| 9 | Ga0466705_117985 | 3300042612 | Bacteria | 6209 |
| 10 | Ga0466705_310115 | 3300042612 | Bacteria | 9081 |
| 11 | Ga0466703_074898 | 3300042636 | Bacteria | 7248 |
| 12 | Ga0466708_067061 | 3300042652 | Bacteria | 2343 |
| 13 | Ga0466708_104104 | 3300042652 | Bacteria | 6889 |
| 14 | Ga0466708_196138 | 3300042652 | Bacteria | 1804 |
| 15 | Ga0466708_381373 | 3300042652 | Bacteria | 5445 |
| 16 | Ga0466727_177696 | 3300042655 | Bacteria | 2730 |
| 17 | Ga0466699_415992 | 3300042597 | Bacteria | 4497 |
| 18 | Ga0466707_181768 | 3300042601 | Bacteria | 11341 |
| 19 | Ga0466716_451916 | 3300042605 | Bacteria | 9095 |
| 20 | Ga0466719_131047 | 3300042606 | Bacteria | 1097 |
| 21 | Ga0466722_021406 | 3300042609 | Bacteria | 4961 |
| 22 | Ga0466722_147668 | 3300042609 | Bacteria | 15879 |
| 23 | JGI24698J34947_10056240 | 3300002449 | Bacteria | 1957 |
| 24 | JGI24698J34947_10092386 | 3300002449 | Bacteria | 1384 |
| 25 | JGI24698J34947_10098473 | 3300002449 | Bacteria | 1321 |
| 26 | JGI24695J34938_10000255 | 3300002450 | Bacteria | 51460 |
| 27 | Ga0466711_280487 | 3300042615 | Bacteria | 4099 |
| 28 | Ga0466715_149757 | 3300042616 | Bacteria | 1424 |
| 29 | Ga0466715_387350 | 3300042616 | Bacteria | 30817 |
| 30 | Ga0466715_473980 | 3300042616 | Bacteria | 4305 |
| 31 | Ga0466715_564925 | 3300042616 | Bacteria | 19180 |
| 32 | Ga0466723_125795 | 3300042618 | Bacteria | 34107 |
| 33 | Ga0466723_250830 | 3300042618 | Bacteria | 6800 |
| 34 | Ga0466729_087178 | 3300042621 | Bacteria | 3737 |
| 35 | Ga0466705_035586 | 3300042612 | Bacteria | 3687 |
| 36 | Ga0466703_060149 | 3300042636 | Bacteria | 10152 |
| 37 | Ga0466691_083155 | 3300042593 | Bacteria | 11761 |
| 38 | JGI24698J34947_10034307 | 3300002449 | Bacteria | 2656 |
| 39 | JGI24695J34938_10010445 | 3300002450 | Bacteria | 5079 |
| 40 | Ga0466711_050128 | 3300042615 | Bacteria | 17464 |
| 41 | Ga0466715_046983 | 3300042616 | Bacteria | 3984 |
| 42 | Ga0123356_10000052 | 3300010049 | Bacteria | 124725 |
| 43 | Ga0123354_10320614 | 3300010882 | Unclassified | 1431 |
| 44 | Ga0466705_191710 | 3300042612 | Bacteria | 6134 |
| 45 | Ga0466703_124200 | 3300042636 | Bacteria | 10716 |
| 46 | Ga0466703_152926 | 3300042636 | Bacteria | 4326 |
| 47 | Ga0466704_251802 | 3300042643 | Bacteria | 2803 |
| 48 | Ga0466704_439294 | 3300042643 | Bacteria | 1760 |
| 49 | Ga0466709_328324 | 3300042648 | Bacteria | 4791 |
| 50 | Ga0466708_298655 | 3300042652 | Bacteria | 60506 |
| 51 | Ga0466727_202434 | 3300042655 | Bacteria | 2349 |
| 52 | Ga0466690_016427 | 3300042590 | Bacteria | 6459 |
| 53 | Ga0466690_181805 | 3300042590 | Bacteria | 13764 |
| 54 | Ga0466690_265963 | 3300042590 | Bacteria | 9083 |
| 55 | Ga0466691_090847 | 3300042593 | Bacteria | 2605 |
| 56 | Ga0466716_335782 | 3300042605 | Bacteria | 1252 |
| 57 | Ga0466719_205152 | 3300042606 | Bacteria | 6295 |
| 58 | Ga0466719_228082 | 3300042606 | Bacteria | 2804 |
| 59 | Ga0466719_246313 | 3300042606 | Bacteria | 8645 |
| 60 | Ga0466722_000673 | 3300042609 | Bacteria | 3508 |
| 61 | JGI24698J34947_10002591 | 3300002449 | Bacteria | 9764 |
| 62 | Ga0466723_240466 | 3300042618 | Bacteria | 15139 |
| 63 | Ga0466703_182627 | 3300042636 | Bacteria | 6588 |
| 64 | Ga0466709_390673 | 3300042648 | Bacteria | 3013 |
| 65 | Ga0466727_196430 | 3300042655 | Bacteria | 1017 |
| 66 | Ga0466690_178219 | 3300042590 | Bacteria | 9315 |
| 67 | Ga0466692_041260 | 3300042591 | Unclassified | 1370 |
| 68 | Ga0466691_109581 | 3300042593 | Bacteria | 1606 |
| 69 | Ga0466691_222853 | 3300042593 | Bacteria | 1358 |
| 70 | Ga0466707_346024 | 3300042601 | Bacteria | 7246 |
| 71 | Ga0466719_281835 | 3300042606 | Bacteria | 5763 |
| 72 | Ga0466719_350582 | 3300042606 | Bacteria | 5925 |
| 73 | Ga0466719_540593 | 3300042606 | Bacteria | 1661 |
| 74 | Ga0466722_069109 | 3300042609 | Bacteria | 31526 |
| 75 | Ga0466712_320704 | 3300042614 | Bacteria | 39378 |
| 76 | Ga0466711_321614 | 3300042615 | Bacteria | 20394 |
| 77 | Ga0466726_011901 | 3300042619 | Bacteria | 41438 |
| 78 | Ga0466726_083611 | 3300042619 | Bacteria | 1391 |
| 79 | Ga0466728_175873 | 3300042620 | Bacteria | 22777 |
| 80 | Ga0123357_10176941 | 3300009784 | Bacteria | 2505 |
| 81 | Ga0123353_10409160 | 3300010167 | Bacteria | 2015 |
| 82 | Ga0466705_331119 | 3300042612 | Archaea | 1413 |
| 83 | Ga0466705_338302 | 3300042612 | Bacteria | 26015 |
| 84 | Ga0466703_404059 | 3300042636 | Bacteria | 1125 |
| 85 | Ga0466704_377125 | 3300042643 | Bacteria | 6556 |
| 86 | Ga0466704_379221 | 3300042643 | Bacteria | 70022 |
| 87 | Ga0466709_348984 | 3300042648 | Bacteria | 9186 |
| 88 | Ga0466708_148458 | 3300042652 | Bacteria | 5605 |
| 89 | Ga0466696_028258 | 3300042596 | Bacteria | 6015 |
| 90 | Ga0466699_033466 | 3300042597 | Bacteria | 1613 |
| 91 | Ga0466699_053617 | 3300042597 | Bacteria | 3872 |
| 92 | Ga0466699_243442 | 3300042597 | Bacteria | 1072 |
| 93 | Ga0466711_180635 | 3300042615 | Bacteria | 48770 |
| 94 | Ga0466711_293369 | 3300042615 | Bacteria | 12239 |
| 95 | Ga0466715_167883 | 3300042616 | Bacteria | 9801 |
| 96 | Ga0466715_431257 | 3300042616 | Bacteria | 11713 |
| 97 | Ga0466723_309204 | 3300042618 | Bacteria | 8492 |
| 98 | Ga0466726_047834 | 3300042619 | Bacteria | 3518 |
| 99 | Ga0466729_204597 | 3300042621 | Bacteria | 6247 |
| 100 | Ga0466703_048043 | 3300042636 | Bacteria | 4310 |
| 101 | Ga0466703_072668 | 3300042636 | Bacteria | 16008 |
| 102 | Ga0466704_305922 | 3300042643 | Bacteria | 4709 |
| 103 | Ga0466704_461425 | 3300042643 | Bacteria | 10412 |
| 104 | Ga0466727_151574 | 3300042655 | Bacteria | 1169 |
| 105 | Ga0466727_196957 | 3300042655 | Bacteria | 11430 |
| 106 | Ga0466690_030312 | 3300042590 | Bacteria | 2375 |
| 107 | Ga0466691_153851 | 3300042593 | Bacteria | 1706 |
| 108 | Ga0466696_411818 | 3300042596 | Bacteria | 1441 |
| 109 | Ga0466719_117784 | 3300042606 | Bacteria | 1647 |
| 110 | Ga0466722_022549 | 3300042609 | Bacteria | 126509 |
| 111 | Ga0466712_043300 | 3300042614 | Unclassified | 8090 |
| 112 | Ga0466711_081586 | 3300042615 | Bacteria | 1938 |
| 113 | Ga0466711_085263 | 3300042615 | Bacteria | 3596 |
| 114 | Ga0466711_103811 | 3300042615 | Bacteria | 8645 |
| 115 | Ga0466711_180148 | 3300042615 | Bacteria | 64420 |
| 116 | Ga0466711_418585 | 3300042615 | Bacteria | 11658 |
| 117 | Ga0466715_557874 | 3300042616 | Bacteria | 11493 |
| 118 | Ga0466723_263712 | 3300042618 | Bacteria | 1917 |
| 119 | Ga0466728_214019 | 3300042620 | Bacteria | 1441 |
| 120 | Ga0123353_10133334 | 3300010167 | Bacteria | 3985 |
| 121 | Ga0466735_104460 | 3300042624 | Bacteria | 4662 |
| 122 | Ga0466735_190547 | 3300042624 | Bacteria | 1311 |
| 123 | Ga0466703_079875 | 3300042636 | Bacteria | 15967 |
| 124 | Ga0466704_559490 | 3300042643 | Bacteria | 12614 |
| 125 | Ga0466691_130059 | 3300042593 | Bacteria | 42419 |
| 126 | Ga0466696_169846 | 3300042596 | Unclassified | 1126 |
| 127 | Ga0466707_356318 | 3300042601 | Bacteria | 1766 |
| 128 | Ga0466716_106902 | 3300042605 | Bacteria | 7866 |
| 129 | Ga0466716_355910 | 3300042605 | Bacteria | 3430 |
| 130 | Ga0466722_083947 | 3300042609 | Bacteria | 2088 |
| 131 | JGI24698J34947_10027868 | 3300002449 | Bacteria | 2996 |
| 132 | JGI24698J34947_10040325 | 3300002449 | Bacteria | 2411 |
| 133 | Ga0466712_123804 | 3300042614 | Unclassified | 6776 |
| 134 | Ga0466711_454385 | 3300042615 | Bacteria | 3098 |
| 135 | Ga0466723_013154 | 3300042618 | Bacteria | 95841 |
| 136 | Ga0466723_098174 | 3300042618 | Bacteria | 1930 |
| 137 | Ga0466726_478348 | 3300042619 | Bacteria | 58193 |
| 138 | Ga0123357_10275891 | 3300009784 | Bacteria | 1747 |
| 139 | Ga0466703_238778 | 3300042636 | Bacteria | 2436 |
| 140 | Ga0466703_379247 | 3300042636 | Bacteria | 6042 |
| 141 | Ga0466727_069284 | 3300042655 | Bacteria | 1685 |
| 142 | Ga0466727_239434 | 3300042655 | Bacteria | 2832 |
| 143 | Ga0466690_021655 | 3300042590 | Bacteria | 3765 |
| 144 | Ga0466691_010342 | 3300042593 | Bacteria | 18793 |
| 145 | Ga0466691_028841 | 3300042593 | Bacteria | 6958 |
| 146 | Ga0466691_137200 | 3300042593 | Bacteria | 6578 |
| 147 | Ga0466696_005517 | 3300042596 | Bacteria | 4029 |
| 148 | Ga0466696_047981 | 3300042596 | Bacteria | 4184 |
| 149 | Ga0466696_184202 | 3300042596 | Bacteria | 5776 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02361 | CbiQ | Cobalt transport protein | 19 | 228 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.