Protein Family IF09630
Metagenome
Isolate
131
Members
75
Samples
115
Scaffolds
301.64
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_221860|Ga0466709_221860_232212_233249
- Length
- 345 aa
- Sequence
- MICPPYLKSGDSVAIVAPARKIALSEISQSIEILQSWGLKVIFSKNLFESYDQFAGTDMQRADDFQEAINNPEIKAIFCARGGYGSVRIIDQIDFSPLLSSPKWIIGFSDITVFHSKLNTLGIESLHAPVLTTLSDAPPETLIKIKNTLFGEALQYNIQLNKANSLNIDGECTGELIGGNLSILYSLLGSNCDIDFRNKILFIEDLDEYFYHIDRIMTALKRAGKLSELNGLIVGDIAKMNDNSIPFGKTAEEIIHDIVGEYNYPVCFNFPAGHIPNNNPLILGRNISLTINKTNINIDFFTKTTDKAIPNSKKRIIKLSLVLLAFFVMIWVVYKIASHFILKMF
Sample Types
Isolate
11.4%
Metagenome
88.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.7%
Unclassified
15.7%
Kalotermitidae
11.4%
Formicidae
10.0%
Armadillidiidae
7.1%
Culicidae
5.7%
Drosophilidae
4.3%
Rhinotermitidae
2.9%
Elmidae
2.9%
Daphniidae
1.4%
Hydrophilidae
1.4%
Tenebrionidae
1.4%
Taxonomy
Archaea
0
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2811995047 | Flavobacterium succinicans DD5b | Isolate | Daphniidae |
| 2 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 9 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2820744581 | Unclassified Bacteroidetes Th196P3bin138 | Isolate | Unclassified |
| 13 | 2820776227 | Unclassified Bacteroidetes Emb289P4bin3 | Isolate | Unclassified |
| 14 | 2873776654 | Pedobacter sp. HDW13 | Isolate | Hydrophilidae |
| 15 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300012846 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972K_E0 MG | Metagenome | Armadillidiidae |
| 18 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 19 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 20 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 21 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 22 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 23 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 24 | 2718218155 | Flavobacteriaceae bacterium UJ101 | Isolate | |
| 25 | 2864878056 | Flavobacterium notoginsengisoli S00128 | Isolate | Elmidae |
| 26 | 2864886855 | Flavobacterium nitrogenifigens S00142 | Isolate | Elmidae |
| 27 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 28 | 3300007143 | Drosophila gut microbial communities from New York, USA - Drosophila putrida female 3 gut | Metagenome | Drosophilidae |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 31 | 2820753519 | Unclassified Bacteroidetes Nc150P4bin20 | Isolate | Unclassified |
| 32 | 2820797595 | Unclassified Bacteroidetes Co191P3bin3 | Isolate | Unclassified |
| 33 | 3300007150 | Drosophila gut microbial communities from New York, USA - Drosophila falleni female 3 gut | Metagenome | Drosophilidae |
| 34 | 3300012803 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E11 MG | Metagenome | |
| 35 | 3300012805 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971I_E11 MG | Metagenome | |
| 36 | 3300012814 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E6 MG | Metagenome | |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 39 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 40 | 3300007080 | Ant gut microbial communities from Cephalotes clypeatus, Brazil | Metagenome | Formicidae |
| 41 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 42 | 3300007192 | Ant gut microbial communities from Cephalotes persimplex, Brazil | Metagenome | Formicidae |
| 43 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 44 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 45 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 46 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 47 | 3300012839 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E11 MG | Metagenome | Culicidae |
| 48 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 49 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 50 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 51 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 52 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 53 | 2820755292 | Unclassified Bacteroidetes Nc150P3bin3 | Isolate | Unclassified |
| 54 | 2820795054 | Unclassified Bacteroidetes Cu122P1bin21 | Isolate | Unclassified |
| 55 | 2899132286 | Myroides albus BIT-d1 | Isolate | Tenebrionidae |
| 56 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 57 | 3300007085 | Drosophila gut microbial communities from New York, USA - Drosophila neotestacea male 3 gut | Metagenome | Drosophilidae |
| 58 | 3300012837 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E6 MG | Metagenome | Armadillidiidae |
| 59 | 3300012849 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973K_E1 MG | Metagenome | Culicidae |
| 60 | 3300012850 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973I_E0 MG | Metagenome | Culicidae |
| 61 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 62 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 63 | 2820765201 | Unclassified Bacteroidetes Lab288P3bin82 | Isolate | Unclassified |
| 64 | 3300007095 | Ant gut microbial communities from Cephalotes minutus, Brazil | Metagenome | Formicidae |
| 65 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 66 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 67 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 68 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 69 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 70 | 2820792843 | Unclassified Bacteroidetes Cu122P3bin1 | Isolate | Unclassified |
| 71 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 72 | 3300007068 | Ant gut microbial communities from Cephalotes simillimus, Peru | Metagenome | Formicidae |
| 73 | 3300012825 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E1 MG | Metagenome | |
| 74 | 3300012845 | Enriched mosquito-associated microbial communities from UW Madison campus, WI, USA - HID1973M_E6 MG | Metagenome | Culicidae |
| 75 | 3300012848 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E1 MG | Metagenome | Armadillidiidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_092635 | 3300042611 | Bacteria | 1882 |
| 2 | Ga0160472_102003 | 3300012839 | Bacteria | 5024 |
| 3 | Ga0466690_041700 | 3300042590 | Bacteria | 2711 |
| 4 | Ga0466695_062912 | 3300042595 | Bacteria | 1765 |
| 5 | Ga0466696_376346 | 3300042596 | Bacteria | 14636 |
| 6 | Ga0466701_053978 | 3300042598 | Bacteria | 47344 |
| 7 | Ga0466701_077120 | 3300042598 | Bacteria | 3536 |
| 8 | Ga0466714_131070 | 3300042603 | Bacteria | 8259 |
| 9 | Ga0466697_023069 | 3300042611 | Bacteria | 3490 |
| 10 | Ga0466705_450960 | 3300042612 | Bacteria | 4184 |
| 11 | Ga0466723_192552 | 3300042618 | Bacteria | 7965 |
| 12 | Ga0466728_379967 | 3300042620 | Bacteria | 2251 |
| 13 | Ga0123353_10298052 | 3300010167 | Bacteria | 2463 |
| 14 | Ga0123354_10170314 | 3300010882 | Bacteria | 2538 |
| 15 | Ga0123354_10333306 | 3300010882 | Unclassified | 1379 |
| 16 | Ga0103268_1001071 | 3300007192 | Bacteria | 7245 |
| 17 | Ga0160441_100011 | 3300012825 | Bacteria | 461375 |
| 18 | Ga0160457_1000756 | 3300012858 | Bacteria | 11831 |
| 19 | Ga0466696_093422 | 3300042596 | Bacteria | 5957 |
| 20 | Ga0466696_256305 | 3300042596 | Bacteria | 7114 |
| 21 | Ga0466714_046827 | 3300042603 | Bacteria | 1435 |
| 22 | Ga0123356_10209660 | 3300010049 | Bacteria | 1996 |
| 23 | Ga0123353_10001252 | 3300010167 | Bacteria | 31127 |
| 24 | Ga0123353_10049243 | 3300010167 | Bacteria | 6712 |
| 25 | JGI24695J34938_10002006 | 3300002450 | Bacteria | 16153 |
| 26 | JGI24696J40584_12938526 | 3300002834 | Bacteria | 1630 |
| 27 | JGI24696J40584_12939423 | 3300002834 | Bacteria | 1652 |
| 28 | Ga0068305_10008280 | 3300005083 | Bacteria | 10270 |
| 29 | Ga0104045_1005232 | 3300007085 | Bacteria | 3519 |
| 30 | Ga0104045_1005795 | 3300007085 | Bacteria | 5205 |
| 31 | Ga0104019_1001755 | 3300007150 | Unclassified | 3168 |
| 32 | Ga0103267_1001206 | 3300007190 | Bacteria | 10576 |
| 33 | Ga0123357_10000477 | 3300009784 | Bacteria | 39043 |
| 34 | Ga0466697_243917 | 3300042611 | Bacteria | 1216 |
| 35 | Ga0466697_258576 | 3300042611 | Bacteria | 357278 |
| 36 | Ga0160453_100069 | 3300012814 | Bacteria | 106591 |
| 37 | Ga0466696_181092 | 3300042596 | Bacteria | 12612 |
| 38 | Ga0466701_045240 | 3300042598 | Bacteria | 5701 |
| 39 | Ga0466713_116444 | 3300042602 | Bacteria | 17088 |
| 40 | Ga0466712_128732 | 3300042614 | Bacteria | 1559 |
| 41 | Ga0123354_10006986 | 3300010882 | Bacteria | 16875 |
| 42 | Ga0103265_1000910 | 3300007068 | Bacteria | 4908 |
| 43 | Ga0160453_100567 | 3300012814 | Bacteria | 25698 |
| 44 | Ga0466699_358114 | 3300042597 | Bacteria | 1240 |
| 45 | Ga0466717_127900 | 3300042604 | Bacteria | 2039 |
| 46 | Ga0466722_034024 | 3300042609 | Bacteria | 12789 |
| 47 | Ga0466731_352681 | 3300042622 | Bacteria | 2639 |
| 48 | Ga0466724_26560 | 3300042649 | Bacteria | 2134 |
| 49 | Ga0123353_10114930 | 3300010167 | Bacteria | 4332 |
| 50 | Ga0123354_10125073 | 3300010882 | Unclassified | 3290 |
| 51 | JGI24702J35022_10142347 | 3300002462 | Bacteria | 1339 |
| 52 | Ga0103268_1001254 | 3300007192 | Bacteria | 6446 |
| 53 | Ga0466697_264169 | 3300042611 | Bacteria | 2683 |
| 54 | Ga0466732_196603 | 3300042656 | Bacteria | 1490 |
| 55 | Ga0160467_100018 | 3300012829 | Bacteria | 326466 |
| 56 | Ga0160443_100303 | 3300012848 | Bacteria | 46301 |
| 57 | Ga0160434_100104 | 3300012850 | Bacteria | 50591 |
| 58 | Ga0160457_1000010 | 3300012858 | Bacteria | 500717 |
| 59 | Ga0466657_159267 | 3300042582 | Bacteria | 2904 |
| 60 | Ga0466657_337380 | 3300042582 | Bacteria | 20451 |
| 61 | Ga0466694_043555 | 3300042594 | Bacteria | 12509 |
| 62 | Ga0466701_100585 | 3300042598 | Bacteria | 25075 |
| 63 | Ga0466710_413891 | 3300042613 | Bacteria | 2500 |
| 64 | Ga0466715_461705 | 3300042616 | Bacteria | 25922 |
| 65 | Ga0123353_10101616 | 3300010167 | Bacteria | 4635 |
| 66 | Ga0466733_148985 | 3300042659 | Bacteria | 20037 |
| 67 | Ga0160433_100067 | 3300012846 | Bacteria | 112579 |
| 68 | Ga0160447_100011 | 3300012849 | Bacteria | 463863 |
| 69 | Ga0466701_074746 | 3300042598 | Bacteria | 3242 |
| 70 | Ga0466713_147564 | 3300042602 | Bacteria | 35409 |
| 71 | Ga0466720_001946 | 3300042607 | Bacteria | 5181 |
| 72 | Ga0466710_053565 | 3300042613 | Bacteria | 3063 |
| 73 | Ga0466710_074540 | 3300042613 | Bacteria | 5531 |
| 74 | Ga0466704_502860 | 3300042643 | Bacteria | 19936 |
| 75 | Ga0466725_061088 | 3300042654 | Bacteria | 1343 |
| 76 | Ga0123356_10014952 | 3300010049 | Bacteria | 7446 |
| 77 | JGI24702J35022_10011405 | 3300002462 | Bacteria | 4952 |
| 78 | JGI24702J35022_10029611 | 3300002462 | Bacteria | 2938 |
| 79 | Ga0466733_074247 | 3300042659 | Bacteria | 8839 |
| 80 | Ga0160455_100119 | 3300012837 | Bacteria | 109702 |
| 81 | Ga0160460_100018 | 3300012845 | Bacteria | 384310 |
| 82 | Ga0466693_119031 | 3300042592 | Bacteria | 1234 |
| 83 | Ga0466694_147748 | 3300042594 | Unclassified | 5647 |
| 84 | Ga0466694_166089 | 3300042594 | Bacteria | 1224 |
| 85 | Ga0466699_233882 | 3300042597 | Bacteria | 1330 |
| 86 | Ga0466717_068364 | 3300042604 | Bacteria | 3709 |
| 87 | Ga0466710_028580 | 3300042613 | Bacteria | 1596 |
| 88 | Ga0466731_355246 | 3300042622 | Bacteria | 5575 |
| 89 | Ga0466731_412590 | 3300042622 | Bacteria | 3561 |
| 90 | Ga0466709_221860 | 3300042648 | Bacteria | 264751 |
| 91 | Ga0123353_10336372 | 3300010167 | Bacteria | 2283 |
| 92 | Ga0160465_100028 | 3300012803 | Bacteria | 208271 |
| 93 | JGI24696J40584_12959518 | 3300002834 | Bacteria | 5235 |
| 94 | Ga0102740_1001379 | 3300007140 | Bacteria | 6202 |
| 95 | Ga0102737_1000047 | 3300007142 | Bacteria | 35246 |
| 96 | Ga0104019_1003246 | 3300007150 | Bacteria | 6264 |
| 97 | Ga0103267_1000174 | 3300007190 | Bacteria | 32636 |
| 98 | Ga0103267_1002548 | 3300007190 | Bacteria | 4681 |
| 99 | Ga0160433_100066 | 3300012846 | Bacteria | 116006 |
| 100 | Ga0466701_086669 | 3300042598 | Bacteria | 16776 |
| 101 | Ga0466713_096332 | 3300042602 | Bacteria | 24639 |
| 102 | Ga0466720_052584 | 3300042607 | Bacteria | 2970 |
| 103 | Ga0466710_244864 | 3300042613 | Bacteria | 10078 |
| 104 | Ga0466710_278710 | 3300042613 | Bacteria | 16262 |
| 105 | Ga0466718_134197 | 3300042617 | Bacteria | 3024 |
| 106 | Ga0466729_264434 | 3300042621 | Bacteria | 4331 |
| 107 | Ga0466724_23916 | 3300042649 | Bacteria | 557842 |
| 108 | Ga0123356_10014819 | 3300010049 | Bacteria | 7487 |
| 109 | Ga0160464_100256 | 3300012805 | Bacteria | 49696 |
| 110 | JGI24702J35022_10048355 | 3300002462 | Bacteria | 2264 |
| 111 | JGI24696J40584_12951268 | 3300002834 | Bacteria | 2227 |
| 112 | Ga0068305_10662144 | 3300005083 | Bacteria | 3016 |
| 113 | Ga0102735_1000010 | 3300007080 | Bacteria | 108713 |
| 114 | Ga0102739_1000003 | 3300007095 | Bacteria | 77722 |
| 115 | Ga0104048_1000483 | 3300007143 | Bacteria | 5100 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.