Protein Family IF09620
Metagenome
Isolate
119
Members
36
Samples
116
Scaffolds
120.06
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_195990|Ga0466709_195990_522_932
- Length
- 136 aa
- Sequence
- VDFAALFRIVQSWGPSAISSCLVVVVLYLIKRVEKNSEEDARRAKAFQDQLETRVGELRSDVNRILDDYGKRLLYVEKEYTRNEVFLRELSGWRAEINRLSDQITSLFASVSQNIFQMLNRGKHEVIVANSIDITE
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
42.4%
Unclassified
9.1%
Rhinotermitidae
3.0%
Taxonomy
Archaea
0
Bacteria
88
Eukaryota
0
Viruses
0
Unclassified
31
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 11 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 22 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_154310 | 3300042612 | Bacteria | 2200 |
| 2 | Ga0123356_10026180 | 3300010049 | Bacteria | 5480 |
| 3 | Ga0123356_10091615 | 3300010049 | Bacteria | 2898 |
| 4 | Ga0466690_007508 | 3300042590 | Bacteria | 1492 |
| 5 | Ga0466699_283371 | 3300042597 | Bacteria | 26474 |
| 6 | Ga0466715_319294 | 3300042616 | Bacteria | 1691 |
| 7 | Ga0466718_117701 | 3300042617 | Bacteria | 1939 |
| 8 | Ga0466728_400872 | 3300042620 | Bacteria | 6170 |
| 9 | Ga0466731_164307 | 3300042622 | Bacteria | 5477 |
| 10 | Ga0466707_009649 | 3300042601 | Bacteria | 2125 |
| 11 | Ga0466719_073663 | 3300042606 | Bacteria | 1326 |
| 12 | Ga0466719_448294 | 3300042606 | Bacteria | 1424 |
| 13 | JGI24698J34947_10010308 | 3300002449 | Unclassified | 5125 |
| 14 | JGI24698J34947_10102948 | 3300002449 | Unclassified | 1279 |
| 15 | JGI24695J34938_10032369 | 3300002450 | Bacteria | 2416 |
| 16 | Ga0123356_10010560 | 3300010049 | Unclassified | 9050 |
| 17 | Ga0466690_366827 | 3300042590 | Bacteria | 1803 |
| 18 | Ga0466712_115120 | 3300042614 | Bacteria | 2029 |
| 19 | Ga0466711_166180 | 3300042615 | Bacteria | 7153 |
| 20 | Ga0466715_114222 | 3300042616 | Unclassified | 1902 |
| 21 | Ga0466723_359311 | 3300042618 | Bacteria | 2580 |
| 22 | Ga0466703_283906 | 3300042636 | Bacteria | 2577 |
| 23 | Ga0466704_275472 | 3300042643 | Bacteria | 20637 |
| 24 | Ga0466704_295615 | 3300042643 | Bacteria | 2425 |
| 25 | Ga0466708_169512 | 3300042652 | Bacteria | 3894 |
| 26 | Ga0466719_190321 | 3300042606 | Bacteria | 3815 |
| 27 | JGI24698J34947_10018579 | 3300002449 | Bacteria | 3755 |
| 28 | JGI24698J34947_10112481 | 3300002449 | Bacteria | 1199 |
| 29 | Ga0466690_176618 | 3300042590 | Bacteria | 3547 |
| 30 | Ga0466694_045165 | 3300042594 | Bacteria | 5631 |
| 31 | Ga0466712_098140 | 3300042614 | Bacteria | 3755 |
| 32 | Ga0466711_461137 | 3300042615 | Bacteria | 2250 |
| 33 | Ga0466703_065752 | 3300042636 | Bacteria | 1458 |
| 34 | Ga0466704_125036 | 3300042643 | Bacteria | 2832 |
| 35 | Ga0466708_193174 | 3300042652 | Bacteria | 16933 |
| 36 | Ga0466716_548542 | 3300042605 | Bacteria | 1536 |
| 37 | Ga0466719_503489 | 3300042606 | Bacteria | 1424 |
| 38 | Ga0466720_218620 | 3300042607 | Unclassified | 3834 |
| 39 | JGI24695J34938_10034802 | 3300002450 | Bacteria | 2308 |
| 40 | Ga0072941_1099551 | 3300005201 | Bacteria | 2133 |
| 41 | Ga0123357_10022209 | 3300009784 | Bacteria | 8500 |
| 42 | Ga0123357_10837016 | 3300009784 | Unclassified | 612 |
| 43 | Ga0123356_12743420 | 3300010049 | Unclassified | 617 |
| 44 | Ga0123353_11653256 | 3300010167 | Unclassified | 805 |
| 45 | Ga0415639_193889 | 3300038395 | Bacteria | 1350 |
| 46 | Ga0466690_289322 | 3300042590 | Bacteria | 2294 |
| 47 | Ga0466731_383982 | 3300042622 | Unclassified | 1420 |
| 48 | Ga0466709_305990 | 3300042648 | Bacteria | 1152 |
| 49 | Ga0466708_177540 | 3300042652 | Bacteria | 4747 |
| 50 | Ga0466716_131340 | 3300042605 | Unclassified | 3415 |
| 51 | Ga0466719_004766 | 3300042606 | Bacteria | 2382 |
| 52 | Ga0466719_466209 | 3300042606 | Bacteria | 1515 |
| 53 | Ga0466720_088972 | 3300042607 | Unclassified | 2614 |
| 54 | Ga0466722_003945 | 3300042609 | Bacteria | 17128 |
| 55 | JGI24698J34947_10010100 | 3300002449 | Bacteria | 5175 |
| 56 | JGI24695J34938_10231429 | 3300002450 | Bacteria | 779 |
| 57 | Ga0072941_1027804 | 3300005201 | Bacteria | 8850 |
| 58 | Ga0466705_069700 | 3300042612 | Bacteria | 2282 |
| 59 | Ga0466732_441843 | 3300042656 | Bacteria | 7695 |
| 60 | Ga0123356_11269863 | 3300010049 | Bacteria | 900 |
| 61 | Ga0123356_12717220 | 3300010049 | Unclassified | 620 |
| 62 | Ga0264413_114010 | 3300024493 | Unclassified | 6268 |
| 63 | Ga0466691_128725 | 3300042593 | Bacteria | 10478 |
| 64 | Ga0466696_110009 | 3300042596 | Bacteria | 6459 |
| 65 | Ga0466696_199579 | 3300042596 | Bacteria | 1381 |
| 66 | Ga0466718_116901 | 3300042617 | Bacteria | 1209 |
| 67 | Ga0466716_134994 | 3300042605 | Bacteria | 1455 |
| 68 | JGI24698J34947_10020558 | 3300002449 | Unclassified | 3554 |
| 69 | JGI24695J34938_10043856 | 3300002450 | Unclassified | 1992 |
| 70 | JGI24695J34938_10047407 | 3300002450 | Bacteria | 1897 |
| 71 | JGI24695J34938_10157181 | 3300002450 | Unclassified | 933 |
| 72 | JGI24695J34938_10259593 | 3300002450 | Unclassified | 740 |
| 73 | Ga0466691_087138 | 3300042593 | Bacteria | 4004 |
| 74 | Ga0466691_215801 | 3300042593 | Bacteria | 3043 |
| 75 | Ga0466712_281507 | 3300042614 | Unclassified | 8529 |
| 76 | Ga0466715_146752 | 3300042616 | Bacteria | 1870 |
| 77 | Ga0466728_112740 | 3300042620 | Bacteria | 1027 |
| 78 | Ga0466722_142834 | 3300042609 | Unclassified | 14087 |
| 79 | JGI24698J34947_10044633 | 3300002449 | Bacteria | 2267 |
| 80 | Ga0072941_1126960 | 3300005201 | Bacteria | 2196 |
| 81 | Ga0123353_10212122 | 3300010167 | Bacteria | 3036 |
| 82 | Ga0264413_109697 | 3300024493 | Unclassified | 16018 |
| 83 | Ga0415639_043527 | 3300038395 | Bacteria | 6696 |
| 84 | Ga0466693_017655 | 3300042592 | Bacteria | 18010 |
| 85 | Ga0466712_103021 | 3300042614 | Bacteria | 17445 |
| 86 | Ga0466715_233019 | 3300042616 | Bacteria | 3503 |
| 87 | Ga0466723_213607 | 3300042618 | Bacteria | 5183 |
| 88 | Ga0466703_272171 | 3300042636 | Bacteria | 1477 |
| 89 | Ga0466704_297897 | 3300042643 | Unclassified | 1299 |
| 90 | Ga0466720_006817 | 3300042607 | Bacteria | 33729 |
| 91 | FAAS_10005608 | 3300001880 | Bacteria | 1811 |
| 92 | FAAS_10239093 | 3300001880 | Unclassified | 572 |
| 93 | FAAS_10451628 | 3300001880 | Unclassified | 567 |
| 94 | JGI24695J34938_10067990 | 3300002450 | Bacteria | 1498 |
| 95 | JGI24695J34938_10284430 | 3300002450 | Unclassified | 710 |
| 96 | Ga0466705_265504 | 3300042612 | Unclassified | 1703 |
| 97 | Ga0123356_10005197 | 3300010049 | Bacteria | 13308 |
| 98 | Ga0123356_10330727 | 3300010049 | Bacteria | 1640 |
| 99 | Ga0466693_065827 | 3300042592 | Bacteria | 6435 |
| 100 | Ga0466691_119033 | 3300042593 | Bacteria | 1180 |
| 101 | Ga0466699_127500 | 3300042597 | Bacteria | 6926 |
| 102 | Ga0466715_543216 | 3300042616 | Bacteria | 2419 |
| 103 | Ga0466703_098428 | 3300042636 | Bacteria | 1861 |
| 104 | Ga0466704_185300 | 3300042643 | Bacteria | 2422 |
| 105 | Ga0466704_419638 | 3300042643 | Bacteria | 1366 |
| 106 | Ga0466709_195990 | 3300042648 | Unclassified | 1089 |
| 107 | Ga0466721_116821 | 3300042608 | Bacteria | 1820 |
| 108 | JGI24698J34947_10011137 | 3300002449 | Unclassified | 4936 |
| 109 | JGI24698J34947_10215453 | 3300002449 | Bacteria | 741 |
| 110 | JGI24695J34938_10004174 | 3300002450 | Bacteria | 9614 |
| 111 | JGI24695J34938_10006230 | 3300002450 | Bacteria | 7239 |
| 112 | JGI24695J34938_10026233 | 3300002450 | Bacteria | 2771 |
| 113 | JGI24695J34938_10107295 | 3300002450 | Unclassified | 1139 |
| 114 | JGI24695J34938_10206381 | 3300002450 | Unclassified | 820 |
| 115 | JGI24695J34938_10353216 | 3300002450 | Unclassified | 646 |
| 116 | Ga0072941_1017037 | 3300005201 | Bacteria | 14253 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300010049 | Ga0123356_10010560 | Ga0123356_1001056010 | 99 |
| 2 | 3300042597 | Ga0466699_283371 | Ga0466699_283371_600_944 | 100 |
| 3 | 3300042614 | Ga0466712_098140 | Ga0466712_098140_2622_2936 | 104 |
| 4 | 3300010049 | Ga0123356_10330727 | Ga0123356_103307273 | 105 |
| 5 | 3300010049 | Ga0123356_12717220 | Ga0123356_127172201 | 110 |
| 6 | 3300042594 | Ga0466694_045165 | Ga0466694_045165_1514_1852 | 112 |
| 7 | 3300042652 | Ga0466708_193174 | Ga0466708_193174_14566_14946 | 112 |
| 8 | 3300002450 | JGI24695J34938_10004174 | JGI24695J34938_100041744 | 113 |
| 9 | 3300002450 | JGI24695J34938_10026233 | JGI24695J34938_100262332 | 113 |
| 10 | 3300002450 | JGI24695J34938_10032369 | JGI24695J34938_100323693 | 113 |
| 11 | 3300002450 | JGI24695J34938_10034802 | JGI24695J34938_100348025 | 113 |
| 12 | 3300002450 | JGI24695J34938_10107295 | JGI24695J34938_101072953 | 113 |
| 13 | 3300024493 | Ga0264413_114010 | Ga0264413_1140105 | 113 |
| 14 | 3300038395 | Ga0415639_193889 | Ga0415639_193889_853_1218 | 113 |
| 15 | 3300042607 | Ga0466720_006817 | Ga0466720_006817_6598_6939 | 113 |
| 16 | 3300042607 | Ga0466720_088972 | Ga0466720_088972_278_619 | 113 |
| 17 | 3300042607 | Ga0466720_218620 | Ga0466720_218620_278_619 | 113 |
| 18 | 3300042617 | Ga0466718_117701 | Ga0466718_117701_1125_1466 | 113 |
| 19 | 3300042622 | Ga0466731_164307 | Ga0466731_164307_3554_3895 | 113 |
| 20 | 3300042622 | Ga0466731_383982 | Ga0466731_383982_360_701 | 113 |
| 21 | 3300042656 | Ga0466732_441843 | Ga0466732_441843_4572_4913 | 113 |
| 22 | iso_pr_bacteria | 2781125661 | 2781334578 | 113 |
| 23 | 3300001880 | FAAS_10005608 | FAAS_100056084 | 114 |
| 24 | 3300001880 | FAAS_10239093 | FAAS_102390931 | 114 |
| 25 | 3300001880 | FAAS_10451628 | FAAS_104516281 | 114 |
| 26 | 3300002449 | JGI24698J34947_10044633 | JGI24698J34947_100446333 | 114 |
| 27 | 3300002450 | JGI24695J34938_10067990 | JGI24695J34938_100679904 | 114 |
| 28 | 3300009784 | Ga0123357_10022209 | Ga0123357_100222093 | 114 |
| 29 | 3300009784 | Ga0123357_10837016 | Ga0123357_108370162 | 114 |
| 30 | 3300010049 | Ga0123356_10005197 | Ga0123356_1000519719 | 114 |
| 31 | 3300010049 | Ga0123356_10026180 | Ga0123356_100261804 | 114 |
| 32 | 3300010049 | Ga0123356_10091615 | Ga0123356_100916152 | 114 |
| 33 | 3300024493 | Ga0264413_109697 | Ga0264413_10969722 | 114 |
| 34 | 3300038395 | Ga0415639_043527 | Ga0415639_043527_1289_1633 | 114 |
| 35 | 3300042597 | Ga0466699_127500 | Ga0466699_127500_600_944 | 114 |
| 36 | 3300042608 | Ga0466721_116821 | Ga0466721_116821_155_499 | 114 |
| 37 | iso_pr_bacteria | 2781125658 | 2781325164 | 114 |
| 38 | 3300002449 | JGI24698J34947_10010100 | JGI24698J34947_100101004 | 115 |
| 39 | 3300002449 | JGI24698J34947_10010308 | JGI24698J34947_100103089 | 115 |
| 40 | 3300002449 | JGI24698J34947_10011137 | JGI24698J34947_1001113711 | 115 |
| 41 | 3300002449 | JGI24698J34947_10018579 | JGI24698J34947_100185798 | 115 |
| 42 | 3300010049 | Ga0123356_11269863 | Ga0123356_112698633 | 115 |
| 43 | 3300010167 | Ga0123353_10212122 | Ga0123353_102121224 | 115 |
| 44 | 3300010167 | Ga0123353_11653256 | Ga0123353_116532562 | 115 |
| 45 | 3300042652 | Ga0466708_169512 | Ga0466708_169512_1962_2342 | 116 |
| 46 | 3300042592 | Ga0466693_017655 | Ga0466693_017655_6404_6763 | 119 |
| 47 | 3300002450 | JGI24695J34938_10006230 | JGI24695J34938_100062305 | 120 |
| 48 | 3300002450 | JGI24695J34938_10043856 | JGI24695J34938_100438565 | 120 |
| 49 | 3300002450 | JGI24695J34938_10047407 | JGI24695J34938_100474074 | 120 |
| 50 | 3300002450 | JGI24695J34938_10157181 | JGI24695J34938_101571812 | 120 |
| 51 | 3300002450 | JGI24695J34938_10206381 | JGI24695J34938_102063812 | 120 |
| 52 | 3300002450 | JGI24695J34938_10259593 | JGI24695J34938_102595931 | 120 |
| 53 | 3300002450 | JGI24695J34938_10284430 | JGI24695J34938_102844301 | 120 |
| 54 | 3300002450 | JGI24695J34938_10353216 | JGI24695J34938_103532161 | 120 |
| 55 | 3300010049 | Ga0123356_12743420 | Ga0123356_127434202 | 120 |
| 56 | 3300042614 | Ga0466712_103021 | Ga0466712_103021_78_440 | 120 |
| 57 | 3300002449 | JGI24698J34947_10102948 | JGI24698J34947_101029482 | 123 |
| 58 | 3300002449 | JGI24698J34947_10215453 | JGI24698J34947_102154532 | 123 |
| 59 | 3300005201 | Ga0072941_1126960 | Ga0072941_11269605 | 123 |
| 60 | 3300042592 | Ga0466693_065827 | Ga0466693_065827_3473_3844 | 123 |
| 61 | 3300042609 | Ga0466722_003945 | Ga0466722_003945_6044_6415 | 123 |
| 62 | 3300042609 | Ga0466722_142834 | Ga0466722_142834_8560_8931 | 123 |
| 63 | 3300005201 | Ga0072941_1017037 | Ga0072941_10170375 | 124 |
| 64 | 3300042590 | Ga0466690_366827 | Ga0466690_366827_1180_1554 | 124 |
| 65 | 3300042612 | Ga0466705_069700 | Ga0466705_069700_693_1067 | 124 |
| 66 | 3300042612 | Ga0466705_265504 | Ga0466705_265504_1204_1578 | 124 |
| 67 | 3300042614 | Ga0466712_115120 | Ga0466712_115120_1255_1629 | 124 |
| 68 | 3300042614 | Ga0466712_281507 | Ga0466712_281507_7336_7710 | 124 |
| 69 | 3300042615 | Ga0466711_461137 | Ga0466711_461137_869_1243 | 124 |
| 70 | 3300042617 | Ga0466718_116901 | Ga0466718_116901_272_646 | 124 |
| 71 | 3300042620 | Ga0466728_112740 | Ga0466728_112740_221_595 | 124 |
| 72 | 3300042620 | Ga0466728_112740 | Ga0466728_112740_221_595 | 124 |
| 73 | 3300042620 | Ga0466728_400872 | Ga0466728_400872_4729_5103 | 124 |
| 74 | 3300042643 | Ga0466704_185300 | Ga0466704_185300_1265_1639 | 124 |
| 75 | 3300002449 | JGI24698J34947_10020558 | JGI24698J34947_100205581 | 125 |
| 76 | 3300002449 | JGI24698J34947_10112481 | JGI24698J34947_101124813 | 125 |
| 77 | 3300002450 | JGI24695J34938_10231429 | JGI24695J34938_102314292 | 125 |
| 78 | 3300005201 | Ga0072941_1027804 | Ga0072941_102780415 | 125 |
| 79 | 3300042590 | Ga0466690_289322 | Ga0466690_289322_1615_1992 | 125 |
| 80 | 3300042605 | Ga0466716_131340 | Ga0466716_131340_2472_2849 | 125 |
| 81 | 3300042606 | Ga0466719_004766 | Ga0466719_004766_332_709 | 125 |
| 82 | 3300042606 | Ga0466719_190321 | Ga0466719_190321_1376_1753 | 125 |
| 83 | 3300042616 | Ga0466715_543216 | Ga0466715_543216_604_981 | 125 |
| 84 | 3300005201 | Ga0072941_1099551 | Ga0072941_10995512 | 126 |
| 85 | 3300042590 | Ga0466690_007508 | Ga0466690_007508_540_920 | 126 |
| 86 | 3300042590 | Ga0466690_176618 | Ga0466690_176618_130_510 | 126 |
| 87 | 3300042593 | Ga0466691_087138 | Ga0466691_087138_644_1024 | 126 |
| 88 | 3300042593 | Ga0466691_119033 | Ga0466691_119033_226_606 | 126 |
| 89 | 3300042593 | Ga0466691_128725 | Ga0466691_128725_9524_9904 | 126 |
| 90 | 3300042593 | Ga0466691_215801 | Ga0466691_215801_524_904 | 126 |
| 91 | 3300042596 | Ga0466696_110009 | Ga0466696_110009_3070_3450 | 126 |
| 92 | 3300042596 | Ga0466696_199579 | Ga0466696_199579_801_1181 | 126 |
| 93 | 3300042601 | Ga0466707_009649 | Ga0466707_009649_943_1323 | 126 |
| 94 | 3300042605 | Ga0466716_134994 | Ga0466716_134994_119_499 | 126 |
| 95 | 3300042605 | Ga0466716_548542 | Ga0466716_548542_534_914 | 126 |
| 96 | 3300042606 | Ga0466719_073663 | Ga0466719_073663_387_767 | 126 |
| 97 | 3300042606 | Ga0466719_466209 | Ga0466719_466209_824_1204 | 126 |
| 98 | 3300042606 | Ga0466719_503489 | Ga0466719_503489_11_391 | 126 |
| 99 | 3300042612 | Ga0466705_154310 | Ga0466705_154310_712_1092 | 126 |
| 100 | 3300042615 | Ga0466711_166180 | Ga0466711_166180_5647_6027 | 126 |
| 101 | 3300042616 | Ga0466715_114222 | Ga0466715_114222_433_813 | 126 |
| 102 | 3300042616 | Ga0466715_146752 | Ga0466715_146752_1005_1385 | 126 |
| 103 | 3300042616 | Ga0466715_233019 | Ga0466715_233019_1679_2059 | 126 |
| 104 | 3300042616 | Ga0466715_319294 | Ga0466715_319294_101_481 | 126 |
| 105 | 3300042618 | Ga0466723_213607 | Ga0466723_213607_3361_3741 | 126 |
| 106 | 3300042618 | Ga0466723_359311 | Ga0466723_359311_746_1126 | 126 |
| 107 | 3300042636 | Ga0466703_065752 | Ga0466703_065752_796_1176 | 126 |
| 108 | 3300042636 | Ga0466703_098428 | Ga0466703_098428_729_1109 | 126 |
| 109 | 3300042636 | Ga0466703_272171 | Ga0466703_272171_301_681 | 126 |
| 110 | 3300042636 | Ga0466703_283906 | Ga0466703_283906_1556_1936 | 126 |
| 111 | 3300042643 | Ga0466704_125036 | Ga0466704_125036_1161_1541 | 126 |
| 112 | 3300042643 | Ga0466704_275472 | Ga0466704_275472_12121_12501 | 126 |
| 113 | 3300042643 | Ga0466704_295615 | Ga0466704_295615_644_1024 | 126 |
| 114 | 3300042643 | Ga0466704_297897 | Ga0466704_297897_446_826 | 126 |
| 115 | 3300042643 | Ga0466704_419638 | Ga0466704_419638_142_522 | 126 |
| 116 | 3300042648 | Ga0466709_305990 | Ga0466709_305990_330_710 | 126 |
| 117 | 3300042652 | Ga0466708_177540 | Ga0466708_177540_1463_1843 | 126 |
| 118 | 3300042606 | Ga0466719_448294 | Ga0466719_448294_895_1284 | 129 |
| 119 | 3300042648 | Ga0466709_195990 | Ga0466709_195990_522_932 | 136 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.42 | 0.92 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.