Protein Family IF09595
Metagenome
Isolate
127
Members
30
Samples
123
Scaffolds
431.46
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_118694|Ga0466709_118694_7004_8422
- Length
- 472 aa
- Sequence
- LGKRQKNFRGTDTFAEFREGPVIPRFPGFSPWIGFVASRYVRRGRRNSPSPVLSVLGIATGVLALIVILAVMNGFQLGFIESIIEISSYHLRAEKFPPEKAGLLEDRLRETPGLVSIVPFREFQGLARGRRSTQHGILVRCLPPDALARDPAMAAKLEIEAGAFDLAGADSILLGSELARSLQLRLGDKLTLLSIPGLFTVSDEEAPPAGDPGDEDAGRVNEFTVTGIFRSGFYEYDMGWGFINLEAGRKLAGEGMSLGIKLRDRWQDRSALSAIERSFAAGGEDFGDLAFSAWRDYNRAFFGALRTEKLFMFILVGLIFVVVGLNIFQAQRRAVLERREEIGLLRAVGGADKAVRLVFVCDGLIIGFAGAGAGLVLGLLVASHIPLFFTFIEKLVNGIIGVANAFTGSFSAPGDFAVFSPAVFYIKEIPSRIIVQEVVFVFMFGFLSALFAAWFASGQVSKMKPAEVLRDE
Sample Types
Isolate
3.1%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Termitidae
20.0%
Unclassified
16.7%
Termopsidae
10.0%
Rhinotermitidae
6.7%
Taxonomy
Archaea
1
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 2 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 3 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 4 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 22 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 30 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_128044 | 3300042659 | Bacteria | 1596 |
| 2 | Ga0466733_207738 | 3300042659 | Bacteria | 14249 |
| 3 | Ga0123353_10029732 | 3300010167 | Bacteria | 8427 |
| 4 | Ga0466692_084153 | 3300042591 | Bacteria | 6355 |
| 5 | Ga0466691_167928 | 3300042593 | Bacteria | 7785 |
| 6 | Ga0466715_307882 | 3300042616 | Bacteria | 10887 |
| 7 | Ga0466723_117615 | 3300042618 | Bacteria | 53992 |
| 8 | Ga0466723_163980 | 3300042618 | Bacteria | 8569 |
| 9 | Ga0466723_177815 | 3300042618 | Bacteria | 12006 |
| 10 | Ga0466723_240327 | 3300042618 | Bacteria | 7338 |
| 11 | Ga0466726_032660 | 3300042619 | Bacteria | 9899 |
| 12 | Ga0466726_245933 | 3300042619 | Bacteria | 3398 |
| 13 | Ga0466728_031898 | 3300042620 | Bacteria | 21446 |
| 14 | Ga0466728_165253 | 3300042620 | Bacteria | 19087 |
| 15 | JGI24695J34938_10003235 | 3300002450 | Bacteria | 11530 |
| 16 | Ga0466703_190075 | 3300042636 | Bacteria | 5688 |
| 17 | Ga0466704_209487 | 3300042643 | Bacteria | 45601 |
| 18 | Ga0466709_118694 | 3300042648 | Bacteria | 11857 |
| 19 | Ga0466709_212079 | 3300042648 | Bacteria | 2226 |
| 20 | Ga0466705_025306 | 3300042612 | Bacteria | 30242 |
| 21 | Ga0466705_341583 | 3300042612 | Bacteria | 5874 |
| 22 | Ga0466733_044201 | 3300042659 | Bacteria | 54685 |
| 23 | Ga0466733_055788 | 3300042659 | Bacteria | 32943 |
| 24 | Ga0123353_10080652 | 3300010167 | Bacteria | 5233 |
| 25 | Ga0466716_495783 | 3300042605 | Bacteria | 7669 |
| 26 | Ga0466691_134095 | 3300042593 | Bacteria | 9924 |
| 27 | Ga0466696_427426 | 3300042596 | Bacteria | 4839 |
| 28 | Ga0466715_069257 | 3300042616 | Bacteria | 34190 |
| 29 | Ga0466715_078388 | 3300042616 | Bacteria | 13010 |
| 30 | Ga0466723_308761 | 3300042618 | Bacteria | 24583 |
| 31 | Ga0466726_086676 | 3300042619 | Bacteria | 9773 |
| 32 | Ga0466726_156215 | 3300042619 | Bacteria | 14405 |
| 33 | Ga0466735_221177 | 3300042624 | Bacteria | 2352 |
| 34 | Ga0466704_216309 | 3300042643 | Bacteria | 43311 |
| 35 | Ga0466704_582104 | 3300042643 | Bacteria | 10224 |
| 36 | Ga0123354_10109779 | 3300010882 | Unclassified | 3652 |
| 37 | Ga0466722_036342 | 3300042609 | Bacteria | 8504 |
| 38 | Ga0466694_002155 | 3300042594 | Bacteria | 38089 |
| 39 | Ga0466711_517874 | 3300042615 | Bacteria | 5933 |
| 40 | Ga0466715_382872 | 3300042616 | Bacteria | 22351 |
| 41 | Ga0466723_009360 | 3300042618 | Bacteria | 5258 |
| 42 | Ga0466723_058123 | 3300042618 | Bacteria | 8843 |
| 43 | Ga0466723_292225 | 3300042618 | Bacteria | 6835 |
| 44 | Ga0466726_490752 | 3300042619 | Bacteria | 8164 |
| 45 | Ga0466728_088286 | 3300042620 | Bacteria | 6195 |
| 46 | Ga0466704_301952 | 3300042643 | Bacteria | 17756 |
| 47 | Ga0466708_005524 | 3300042652 | Bacteria | 9864 |
| 48 | Ga0466705_026099 | 3300042612 | Bacteria | 14603 |
| 49 | Ga0466705_060150 | 3300042612 | Bacteria | 42844 |
| 50 | Ga0466705_128423 | 3300042612 | Bacteria | 4557 |
| 51 | Ga0466722_068591 | 3300042609 | Bacteria | 9734 |
| 52 | Ga0466690_245675 | 3300042590 | Bacteria | 3731 |
| 53 | Ga0466692_042687 | 3300042591 | Bacteria | 64519 |
| 54 | Ga0466696_019439 | 3300042596 | Bacteria | 13656 |
| 55 | Ga0466711_032983 | 3300042615 | Bacteria | 3107 |
| 56 | Ga0466711_477746 | 3300042615 | Bacteria | 3593 |
| 57 | Ga0466715_147164 | 3300042616 | Bacteria | 17560 |
| 58 | Ga0466715_263195 | 3300042616 | Bacteria | 8028 |
| 59 | Ga0466715_355918 | 3300042616 | Bacteria | 9209 |
| 60 | Ga0466723_343537 | 3300042618 | Bacteria | 96271 |
| 61 | Ga0466726_084031 | 3300042619 | Bacteria | 3750 |
| 62 | Ga0466728_032486 | 3300042620 | Bacteria | 12326 |
| 63 | Ga0466709_338063 | 3300042648 | Bacteria | 8036 |
| 64 | Ga0466708_121832 | 3300042652 | Bacteria | 10302 |
| 65 | Ga0466727_012228 | 3300042655 | Bacteria | 2717 |
| 66 | Ga0466719_350536 | 3300042606 | Bacteria | 1983 |
| 67 | Ga0466690_352707 | 3300042590 | Bacteria | 9829 |
| 68 | Ga0466691_010692 | 3300042593 | Bacteria | 45781 |
| 69 | Ga0466711_329070 | 3300042615 | Bacteria | 4594 |
| 70 | Ga0466715_018975 | 3300042616 | Bacteria | 15600 |
| 71 | Ga0466715_505926 | 3300042616 | Bacteria | 12607 |
| 72 | Ga0466715_616711 | 3300042616 | Bacteria | 1502 |
| 73 | Ga0466723_109836 | 3300042618 | Bacteria | 4695 |
| 74 | Ga0466728_052374 | 3300042620 | Bacteria | 39388 |
| 75 | Ga0466728_355275 | 3300042620 | Bacteria | 4246 |
| 76 | Ga0466703_068102 | 3300042636 | Bacteria | 2644 |
| 77 | Ga0466703_293690 | 3300042636 | Bacteria | 3977 |
| 78 | Ga0466709_129154 | 3300042648 | Bacteria | 51098 |
| 79 | Ga0466708_157225 | 3300042652 | Bacteria | 4164 |
| 80 | Ga0466708_366296 | 3300042652 | Bacteria | 6308 |
| 81 | Ga0466705_234159 | 3300042612 | Bacteria | 9676 |
| 82 | Ga0466719_415041 | 3300042606 | Bacteria | 20967 |
| 83 | Ga0466690_087446 | 3300042590 | Bacteria | 49513 |
| 84 | Ga0466690_138934 | 3300042590 | Archaea | 2913 |
| 85 | Ga0466692_033635 | 3300042591 | Bacteria | 4884 |
| 86 | Ga0466711_050410 | 3300042615 | Bacteria | 22899 |
| 87 | Ga0466728_023553 | 3300042620 | Bacteria | 8397 |
| 88 | JGI24702J35022_10001467 | 3300002462 | Bacteria | 14658 |
| 89 | Ga0466709_230244 | 3300042648 | Bacteria | 10623 |
| 90 | Ga0466708_022521 | 3300042652 | Bacteria | 3058 |
| 91 | Ga0466708_197587 | 3300042652 | Bacteria | 12562 |
| 92 | Ga0466708_234390 | 3300042652 | Bacteria | 27135 |
| 93 | Ga0466727_173103 | 3300042655 | Bacteria | 11113 |
| 94 | Ga0466727_327080 | 3300042655 | Bacteria | 6263 |
| 95 | Ga0466733_057162 | 3300042659 | Bacteria | 7194 |
| 96 | Ga0466716_038402 | 3300042605 | Bacteria | 5676 |
| 97 | Ga0466716_099890 | 3300042605 | Bacteria | 31090 |
| 98 | Ga0466719_280035 | 3300042606 | Bacteria | 7223 |
| 99 | Ga0466715_055859 | 3300042616 | Bacteria | 18639 |
| 100 | Ga0466723_142238 | 3300042618 | Bacteria | 10110 |
| 101 | Ga0466726_156632 | 3300042619 | Bacteria | 2518 |
| 102 | Ga0466735_136805 | 3300042624 | Bacteria | 2824 |
| 103 | Ga0466703_116563 | 3300042636 | Bacteria | 3902 |
| 104 | Ga0466704_212969 | 3300042643 | Bacteria | 10903 |
| 105 | Ga0466704_232658 | 3300042643 | Bacteria | 5607 |
| 106 | Ga0466705_068713 | 3300042612 | Bacteria | 12031 |
| 107 | Ga0466707_023018 | 3300042601 | Bacteria | 3778 |
| 108 | Ga0466707_047263 | 3300042601 | Bacteria | 18620 |
| 109 | Ga0466719_214459 | 3300042606 | Bacteria | 27938 |
| 110 | Ga0466691_174510 | 3300042593 | Bacteria | 2260 |
| 111 | Ga0466696_079274 | 3300042596 | Bacteria | 11056 |
| 112 | Ga0466696_153555 | 3300042596 | Bacteria | 5443 |
| 113 | Ga0466696_335069 | 3300042596 | Bacteria | 23035 |
| 114 | Ga0466723_323276 | 3300042618 | Bacteria | 12192 |
| 115 | Ga0466726_363596 | 3300042619 | Bacteria | 1869 |
| 116 | Ga0466728_065446 | 3300042620 | Bacteria | 45233 |
| 117 | JGI24702J35022_10061127 | 3300002462 | Bacteria | 2015 |
| 118 | Ga0466735_117126 | 3300042624 | Bacteria | 3118 |
| 119 | Ga0466703_012351 | 3300042636 | Bacteria | 30446 |
| 120 | Ga0466703_316437 | 3300042636 | Bacteria | 17841 |
| 121 | Ga0466704_511287 | 3300042643 | Bacteria | 48132 |
| 122 | Ga0466708_096456 | 3300042652 | Bacteria | 22929 |
| 123 | Ga0466727_278107 | 3300042655 | Unclassified | 1370 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02687 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.