Protein Family IF09594
Metagenome
Isolate
156
Members
45
Samples
148
Scaffolds
314.62
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_117079|Ga0466709_117079_951_2078
- Length
- 375 aa
- Sequence
- LGRFFAEPAKAGRVSPLVKIRDLFGNSGFRTNSAQKPQFHSRMTTGLLAGNCKTLWGLKVDMNSPRNNIVRIGIFYDGYYFYKVSNYYKYEHTRKARISISGLHDFIREEIASFMQIDDIRHCQIIDAHYFKGRSSAKEMGEKVQSERVFEDILMRENIVNHYLPLRYGENNTWQEKGIDVWLALEAYELAIYKRFDVLVLVAGDGDYVPLVRKLNTLGTQVMLICWDYSYVNENGTVTETRTSRQLLEEVLYPIVMNERIDRQPSTDSVNELFVRERREYGTEAIGNIIPLKEEPGVPEDNYQVSTIISIKEGFGFIKDEKINNVFFYYDTLTNKDFDELEVGMKVKYLCEEDEERSKRDDAPRYRAYKVTVMD
Sample Types
Isolate
5.1%
Metagenome
94.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.1%
Kalotermitidae
31.8%
Unclassified
22.7%
Rhinotermitidae
6.8%
Termopsidae
4.5%
Taxonomy
Archaea
0
Bacteria
140
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 10 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 11 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 21 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 22 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 29 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 30 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 2781125665 | Treponema sp. Emb289P3bin117 | Isolate | Unclassified |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_263307 | 3300042612 | Bacteria | 5318 |
| 2 | Ga0466712_133645 | 3300042614 | Bacteria | 7385 |
| 3 | Ga0466712_160846 | 3300042614 | Bacteria | 2081 |
| 4 | Ga0466711_263338 | 3300042615 | Bacteria | 27803 |
| 5 | Ga0466723_049917 | 3300042618 | Bacteria | 14979 |
| 6 | Ga0466723_359532 | 3300042618 | Bacteria | 15452 |
| 7 | Ga0466728_251921 | 3300042620 | Bacteria | 2234 |
| 8 | Ga0466707_051395 | 3300042601 | Bacteria | 1618 |
| 9 | Ga0466707_254280 | 3300042601 | Bacteria | 2839 |
| 10 | Ga0466716_166622 | 3300042605 | Bacteria | 1616 |
| 11 | Ga0466722_012286 | 3300042609 | Bacteria | 9346 |
| 12 | Ga0466722_096496 | 3300042609 | Bacteria | 15946 |
| 13 | Ga0466722_172298 | 3300042609 | Bacteria | 6545 |
| 14 | JGI24698J34947_10018259 | 3300002449 | Bacteria | 3793 |
| 15 | JGI24695J34938_10000052 | 3300002450 | Bacteria | 90676 |
| 16 | Ga0466729_237711 | 3300042621 | Bacteria | 1614 |
| 17 | Ga0466703_350882 | 3300042636 | Bacteria | 30976 |
| 18 | Ga0466704_049979 | 3300042643 | Bacteria | 20325 |
| 19 | Ga0466704_051413 | 3300042643 | Bacteria | 2625 |
| 20 | Ga0466704_205209 | 3300042643 | Bacteria | 2206 |
| 21 | Ga0466704_304316 | 3300042643 | Unclassified | 4933 |
| 22 | Ga0466704_495595 | 3300042643 | Bacteria | 15189 |
| 23 | Ga0466709_044779 | 3300042648 | Bacteria | 12560 |
| 24 | Ga0466709_191554 | 3300042648 | Bacteria | 2571 |
| 25 | Ga0466708_205930 | 3300042652 | Unclassified | 1480 |
| 26 | Ga0466708_212628 | 3300042652 | Bacteria | 2921 |
| 27 | Ga0466699_082165 | 3300042597 | Bacteria | 1613 |
| 28 | Ga0466705_142757 | 3300042612 | Bacteria | 2185 |
| 29 | Ga0466715_484677 | 3300042616 | Bacteria | 10094 |
| 30 | Ga0466723_076271 | 3300042618 | Unclassified | 1312 |
| 31 | Ga0123356_10000626 | 3300010049 | Bacteria | 39002 |
| 32 | Ga0466707_073684 | 3300042601 | Bacteria | 21760 |
| 33 | Ga0466716_094674 | 3300042605 | Bacteria | 3517 |
| 34 | Ga0466719_174461 | 3300042606 | Bacteria | 3555 |
| 35 | Ga0466722_202494 | 3300042609 | Unclassified | 1746 |
| 36 | Ga0466698_203568 | 3300042610 | Bacteria | 2649 |
| 37 | JGI24698J34947_10000243 | 3300002449 | Bacteria | 22739 |
| 38 | JGI24698J34947_10010172 | 3300002449 | Bacteria | 5158 |
| 39 | JGI24698J34947_10041288 | 3300002449 | Bacteria | 2377 |
| 40 | JGI24695J34938_10000023 | 3300002450 | Bacteria | 110103 |
| 41 | Ga0072940_1012995 | 3300005200 | Unclassified | 4595 |
| 42 | Ga0072941_1040190 | 3300005201 | Bacteria | 9082 |
| 43 | Ga0466731_206024 | 3300042622 | Bacteria | 1267 |
| 44 | Ga0466704_022797 | 3300042643 | Bacteria | 7966 |
| 45 | Ga0466704_043408 | 3300042643 | Bacteria | 10561 |
| 46 | Ga0466709_398374 | 3300042648 | Bacteria | 5722 |
| 47 | Ga0466690_027904 | 3300042590 | Bacteria | 14673 |
| 48 | Ga0466690_041149 | 3300042590 | Bacteria | 4467 |
| 49 | Ga0466690_264227 | 3300042590 | Bacteria | 5034 |
| 50 | Ga0466692_146975 | 3300042591 | Bacteria | 1559 |
| 51 | Ga0466694_075543 | 3300042594 | Bacteria | 2334 |
| 52 | Ga0466705_244617 | 3300042612 | Bacteria | 23734 |
| 53 | Ga0466712_028790 | 3300042614 | Bacteria | 127971 |
| 54 | Ga0466712_090987 | 3300042614 | Bacteria | 12032 |
| 55 | Ga0466715_220400 | 3300042616 | Bacteria | 8496 |
| 56 | Ga0466729_143938 | 3300042621 | Bacteria | 2256 |
| 57 | Ga0466722_202153 | 3300042609 | Bacteria | 3481 |
| 58 | AustNasuHG_c1001578 | 3300000089 | Bacteria | 8220 |
| 59 | Ga0466731_285771 | 3300042622 | Unclassified | 1797 |
| 60 | Ga0466709_174192 | 3300042648 | Bacteria | 8368 |
| 61 | Ga0466709_306556 | 3300042648 | Bacteria | 2433 |
| 62 | Ga0466708_057122 | 3300042652 | Bacteria | 7352 |
| 63 | Ga0466690_063727 | 3300042590 | Unclassified | 1576 |
| 64 | Ga0466693_376710 | 3300042592 | Bacteria | 20175 |
| 65 | Ga0466696_068659 | 3300042596 | Bacteria | 11451 |
| 66 | Ga0466699_024939 | 3300042597 | Bacteria | 4818 |
| 67 | Ga0466705_022934 | 3300042612 | Bacteria | 6801 |
| 68 | Ga0466712_000594 | 3300042614 | Bacteria | 29291 |
| 69 | Ga0466712_191971 | 3300042614 | Bacteria | 2862 |
| 70 | Ga0466711_015361 | 3300042615 | Bacteria | 16701 |
| 71 | Ga0466711_337908 | 3300042615 | Bacteria | 2020 |
| 72 | Ga0466715_162695 | 3300042616 | Bacteria | 1218 |
| 73 | Ga0466715_197309 | 3300042616 | Bacteria | 9892 |
| 74 | Ga0466728_329479 | 3300042620 | Bacteria | 6726 |
| 75 | Ga0123356_10000810 | 3300010049 | Bacteria | 34730 |
| 76 | Ga0123356_10004865 | 3300010049 | Bacteria | 13807 |
| 77 | Ga0123356_10054436 | 3300010049 | Bacteria | 3726 |
| 78 | Ga0466722_203427 | 3300042609 | Bacteria | 6232 |
| 79 | JGI24695J34938_10000081 | 3300002450 | Bacteria | 82371 |
| 80 | Ga0072941_1002020 | 3300005201 | Bacteria | 2391 |
| 81 | Ga0466690_270734 | 3300042590 | Unclassified | 1976 |
| 82 | Ga0466692_058889 | 3300042591 | Bacteria | 41705 |
| 83 | Ga0466692_063115 | 3300042591 | Bacteria | 5393 |
| 84 | Ga0466692_165652 | 3300042591 | Bacteria | 2545 |
| 85 | Ga0466691_073293 | 3300042593 | Bacteria | 27182 |
| 86 | Ga0466691_165066 | 3300042593 | Unclassified | 1729 |
| 87 | Ga0466696_089316 | 3300042596 | Bacteria | 14243 |
| 88 | Ga0466699_021810 | 3300042597 | Bacteria | 1812 |
| 89 | Ga0466705_313244 | 3300042612 | Bacteria | 1269 |
| 90 | Ga0466712_198881 | 3300042614 | Bacteria | 7679 |
| 91 | Ga0466711_139506 | 3300042615 | Bacteria | 7952 |
| 92 | Ga0466711_279944 | 3300042615 | Bacteria | 7140 |
| 93 | Ga0466723_289910 | 3300042618 | Bacteria | 10734 |
| 94 | Ga0466719_253551 | 3300042606 | Bacteria | 3155 |
| 95 | JGI24695J34938_10000324 | 3300002450 | Bacteria | 46911 |
| 96 | JGI24700J35501_10929407 | 3300002508 | Bacteria | 9194 |
| 97 | Ga0466729_275305 | 3300042621 | Bacteria | 3474 |
| 98 | Ga0466735_181459 | 3300042624 | Bacteria | 65106 |
| 99 | Ga0466703_058874 | 3300042636 | Bacteria | 5177 |
| 100 | Ga0466709_329775 | 3300042648 | Bacteria | 1535 |
| 101 | Ga0466709_416555 | 3300042648 | Bacteria | 26652 |
| 102 | Ga0466694_278981 | 3300042594 | Bacteria | 4797 |
| 103 | Ga0466699_165070 | 3300042597 | Bacteria | 2810 |
| 104 | Ga0466699_181958 | 3300042597 | Bacteria | 15085 |
| 105 | Ga0466705_025367 | 3300042612 | Bacteria | 10961 |
| 106 | Ga0466723_272119 | 3300042618 | Bacteria | 1963 |
| 107 | Ga0123356_10000688 | 3300010049 | Bacteria | 37446 |
| 108 | Ga0466700_326445 | 3300042600 | Unclassified | 1224 |
| 109 | Ga0466716_099805 | 3300042605 | Bacteria | 2119 |
| 110 | Ga0466719_091726 | 3300042606 | Bacteria | 40445 |
| 111 | JGI24696J40584_12928238 | 3300002834 | Unclassified | 1437 |
| 112 | Ga0068305_10450707 | 3300005083 | Bacteria | 18601 |
| 113 | Ga0072941_1003884 | 3300005201 | Bacteria | 10093 |
| 114 | Ga0466703_402271 | 3300042636 | Unclassified | 1215 |
| 115 | Ga0466704_237329 | 3300042643 | Bacteria | 8681 |
| 116 | Ga0466704_415790 | 3300042643 | Bacteria | 9920 |
| 117 | Ga0466704_453640 | 3300042643 | Unclassified | 2126 |
| 118 | Ga0466709_182885 | 3300042648 | Bacteria | 1984 |
| 119 | Ga0466690_294630 | 3300042590 | Unclassified | 1863 |
| 120 | Ga0466692_202587 | 3300042591 | Unclassified | 1573 |
| 121 | Ga0466691_047115 | 3300042593 | Bacteria | 4734 |
| 122 | Ga0466695_036381 | 3300042595 | Bacteria | 2707 |
| 123 | Ga0466705_130298 | 3300042612 | Bacteria | 9813 |
| 124 | Ga0466712_154716 | 3300042614 | Bacteria | 14451 |
| 125 | Ga0466711_187453 | 3300042615 | Bacteria | 3287 |
| 126 | Ga0466723_081086 | 3300042618 | Bacteria | 11274 |
| 127 | Ga0466726_337132 | 3300042619 | Bacteria | 1740 |
| 128 | Ga0466728_010326 | 3300042620 | Bacteria | 3470 |
| 129 | Ga0466728_197709 | 3300042620 | Bacteria | 6266 |
| 130 | Ga0123356_10555942 | 3300010049 | Bacteria | 1309 |
| 131 | JGI24695J34938_10035649 | 3300002450 | Bacteria | 2273 |
| 132 | Ga0466731_148280 | 3300042622 | Bacteria | 1088 |
| 133 | Ga0466691_062781 | 3300042593 | Bacteria | 4431 |
| 134 | Ga0466712_022183 | 3300042614 | Bacteria | 9688 |
| 135 | Ga0466715_544837 | 3300042616 | Bacteria | 5119 |
| 136 | Ga0466728_122478 | 3300042620 | Bacteria | 2935 |
| 137 | Ga0466728_222942 | 3300042620 | Bacteria | 2082 |
| 138 | Ga0466722_127709 | 3300042609 | Bacteria | 23228 |
| 139 | AustNasuHG_c1001469 | 3300000089 | Bacteria | 8464 |
| 140 | Ga0466735_112476 | 3300042624 | Bacteria | 2429 |
| 141 | Ga0466703_016685 | 3300042636 | Bacteria | 11671 |
| 142 | Ga0466704_429269 | 3300042643 | Bacteria | 1773 |
| 143 | Ga0466709_115714 | 3300042648 | Bacteria | 4740 |
| 144 | Ga0466709_117079 | 3300042648 | Bacteria | 6798 |
| 145 | Ga0466709_197556 | 3300042648 | Bacteria | 3742 |
| 146 | Ga0466708_092171 | 3300042652 | Bacteria | 24186 |
| 147 | Ga0466691_139857 | 3300042593 | Bacteria | 5458 |
| 148 | Ga0466694_004925 | 3300042594 | Unclassified | 2145 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00313 | GO:0003676 | nucleic acid binding | MF |
| PF01936 | GO:0004540 | RNA nuclease activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.