Protein Family IF09576
Metagenome
Isolate
209
Members
30
Samples
208
Scaffolds
247.39
Avg Length
Representative Sequence
- ID
- 3300042648|Ga0466709_065074|Ga0466709_065074_8008_8826
- Length
- 272 aa
- Sequence
- LRKGAGFTGGWSLGNKAGGNSVMDIKGSLEEFKIVFSIPVFQDKPLYLLGQEIRSIDINETVLVSWVVMAVLIAASLVLTRRLKELPRGPQVILEAMVEFLNHFAQEHFGRRAKTYGPFIGTIFLFLLLANIIPVLSPVGAFGHEPPFSIRPPARDINLTAAMAILSILVVLIGGLRARGLKGWCKNLLRPVPMMLPFNLLEYIIRPTSMCLRLFGNILGGLIIMLLIEGVVPLGLPPVLSLYFDFLDVLIQAMVFTFLTTLFIAEAVEVEQ
Sample Types
Isolate
0.5%
Metagenome
99.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Termitidae
26.7%
Rhinotermitidae
10.0%
Termopsidae
10.0%
Unclassified
6.7%
Taxonomy
Archaea
1
Bacteria
192
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 10 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 11 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 17 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_321923 | 3300042612 | Bacteria | 4201 |
| 2 | Ga0466705_363862 | 3300042612 | Bacteria | 12464 |
| 3 | JGI24698J34947_10059085 | 3300002449 | Bacteria | 1896 |
| 4 | Ga0466690_195282 | 3300042590 | Bacteria | 1767 |
| 5 | Ga0466691_030623 | 3300042593 | Bacteria | 5936 |
| 6 | Ga0466696_084711 | 3300042596 | Bacteria | 44294 |
| 7 | Ga0466716_211648 | 3300042605 | Bacteria | 7730 |
| 8 | Ga0466716_217492 | 3300042605 | Bacteria | 1681 |
| 9 | Ga0466719_309136 | 3300042606 | Bacteria | 27413 |
| 10 | Ga0466720_083188 | 3300042607 | Bacteria | 15493 |
| 11 | Ga0466722_058856 | 3300042609 | Bacteria | 1710 |
| 12 | Ga0466722_076338 | 3300042609 | Bacteria | 4744 |
| 13 | Ga0466711_016952 | 3300042615 | Bacteria | 1913 |
| 14 | Ga0466715_095772 | 3300042616 | Bacteria | 8153 |
| 15 | Ga0466715_278161 | 3300042616 | Bacteria | 20583 |
| 16 | Ga0466715_519867 | 3300042616 | Bacteria | 4770 |
| 17 | Ga0466718_002727 | 3300042617 | Bacteria | 3334 |
| 18 | Ga0466723_217523 | 3300042618 | Bacteria | 11365 |
| 19 | Ga0466728_249755 | 3300042620 | Bacteria | 2516 |
| 20 | Ga0466729_313604 | 3300042621 | Bacteria | 2265 |
| 21 | Ga0466703_082038 | 3300042636 | Bacteria | 5369 |
| 22 | Ga0466703_135186 | 3300042636 | Bacteria | 2195 |
| 23 | Ga0466704_261876 | 3300042643 | Bacteria | 4536 |
| 24 | Ga0466709_320517 | 3300042648 | Bacteria | 2964 |
| 25 | Ga0466709_371719 | 3300042648 | Bacteria | 9977 |
| 26 | Ga0466708_006614 | 3300042652 | Bacteria | 18832 |
| 27 | Ga0466708_019692 | 3300042652 | Bacteria | 15266 |
| 28 | Ga0466708_038220 | 3300042652 | Unclassified | 2818 |
| 29 | Ga0466708_257111 | 3300042652 | Bacteria | 2664 |
| 30 | Ga0466727_111143 | 3300042655 | Bacteria | 5939 |
| 31 | Ga0466705_051501 | 3300042612 | Bacteria | 19408 |
| 32 | Ga0466705_065050 | 3300042612 | Unclassified | 3667 |
| 33 | Ga0466705_251186 | 3300042612 | Bacteria | 13584 |
| 34 | Ga0466705_272743 | 3300042612 | Bacteria | 23264 |
| 35 | AustNasuHG_c1035898 | 3300000089 | Bacteria | 1297 |
| 36 | Ga0466691_184768 | 3300042593 | Bacteria | 7376 |
| 37 | Ga0466696_028437 | 3300042596 | Bacteria | 47665 |
| 38 | Ga0466707_380460 | 3300042601 | Bacteria | 1155 |
| 39 | Ga0466716_143417 | 3300042605 | Bacteria | 4816 |
| 40 | Ga0466719_455876 | 3300042606 | Bacteria | 2842 |
| 41 | Ga0466722_031816 | 3300042609 | Bacteria | 21407 |
| 42 | Ga0466722_238939 | 3300042609 | Bacteria | 28292 |
| 43 | Ga0466698_351180 | 3300042610 | Bacteria | 1024 |
| 44 | Ga0466711_321424 | 3300042615 | Bacteria | 1142 |
| 45 | Ga0466715_627946 | 3300042616 | Bacteria | 6892 |
| 46 | Ga0466723_120152 | 3300042618 | Bacteria | 26361 |
| 47 | Ga0466726_426607 | 3300042619 | Bacteria | 1067 |
| 48 | Ga0466726_460714 | 3300042619 | Bacteria | 2410 |
| 49 | Ga0466728_024110 | 3300042620 | Bacteria | 9896 |
| 50 | Ga0466728_065223 | 3300042620 | Bacteria | 11798 |
| 51 | Ga0466735_159147 | 3300042624 | Unclassified | 2832 |
| 52 | Ga0466703_028796 | 3300042636 | Bacteria | 28449 |
| 53 | Ga0466703_085972 | 3300042636 | Bacteria | 8105 |
| 54 | Ga0466703_215121 | 3300042636 | Bacteria | 4577 |
| 55 | Ga0466703_260999 | 3300042636 | Bacteria | 1735 |
| 56 | Ga0466708_014488 | 3300042652 | Bacteria | 3900 |
| 57 | Ga0466708_064708 | 3300042652 | Bacteria | 8020 |
| 58 | Ga0466705_015291 | 3300042612 | Bacteria | 23966 |
| 59 | Ga0466733_047462 | 3300042659 | Bacteria | 1116 |
| 60 | Ga0466690_275270 | 3300042590 | Bacteria | 3026 |
| 61 | Ga0466690_327791 | 3300042590 | Unclassified | 3647 |
| 62 | Ga0466690_336508 | 3300042590 | Bacteria | 10825 |
| 63 | Ga0466692_125006 | 3300042591 | Bacteria | 40169 |
| 64 | Ga0466691_064060 | 3300042593 | Bacteria | 14735 |
| 65 | Ga0466691_176333 | 3300042593 | Bacteria | 9039 |
| 66 | Ga0466696_281012 | 3300042596 | Bacteria | 2521 |
| 67 | Ga0466696_318108 | 3300042596 | Bacteria | 9753 |
| 68 | Ga0466707_086211 | 3300042601 | Bacteria | 1421 |
| 69 | Ga0466722_123386 | 3300042609 | Bacteria | 2349 |
| 70 | Ga0466711_484744 | 3300042615 | Bacteria | 2487 |
| 71 | Ga0466715_374008 | 3300042616 | Bacteria | 7395 |
| 72 | Ga0466723_175582 | 3300042618 | Archaea | 3113 |
| 73 | Ga0466728_060793 | 3300042620 | Bacteria | 4622 |
| 74 | Ga0466728_085443 | 3300042620 | Bacteria | 1389 |
| 75 | Ga0466728_131614 | 3300042620 | Unclassified | 5983 |
| 76 | Ga0466703_003106 | 3300042636 | Bacteria | 32370 |
| 77 | Ga0466703_096848 | 3300042636 | Bacteria | 24897 |
| 78 | Ga0466703_253205 | 3300042636 | Bacteria | 4090 |
| 79 | Ga0466704_107406 | 3300042643 | Unclassified | 2252 |
| 80 | Ga0466709_065074 | 3300042648 | Bacteria | 18590 |
| 81 | Ga0466708_213773 | 3300042652 | Bacteria | 3030 |
| 82 | AustNasuHG_c1041634 | 3300000089 | Bacteria | 1104 |
| 83 | Ga0466690_293153 | 3300042590 | Bacteria | 4012 |
| 84 | Ga0466691_030723 | 3300042593 | Bacteria | 5783 |
| 85 | Ga0466691_061760 | 3300042593 | Bacteria | 6004 |
| 86 | Ga0466691_144782 | 3300042593 | Bacteria | 35149 |
| 87 | Ga0466716_064240 | 3300042605 | Unclassified | 3925 |
| 88 | Ga0466716_464939 | 3300042605 | Bacteria | 13234 |
| 89 | Ga0466722_057019 | 3300042609 | Bacteria | 27648 |
| 90 | Ga0466722_188961 | 3300042609 | Bacteria | 5268 |
| 91 | Ga0466698_091939 | 3300042610 | Bacteria | 10842 |
| 92 | Ga0466705_406745 | 3300042612 | Bacteria | 9599 |
| 93 | Ga0466715_216828 | 3300042616 | Bacteria | 18668 |
| 94 | Ga0466715_564925 | 3300042616 | Bacteria | 19180 |
| 95 | Ga0466723_092560 | 3300042618 | Bacteria | 15560 |
| 96 | Ga0466723_184622 | 3300042618 | Bacteria | 1343 |
| 97 | Ga0466726_019487 | 3300042619 | Bacteria | 4199 |
| 98 | Ga0466726_249311 | 3300042619 | Bacteria | 1643 |
| 99 | Ga0466728_102543 | 3300042620 | Bacteria | 9845 |
| 100 | Ga0466728_250428 | 3300042620 | Bacteria | 1646 |
| 101 | Ga0466728_267873 | 3300042620 | Bacteria | 6494 |
| 102 | Ga0466735_040519 | 3300042624 | Bacteria | 2167 |
| 103 | Ga0466735_066425 | 3300042624 | Bacteria | 33205 |
| 104 | Ga0466735_092187 | 3300042624 | Bacteria | 2016 |
| 105 | Ga0466704_001173 | 3300042643 | Bacteria | 6479 |
| 106 | Ga0466704_040039 | 3300042643 | Bacteria | 8496 |
| 107 | Ga0466708_064572 | 3300042652 | Bacteria | 68987 |
| 108 | Ga0466727_050357 | 3300042655 | Bacteria | 3001 |
| 109 | Ga0466705_138250 | 3300042612 | Bacteria | 8800 |
| 110 | Ga0466732_185406 | 3300042656 | Bacteria | 21032 |
| 111 | Ga0466690_103405 | 3300042590 | Bacteria | 1313 |
| 112 | Ga0466690_110649 | 3300042590 | Bacteria | 6912 |
| 113 | Ga0466691_017620 | 3300042593 | Bacteria | 8182 |
| 114 | Ga0466691_025745 | 3300042593 | Bacteria | 9293 |
| 115 | Ga0466691_049174 | 3300042593 | Bacteria | 4460 |
| 116 | Ga0466691_109337 | 3300042593 | Bacteria | 3898 |
| 117 | Ga0466691_158077 | 3300042593 | Bacteria | 5313 |
| 118 | Ga0466691_181177 | 3300042593 | Bacteria | 2338 |
| 119 | Ga0466707_318683 | 3300042601 | Bacteria | 1520 |
| 120 | Ga0466719_066848 | 3300042606 | Bacteria | 1965 |
| 121 | Ga0466720_063139 | 3300042607 | Bacteria | 1049 |
| 122 | Ga0466711_488875 | 3300042615 | Bacteria | 3748 |
| 123 | Ga0466715_101884 | 3300042616 | Bacteria | 31508 |
| 124 | Ga0466723_100367 | 3300042618 | Bacteria | 7902 |
| 125 | Ga0466723_133988 | 3300042618 | Bacteria | 6956 |
| 126 | Ga0466723_332666 | 3300042618 | Bacteria | 2496 |
| 127 | Ga0466726_329373 | 3300042619 | Bacteria | 5449 |
| 128 | Ga0466728_052008 | 3300042620 | Bacteria | 6247 |
| 129 | Ga0466728_067013 | 3300042620 | Bacteria | 6731 |
| 130 | Ga0466704_079358 | 3300042643 | Bacteria | 2972 |
| 131 | Ga0466704_091899 | 3300042643 | Bacteria | 3040 |
| 132 | Ga0466704_204695 | 3300042643 | Bacteria | 1586 |
| 133 | Ga0466704_349221 | 3300042643 | Unclassified | 1560 |
| 134 | Ga0466709_130161 | 3300042648 | Bacteria | 8844 |
| 135 | Ga0466708_275348 | 3300042652 | Bacteria | 53424 |
| 136 | Ga0466708_300512 | 3300042652 | Bacteria | 25602 |
| 137 | Ga0466708_423050 | 3300042652 | Bacteria | 1815 |
| 138 | Ga0466705_138688 | 3300042612 | Bacteria | 1682 |
| 139 | Ga0466705_167192 | 3300042612 | Bacteria | 1442 |
| 140 | Ga0466691_033768 | 3300042593 | Bacteria | 1025 |
| 141 | Ga0466696_259758 | 3300042596 | Bacteria | 1875 |
| 142 | Ga0466696_336020 | 3300042596 | Bacteria | 3119 |
| 143 | Ga0466707_130973 | 3300042601 | Bacteria | 2184 |
| 144 | Ga0466707_317309 | 3300042601 | Bacteria | 1311 |
| 145 | Ga0466716_027907 | 3300042605 | Bacteria | 11091 |
| 146 | Ga0466716_172964 | 3300042605 | Bacteria | 7796 |
| 147 | Ga0466719_128283 | 3300042606 | Bacteria | 4215 |
| 148 | Ga0466711_223203 | 3300042615 | Bacteria | 12281 |
| 149 | Ga0466723_050301 | 3300042618 | Bacteria | 15280 |
| 150 | Ga0466704_044820 | 3300042643 | Bacteria | 7393 |
| 151 | Ga0466704_175418 | 3300042643 | Bacteria | 1650 |
| 152 | Ga0466704_410081 | 3300042643 | Bacteria | 3264 |
| 153 | Ga0466709_036318 | 3300042648 | Bacteria | 12405 |
| 154 | Ga0466727_036427 | 3300042655 | Unclassified | 1739 |
| 155 | Ga0466727_269738 | 3300042655 | Unclassified | 1311 |
| 156 | Ga0466705_027765 | 3300042612 | Bacteria | 8419 |
| 157 | Ga0466690_139402 | 3300042590 | Bacteria | 7223 |
| 158 | Ga0466691_185449 | 3300042593 | Bacteria | 1018 |
| 159 | Ga0466694_039245 | 3300042594 | Bacteria | 1287 |
| 160 | Ga0466694_319640 | 3300042594 | Bacteria | 4177 |
| 161 | Ga0466696_077808 | 3300042596 | Unclassified | 1806 |
| 162 | Ga0466696_122810 | 3300042596 | Bacteria | 28560 |
| 163 | Ga0466696_182984 | 3300042596 | Bacteria | 2840 |
| 164 | Ga0466696_228620 | 3300042596 | Bacteria | 6940 |
| 165 | Ga0466696_446903 | 3300042596 | Bacteria | 7741 |
| 166 | Ga0466707_259148 | 3300042601 | Bacteria | 23024 |
| 167 | Ga0466707_420025 | 3300042601 | Bacteria | 2381 |
| 168 | Ga0466719_072423 | 3300042606 | Bacteria | 12203 |
| 169 | Ga0466719_185535 | 3300042606 | Bacteria | 1197 |
| 170 | Ga0466722_018428 | 3300042609 | Bacteria | 3741 |
| 171 | Ga0466705_419548 | 3300042612 | Unclassified | 2584 |
| 172 | Ga0466711_231826 | 3300042615 | Bacteria | 17669 |
| 173 | Ga0466711_358404 | 3300042615 | Bacteria | 16250 |
| 174 | Ga0466715_093448 | 3300042616 | Bacteria | 6124 |
| 175 | Ga0466715_585648 | 3300042616 | Unclassified | 6695 |
| 176 | Ga0466723_159008 | 3300042618 | Bacteria | 56322 |
| 177 | Ga0466703_101352 | 3300042636 | Bacteria | 12187 |
| 178 | Ga0466704_186442 | 3300042643 | Bacteria | 1807 |
| 179 | Ga0466709_118932 | 3300042648 | Bacteria | 1540 |
| 180 | Ga0466709_340614 | 3300042648 | Bacteria | 7512 |
| 181 | Ga0466709_374563 | 3300042648 | Bacteria | 7422 |
| 182 | Ga0466708_001281 | 3300042652 | Bacteria | 6757 |
| 183 | Ga0466708_091827 | 3300042652 | Unclassified | 2011 |
| 184 | Ga0466705_076053 | 3300042612 | Bacteria | 41201 |
| 185 | Ga0466705_168853 | 3300042612 | Unclassified | 1709 |
| 186 | Ga0466733_074348 | 3300042659 | Bacteria | 2002 |
| 187 | Ga0466692_019904 | 3300042591 | Bacteria | 3633 |
| 188 | Ga0466696_058689 | 3300042596 | Bacteria | 1663 |
| 189 | Ga0466716_477812 | 3300042605 | Bacteria | 5712 |
| 190 | Ga0466711_025617 | 3300042615 | Bacteria | 25221 |
| 191 | Ga0466711_127902 | 3300042615 | Bacteria | 33180 |
| 192 | Ga0466711_450287 | 3300042615 | Bacteria | 11176 |
| 193 | Ga0466715_073782 | 3300042616 | Bacteria | 23076 |
| 194 | Ga0466715_086100 | 3300042616 | Bacteria | 9602 |
| 195 | Ga0466715_202073 | 3300042616 | Bacteria | 7128 |
| 196 | Ga0466718_097660 | 3300042617 | Bacteria | 2972 |
| 197 | Ga0466723_243195 | 3300042618 | Bacteria | 87629 |
| 198 | Ga0466723_253190 | 3300042618 | Bacteria | 7021 |
| 199 | Ga0466723_306868 | 3300042618 | Bacteria | 3055 |
| 200 | Ga0466728_061401 | 3300042620 | Bacteria | 3647 |
| 201 | Ga0466735_064502 | 3300042624 | Bacteria | 1612 |
| 202 | Ga0466735_163301 | 3300042624 | Bacteria | 2290 |
| 203 | Ga0466703_259837 | 3300042636 | Bacteria | 9331 |
| 204 | Ga0466704_019144 | 3300042643 | Bacteria | 6408 |
| 205 | Ga0466704_077030 | 3300042643 | Unclassified | 1008 |
| 206 | Ga0466704_476708 | 3300042643 | Bacteria | 3682 |
| 207 | Ga0466708_242506 | 3300042652 | Bacteria | 1764 |
| 208 | Ga0466727_142779 | 3300042655 | Bacteria | 2123 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00119 | ATP-synt_A | ATP synthase A chain | 62 | 264 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.