Protein Family IF09384
Metagenome
Isolate
148
Members
42
Samples
140
Scaffolds
353.74
Avg Length
Representative Sequence
- ID
- 3300042643|Ga0466704_139785|Ga0466704_139785_2034_3164
- Length
- 376 aa
- Sequence
- MASCEGFHFQAGKLEKNINRIKLPLINGYFLCRRVTGIERYAIEITYRLDELSKPGELAIIIPGGTTKKTISVPAYKNIRVIRYAKMQTHACWQMLSLQLFLLTHRQYMILDFGNTCLPFAPGIIFLHDIYCEFFSDDFTSFHDKIVRLYNKWQYRLIAKRAKKIVTVSEFSKKQIAETYRIDPGRISVIYSSWNHFRMIKADYSVFEAFPALSQRQFYFSLGSLSKRKNIRWIIEYAAKHPDSCFALSGTSLPTAKIGGLDAGALGNILFLGYLDDARVKALMERCKAFVLPSYYEGFGLTPLEALSCGAKIIIANAASLPEIYGKTAHYIDPFDTNVDLDKLLQEPVESPDFILGKYSYDTAARQVYDLISGIT
Sample Types
Isolate
3.4%
Metagenome
96.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Kalotermitidae
35.0%
Unclassified
12.5%
Termopsidae
7.5%
Rhinotermitidae
5.0%
Taxonomy
Archaea
1
Bacteria
133
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 2 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 9 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 10 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 22 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 29 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 30 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 31 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 32 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 39 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 40 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 41 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 42 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_120486 | 3300042612 | Bacteria | 12038 |
| 2 | Ga0466698_209522 | 3300042610 | Bacteria | 1344 |
| 3 | JGI24698J34947_10000289 | 3300002449 | Bacteria | 21802 |
| 4 | JGI24700J35501_10930899 | 3300002508 | Bacteria | 36700 |
| 5 | Ga0466708_280980 | 3300042652 | Bacteria | 3182 |
| 6 | Ga0466712_041086 | 3300042614 | Bacteria | 62732 |
| 7 | Ga0466723_041142 | 3300042618 | Bacteria | 41550 |
| 8 | Ga0466723_103048 | 3300042618 | Bacteria | 13029 |
| 9 | Ga0466690_420390 | 3300042590 | Bacteria | 4190 |
| 10 | Ga0466694_373562 | 3300042594 | Bacteria | 1319 |
| 11 | Ga0466696_055964 | 3300042596 | Bacteria | 10068 |
| 12 | Ga0123356_10020788 | 3300010049 | Bacteria | 6207 |
| 13 | Ga0123356_10239441 | 3300010049 | Bacteria | 1885 |
| 14 | Ga0466716_014331 | 3300042605 | Bacteria | 9944 |
| 15 | Ga0466722_012948 | 3300042609 | Bacteria | 7606 |
| 16 | Ga0466722_143109 | 3300042609 | Bacteria | 4319 |
| 17 | JGI24698J34947_10000004 | 3300002449 | Bacteria | 62550 |
| 18 | JGI24698J34947_10000130 | 3300002449 | Bacteria | 27577 |
| 19 | JGI24695J34938_10000122 | 3300002450 | Bacteria | 69892 |
| 20 | Ga0072941_1080845 | 3300005201 | Bacteria | 2366 |
| 21 | Ga0466709_036259 | 3300042648 | Bacteria | 16966 |
| 22 | Ga0466709_322292 | 3300042648 | Bacteria | 18005 |
| 23 | Ga0466708_013317 | 3300042652 | Bacteria | 15314 |
| 24 | Ga0466708_439683 | 3300042652 | Bacteria | 2186 |
| 25 | Ga0466712_209174 | 3300042614 | Unclassified | 5600 |
| 26 | Ga0466712_307642 | 3300042614 | Bacteria | 17229 |
| 27 | Ga0466711_086467 | 3300042615 | Unclassified | 2734 |
| 28 | Ga0466718_028461 | 3300042617 | Bacteria | 13376 |
| 29 | Ga0466728_019539 | 3300042620 | Bacteria | 2359 |
| 30 | Ga0466728_160570 | 3300042620 | Bacteria | 2349 |
| 31 | Ga0466732_000603 | 3300042656 | Bacteria | 2378 |
| 32 | Ga0264413_105627 | 3300024493 | Bacteria | 18134 |
| 33 | Ga0466691_142574 | 3300042593 | Bacteria | 5951 |
| 34 | Ga0466699_044365 | 3300042597 | Bacteria | 1911 |
| 35 | Ga0466722_072395 | 3300042609 | Bacteria | 3058 |
| 36 | Ga0466698_302426 | 3300042610 | Bacteria | 4764 |
| 37 | JGI24698J34947_10002693 | 3300002449 | Bacteria | 9592 |
| 38 | JGI24698J34947_10055819 | 3300002449 | Bacteria | 1966 |
| 39 | Ga0466735_000927 | 3300042624 | Bacteria | 6647 |
| 40 | Ga0466703_057110 | 3300042636 | Bacteria | 12891 |
| 41 | Ga0466704_454493 | 3300042643 | Bacteria | 1260 |
| 42 | Ga0466708_048655 | 3300042652 | Unclassified | 1924 |
| 43 | Ga0466705_420322 | 3300042612 | Bacteria | 3109 |
| 44 | Ga0466712_265069 | 3300042614 | Unclassified | 3155 |
| 45 | Ga0264413_114831 | 3300024493 | Bacteria | 3895 |
| 46 | Ga0466690_092360 | 3300042590 | Bacteria | 12914 |
| 47 | Ga0466691_058363 | 3300042593 | Bacteria | 17021 |
| 48 | Ga0466694_086477 | 3300042594 | Bacteria | 2675 |
| 49 | Ga0466696_412468 | 3300042596 | Bacteria | 2338 |
| 50 | Ga0466699_088613 | 3300042597 | Bacteria | 91931 |
| 51 | Ga0123356_10009909 | 3300010049 | Bacteria | 9385 |
| 52 | Ga0466722_132900 | 3300042609 | Bacteria | 11567 |
| 53 | JGI24698J34947_10000174 | 3300002449 | Bacteria | 25056 |
| 54 | JGI24698J34947_10094619 | 3300002449 | Bacteria | 1361 |
| 55 | JGI24702J35022_10001440 | 3300002462 | Bacteria | 14831 |
| 56 | Ga0466704_139785 | 3300042643 | Bacteria | 33741 |
| 57 | Ga0466704_140178 | 3300042643 | Bacteria | 60046 |
| 58 | Ga0466712_248216 | 3300042614 | Bacteria | 3735 |
| 59 | Ga0466711_058999 | 3300042615 | Unclassified | 2418 |
| 60 | Ga0466711_184391 | 3300042615 | Bacteria | 3286 |
| 61 | Ga0466715_003157 | 3300042616 | Bacteria | 16477 |
| 62 | Ga0466715_011664 | 3300042616 | Bacteria | 6679 |
| 63 | Ga0466715_351588 | 3300042616 | Bacteria | 3845 |
| 64 | Ga0466723_086192 | 3300042618 | Bacteria | 4742 |
| 65 | Ga0466726_146285 | 3300042619 | Bacteria | 5245 |
| 66 | Ga0466726_338101 | 3300042619 | Bacteria | 3233 |
| 67 | Ga0466732_008658 | 3300042656 | Bacteria | 11160 |
| 68 | Ga0466732_020860 | 3300042656 | Bacteria | 2916 |
| 69 | Ga0466691_139169 | 3300042593 | Bacteria | 8795 |
| 70 | Ga0466719_457231 | 3300042606 | Bacteria | 1883 |
| 71 | Ga0466720_037586 | 3300042607 | Bacteria | 39008 |
| 72 | Ga0466720_211375 | 3300042607 | Bacteria | 60841 |
| 73 | Ga0466720_214432 | 3300042607 | Bacteria | 1865 |
| 74 | Ga0466722_255419 | 3300042609 | Bacteria | 3278 |
| 75 | JGI24698J34947_10004750 | 3300002449 | Bacteria | 7424 |
| 76 | JGI24695J34938_10000004 | 3300002450 | Bacteria | 163071 |
| 77 | JGI24695J34938_10040994 | 3300002450 | Bacteria | 2081 |
| 78 | Ga0072941_1004185 | 3300005201 | Bacteria | 50030 |
| 79 | Ga0072941_1188500 | 3300005201 | Bacteria | 1924 |
| 80 | Ga0466704_215651 | 3300042643 | Bacteria | 22801 |
| 81 | Ga0466712_020273 | 3300042614 | Bacteria | 6228 |
| 82 | Ga0466712_022976 | 3300042614 | Bacteria | 24268 |
| 83 | Ga0466712_185745 | 3300042614 | Bacteria | 7374 |
| 84 | Ga0466728_076796 | 3300042620 | Bacteria | 3162 |
| 85 | Ga0466728_126886 | 3300042620 | Bacteria | 10469 |
| 86 | Ga0466728_162912 | 3300042620 | Bacteria | 6237 |
| 87 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 88 | Ga0466692_002945 | 3300042591 | Bacteria | 6301 |
| 89 | Ga0466691_025139 | 3300042593 | Bacteria | 13400 |
| 90 | Ga0123356_10137416 | 3300010049 | Bacteria | 2405 |
| 91 | Ga0466720_041453 | 3300042607 | Bacteria | 36391 |
| 92 | Ga0466722_043926 | 3300042609 | Bacteria | 6065 |
| 93 | AustNasuHG_c1000438 | 3300000089 | Bacteria | 14574 |
| 94 | JGI24698J34947_10013919 | 3300002449 | Unclassified | 4385 |
| 95 | JGI24695J34938_10010235 | 3300002450 | Bacteria | 5155 |
| 96 | Ga0466702_262535 | 3300042635 | Bacteria | 2969 |
| 97 | Ga0466703_150539 | 3300042636 | Bacteria | 10863 |
| 98 | Ga0466704_280972 | 3300042643 | Bacteria | 32550 |
| 99 | Ga0466709_185006 | 3300042648 | Bacteria | 4066 |
| 100 | Ga0466708_010650 | 3300042652 | Bacteria | 13065 |
| 101 | Ga0466708_210315 | 3300042652 | Bacteria | 30080 |
| 102 | Ga0466705_488839 | 3300042612 | Bacteria | 2826 |
| 103 | Ga0466711_396298 | 3300042615 | Unclassified | 1244 |
| 104 | Ga0466711_425854 | 3300042615 | Unclassified | 1461 |
| 105 | Ga0466715_062449 | 3300042616 | Bacteria | 13496 |
| 106 | Ga0466723_031805 | 3300042618 | Bacteria | 21552 |
| 107 | Ga0466726_083364 | 3300042619 | Bacteria | 5463 |
| 108 | Ga0466726_352019 | 3300042619 | Bacteria | 1918 |
| 109 | Ga0466728_332620 | 3300042620 | Unclassified | 1979 |
| 110 | Ga0466690_373501 | 3300042590 | Bacteria | 1936 |
| 111 | Ga0466692_067481 | 3300042591 | Bacteria | 1589 |
| 112 | Ga0466691_104564 | 3300042593 | Unclassified | 1366 |
| 113 | Ga0466694_042050 | 3300042594 | Unclassified | 1937 |
| 114 | Ga0466694_297644 | 3300042594 | Bacteria | 3309 |
| 115 | Ga0466699_027583 | 3300042597 | Unclassified | 8325 |
| 116 | Ga0466699_118972 | 3300042597 | Bacteria | 29522 |
| 117 | Ga0123356_10000062 | 3300010049 | Bacteria | 112695 |
| 118 | Ga0466716_307533 | 3300042605 | Unclassified | 5100 |
| 119 | JGI24698J34947_10010906 | 3300002449 | Bacteria | 4987 |
| 120 | Ga0072941_1151583 | 3300005201 | Bacteria | 4265 |
| 121 | Ga0466703_308941 | 3300042636 | Bacteria | 13319 |
| 122 | Ga0466703_326039 | 3300042636 | Bacteria | 10823 |
| 123 | Ga0466709_335298 | 3300042648 | Bacteria | 2965 |
| 124 | Ga0466718_022853 | 3300042617 | Bacteria | 49734 |
| 125 | Ga0466718_038578 | 3300042617 | Bacteria | 1670 |
| 126 | Ga0466726_323095 | 3300042619 | Bacteria | 1296 |
| 127 | Ga0466705_320840 | 3300042612 | Bacteria | 5613 |
| 128 | Ga0466733_161818 | 3300042659 | Bacteria | 5882 |
| 129 | Ga0415639_209346 | 3300038395 | Bacteria | 1906 |
| 130 | Ga0466696_043537 | 3300042596 | Bacteria | 7033 |
| 131 | Ga0466699_443040 | 3300042597 | Bacteria | 1957 |
| 132 | Ga0123356_10339158 | 3300010049 | Bacteria | 1623 |
| 133 | Ga0466716_306769 | 3300042605 | Unclassified | 1406 |
| 134 | JGI24702J35022_10018872 | 3300002462 | Bacteria | 3756 |
| 135 | Ga0466735_082530 | 3300042624 | Bacteria | 24525 |
| 136 | Ga0466704_440181 | 3300042643 | Bacteria | 4342 |
| 137 | Ga0466727_012783 | 3300042655 | Archaea | 1421 |
| 138 | Ga0466727_037388 | 3300042655 | Bacteria | 1566 |
| 139 | Ga0466705_463000 | 3300042612 | Bacteria | 14210 |
| 140 | Ga0466726_135683 | 3300042619 | Bacteria | 2292 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00534 | GO:0016757 | glycosyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.