Protein Family IF09289
Metagenome
Metatranscriptome
184
Members
40
Samples
184
Scaffolds
215.07
Avg Length
Representative Sequence
- ID
- 3300042636|Ga0466703_381716|Ga0466703_381716_754_1491
- Length
- 245 aa
- Sequence
- MIKLICIFMKTNPVFGFPEGSTSCDGRLRRRTMKRVVLPLFLLGVAAVLFAQAQLPEHHFASGNWALTGQRLYQNDADARLAKLNIQAPQSGVMLYEFEARYESGADDGHGGFGLHIFEDAPLNRASWGAGNSYLLWLNYDEHPINKDIPRGLSAQLYRSVTNSRMDLVESYDLNRYADFLTDDNLAQPVRFKIVVYGDTGEIRVYDPTEDGSIYYELSINRRDLPLKGDWVSLRTNGMSLSFAN
Sample Types
Isolate
0.0%
Metagenome
98.9%
MAG
0.0%
Metatranscriptome
1.1%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.6%
Kalotermitidae
35.9%
Termopsidae
10.3%
Rhinotermitidae
7.7%
Unclassified
2.6%
Taxonomy
Archaea
0
Bacteria
178
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 8 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 9 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 19 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 28 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 29 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 36 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_069037 | 3300042590 | Unclassified | 3701 |
| 2 | Ga0466692_120810 | 3300042591 | Bacteria | 3512 |
| 3 | Ga0466692_198964 | 3300042591 | Bacteria | 10944 |
| 4 | Ga0466703_381716 | 3300042636 | Bacteria | 2413 |
| 5 | Ga0466708_038544 | 3300042652 | Bacteria | 3042 |
| 6 | Ga0466708_051430 | 3300042652 | Bacteria | 3329 |
| 7 | Ga0466715_183802 | 3300042616 | Bacteria | 4200 |
| 8 | Ga0466718_129403 | 3300042617 | Bacteria | 6886 |
| 9 | Ga0466726_267855 | 3300042619 | Bacteria | 1025 |
| 10 | Ga0466726_310155 | 3300042619 | Bacteria | 2479 |
| 11 | Ga0466728_044588 | 3300042620 | Bacteria | 1125 |
| 12 | Ga0466728_134711 | 3300042620 | Bacteria | 3882 |
| 13 | Ga0466728_336847 | 3300042620 | Bacteria | 13866 |
| 14 | JGI24698J34947_10014003 | 3300002449 | Bacteria | 4371 |
| 15 | JGI24702J35022_10184528 | 3300002462 | Bacteria | 1187 |
| 16 | JGI24705J35276_12216690 | 3300002504 | Bacteria | 2058 |
| 17 | Ga0466700_172908 | 3300042600 | Bacteria | 1804 |
| 18 | Ga0466716_385541 | 3300042605 | Bacteria | 6247 |
| 19 | Ga0466719_397910 | 3300042606 | Bacteria | 5550 |
| 20 | Ga0466719_405914 | 3300042606 | Bacteria | 2040 |
| 21 | Ga0466719_482371 | 3300042606 | Bacteria | 16404 |
| 22 | Ga0466722_170478 | 3300042609 | Unclassified | 1182 |
| 23 | Ga0466722_170790 | 3300042609 | Bacteria | 1265 |
| 24 | Ga0466698_209014 | 3300042610 | Bacteria | 1589 |
| 25 | Ga0466705_046076 | 3300042612 | Bacteria | 7289 |
| 26 | Ga0223683_1082402 | 3300021245 | Bacteria | 729 |
| 27 | Ga0415639_073372 | 3300038395 | Bacteria | 1659 |
| 28 | Ga0466690_065588 | 3300042590 | Bacteria | 6188 |
| 29 | Ga0466691_058785 | 3300042593 | Bacteria | 2596 |
| 30 | Ga0466696_058847 | 3300042596 | Bacteria | 2765 |
| 31 | Ga0466735_171355 | 3300042624 | Bacteria | 1942 |
| 32 | Ga0466704_249191 | 3300042643 | Bacteria | 9945 |
| 33 | Ga0466709_017018 | 3300042648 | Bacteria | 2701 |
| 34 | Ga0466708_143876 | 3300042652 | Bacteria | 11312 |
| 35 | Ga0466712_150600 | 3300042614 | Bacteria | 12573 |
| 36 | Ga0466712_206445 | 3300042614 | Bacteria | 3420 |
| 37 | Ga0466712_236181 | 3300042614 | Bacteria | 1001 |
| 38 | Ga0466715_331735 | 3300042616 | Bacteria | 17452 |
| 39 | Ga0466723_034743 | 3300042618 | Bacteria | 4453 |
| 40 | Ga0466723_338270 | 3300042618 | Bacteria | 2551 |
| 41 | Ga0466726_155191 | 3300042619 | Bacteria | 5043 |
| 42 | Ga0466728_050869 | 3300042620 | Bacteria | 5972 |
| 43 | Ga0466728_084594 | 3300042620 | Bacteria | 6544 |
| 44 | Ga0466722_189416 | 3300042609 | Bacteria | 4373 |
| 45 | Ga0466705_045083 | 3300042612 | Bacteria | 17565 |
| 46 | Ga0466705_183952 | 3300042612 | Bacteria | 15086 |
| 47 | Ga0466692_186020 | 3300042591 | Bacteria | 2194 |
| 48 | Ga0466691_074974 | 3300042593 | Bacteria | 8118 |
| 49 | Ga0466691_117333 | 3300042593 | Bacteria | 4470 |
| 50 | Ga0466696_199194 | 3300042596 | Bacteria | 1302 |
| 51 | Ga0466703_325768 | 3300042636 | Bacteria | 1631 |
| 52 | Ga0466704_250209 | 3300042643 | Bacteria | 34988 |
| 53 | Ga0466704_300283 | 3300042643 | Bacteria | 19624 |
| 54 | Ga0466709_364770 | 3300042648 | Bacteria | 3813 |
| 55 | Ga0466708_465399 | 3300042652 | Bacteria | 2692 |
| 56 | Ga0466727_115720 | 3300042655 | Bacteria | 3104 |
| 57 | Ga0466711_005468 | 3300042615 | Bacteria | 4493 |
| 58 | Ga0466711_070073 | 3300042615 | Bacteria | 5362 |
| 59 | Ga0466711_466167 | 3300042615 | Bacteria | 2223 |
| 60 | Ga0466715_146705 | 3300042616 | Bacteria | 6942 |
| 61 | Ga0466715_207962 | 3300042616 | Bacteria | 26478 |
| 62 | Ga0466723_015109 | 3300042618 | Bacteria | 58838 |
| 63 | Ga0466723_340991 | 3300042618 | Bacteria | 5752 |
| 64 | Ga0466729_033318 | 3300042621 | Bacteria | 1367 |
| 65 | JGI24702J35022_10017791 | 3300002462 | Bacteria | 3880 |
| 66 | Ga0466700_393723 | 3300042600 | Bacteria | 1559 |
| 67 | Ga0466707_153035 | 3300042601 | Bacteria | 2065 |
| 68 | Ga0466716_262418 | 3300042605 | Bacteria | 1112 |
| 69 | Ga0466719_104731 | 3300042606 | Bacteria | 4509 |
| 70 | Ga0466722_123472 | 3300042609 | Bacteria | 1595 |
| 71 | Ga0466705_177744 | 3300042612 | Bacteria | 4397 |
| 72 | Ga0466732_296119 | 3300042656 | Bacteria | 2381 |
| 73 | Ga0466690_028216 | 3300042590 | Bacteria | 5360 |
| 74 | Ga0466692_091288 | 3300042591 | Bacteria | 1356 |
| 75 | Ga0466696_376241 | 3300042596 | Bacteria | 2067 |
| 76 | Ga0466703_096402 | 3300042636 | Bacteria | 2843 |
| 77 | Ga0466703_297781 | 3300042636 | Bacteria | 18976 |
| 78 | Ga0466704_055093 | 3300042643 | Bacteria | 6661 |
| 79 | Ga0466709_054027 | 3300042648 | Bacteria | 4253 |
| 80 | Ga0466709_149834 | 3300042648 | Bacteria | 5427 |
| 81 | Ga0466708_297178 | 3300042652 | Bacteria | 2779 |
| 82 | Ga0466705_467465 | 3300042612 | Bacteria | 6665 |
| 83 | Ga0466711_147165 | 3300042615 | Bacteria | 10708 |
| 84 | Ga0466711_150302 | 3300042615 | Bacteria | 12259 |
| 85 | Ga0466711_454548 | 3300042615 | Bacteria | 1606 |
| 86 | Ga0466715_635423 | 3300042616 | Bacteria | 1169 |
| 87 | Ga0466723_360021 | 3300042618 | Bacteria | 1226 |
| 88 | Ga0466726_417138 | 3300042619 | Bacteria | 5757 |
| 89 | Ga0466726_483525 | 3300042619 | Bacteria | 2246 |
| 90 | JGI24698J34947_10099382 | 3300002449 | Bacteria | 1312 |
| 91 | Ga0068302_10469297 | 3300005071 | Bacteria | 1109 |
| 92 | Ga0466716_057410 | 3300042605 | Bacteria | 3541 |
| 93 | Ga0466719_033242 | 3300042606 | Bacteria | 3671 |
| 94 | Ga0466719_439520 | 3300042606 | Unclassified | 3542 |
| 95 | Ga0233288_1134197 | 3300022232 | Bacteria | 707 |
| 96 | Ga0466692_048745 | 3300042591 | Bacteria | 9059 |
| 97 | Ga0466691_098321 | 3300042593 | Bacteria | 1919 |
| 98 | Ga0466691_167676 | 3300042593 | Bacteria | 1126 |
| 99 | Ga0466704_088075 | 3300042643 | Bacteria | 2071 |
| 100 | Ga0466704_096756 | 3300042643 | Bacteria | 25559 |
| 101 | Ga0466704_377732 | 3300042643 | Bacteria | 5816 |
| 102 | Ga0466708_202448 | 3300042652 | Bacteria | 5559 |
| 103 | Ga0466708_385463 | 3300042652 | Bacteria | 2831 |
| 104 | Ga0466727_256731 | 3300042655 | Bacteria | 3685 |
| 105 | Ga0466723_367213 | 3300042618 | Bacteria | 1526 |
| 106 | Ga0466726_155333 | 3300042619 | Bacteria | 1178 |
| 107 | Ga0466726_282923 | 3300042619 | Bacteria | 1593 |
| 108 | Ga0466728_265678 | 3300042620 | Bacteria | 7152 |
| 109 | Ga0466728_470317 | 3300042620 | Bacteria | 1583 |
| 110 | AustNasuHG_c1001895 | 3300000089 | Bacteria | 7538 |
| 111 | Ga0068302_10244333 | 3300005071 | Bacteria | 1894 |
| 112 | Ga0466719_176573 | 3300042606 | Bacteria | 2200 |
| 113 | Ga0466719_489506 | 3300042606 | Bacteria | 1293 |
| 114 | Ga0466722_169315 | 3300042609 | Bacteria | 22756 |
| 115 | Ga0123353_10435200 | 3300010167 | Bacteria | 1937 |
| 116 | Ga0466694_255969 | 3300042594 | Bacteria | 1200 |
| 117 | Ga0466699_123177 | 3300042597 | Bacteria | 1997 |
| 118 | Ga0466735_066425 | 3300042624 | Bacteria | 33205 |
| 119 | Ga0466703_073592 | 3300042636 | Bacteria | 3848 |
| 120 | Ga0466703_076849 | 3300042636 | Bacteria | 11625 |
| 121 | Ga0466703_192316 | 3300042636 | Bacteria | 10205 |
| 122 | Ga0466704_406072 | 3300042643 | Bacteria | 5037 |
| 123 | Ga0466704_590389 | 3300042643 | Bacteria | 15345 |
| 124 | Ga0466708_401735 | 3300042652 | Bacteria | 8529 |
| 125 | Ga0466727_165869 | 3300042655 | Bacteria | 13781 |
| 126 | Ga0466727_212766 | 3300042655 | Unclassified | 3026 |
| 127 | Ga0466715_126526 | 3300042616 | Bacteria | 5753 |
| 128 | Ga0466715_198631 | 3300042616 | Bacteria | 7099 |
| 129 | Ga0466715_425928 | 3300042616 | Bacteria | 11513 |
| 130 | Ga0466715_582968 | 3300042616 | Bacteria | 1172 |
| 131 | Ga0466715_592208 | 3300042616 | Bacteria | 2614 |
| 132 | Ga0466723_010481 | 3300042618 | Bacteria | 18874 |
| 133 | Ga0466723_151504 | 3300042618 | Bacteria | 33081 |
| 134 | Ga0466726_333160 | 3300042619 | Bacteria | 1550 |
| 135 | Ga0466728_011066 | 3300042620 | Bacteria | 10869 |
| 136 | Ga0466728_141956 | 3300042620 | Bacteria | 1268 |
| 137 | Ga0466728_253503 | 3300042620 | Unclassified | 1060 |
| 138 | JGI24698J34947_10021979 | 3300002449 | Bacteria | 3425 |
| 139 | JGI24695J34938_10003620 | 3300002450 | Bacteria | 10614 |
| 140 | Ga0466722_008995 | 3300042609 | Bacteria | 2413 |
| 141 | Ga0466722_013846 | 3300042609 | Bacteria | 6369 |
| 142 | Ga0466705_199179 | 3300042612 | Bacteria | 18953 |
| 143 | Ga0466705_214633 | 3300042612 | Bacteria | 1503 |
| 144 | Ga0123353_10293772 | 3300010167 | Bacteria | 2486 |
| 145 | Ga0466690_045045 | 3300042590 | Unclassified | 2409 |
| 146 | Ga0466690_170277 | 3300042590 | Bacteria | 2657 |
| 147 | Ga0466692_115275 | 3300042591 | Bacteria | 1157 |
| 148 | Ga0466691_198559 | 3300042593 | Bacteria | 13562 |
| 149 | Ga0466696_058902 | 3300042596 | Bacteria | 1179 |
| 150 | Ga0466696_310965 | 3300042596 | Bacteria | 3192 |
| 151 | Ga0466696_382564 | 3300042596 | Bacteria | 2320 |
| 152 | Ga0466699_190159 | 3300042597 | Bacteria | 2513 |
| 153 | Ga0466735_144705 | 3300042624 | Bacteria | 3153 |
| 154 | Ga0466702_102320 | 3300042635 | Bacteria | 1384 |
| 155 | Ga0466704_223864 | 3300042643 | Bacteria | 2876 |
| 156 | Ga0466704_565934 | 3300042643 | Bacteria | 7585 |
| 157 | Ga0466709_006308 | 3300042648 | Bacteria | 7294 |
| 158 | Ga0466708_013276 | 3300042652 | Bacteria | 4708 |
| 159 | Ga0466708_142223 | 3300042652 | Bacteria | 6109 |
| 160 | Ga0466705_512622 | 3300042612 | Bacteria | 14154 |
| 161 | Ga0072941_1479126 | 3300005201 | Bacteria | 1006 |
| 162 | Ga0466716_494867 | 3300042605 | Bacteria | 2242 |
| 163 | Ga0466719_422546 | 3300042606 | Bacteria | 38458 |
| 164 | Ga0466732_298068 | 3300042656 | Bacteria | 8109 |
| 165 | Ga0466696_131950 | 3300042596 | Bacteria | 3468 |
| 166 | Ga0466696_295452 | 3300042596 | Bacteria | 3604 |
| 167 | Ga0466699_060995 | 3300042597 | Bacteria | 46589 |
| 168 | Ga0466703_003148 | 3300042636 | Bacteria | 15239 |
| 169 | Ga0466709_320206 | 3300042648 | Bacteria | 1061 |
| 170 | Ga0466708_417137 | 3300042652 | Bacteria | 2329 |
| 171 | Ga0466727_019216 | 3300042655 | Bacteria | 3347 |
| 172 | Ga0466705_507342 | 3300042612 | Bacteria | 4700 |
| 173 | Ga0466711_217462 | 3300042615 | Bacteria | 3410 |
| 174 | Ga0466711_253961 | 3300042615 | Bacteria | 28887 |
| 175 | Ga0466711_336244 | 3300042615 | Bacteria | 1470 |
| 176 | Ga0466711_434930 | 3300042615 | Bacteria | 5851 |
| 177 | Ga0466723_015466 | 3300042618 | Bacteria | 2003 |
| 178 | Ga0466723_153733 | 3300042618 | Bacteria | 8418 |
| 179 | Ga0466726_017894 | 3300042619 | Bacteria | 11731 |
| 180 | Ga0466726_235583 | 3300042619 | Bacteria | 4844 |
| 181 | Ga0466726_382479 | 3300042619 | Bacteria | 7125 |
| 182 | Ga0466728_131031 | 3300042620 | Bacteria | 2678 |
| 183 | Ga0466707_371895 | 3300042601 | Bacteria | 2301 |
| 184 | Ga0466719_178432 | 3300042606 | Bacteria | 37138 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.