Protein Family IF09247

Metagenome Isolate
110 Members
38 Samples
104 Scaffolds
461.63 Avg Length

🧬 Representative Sequence

ID
3300042636|Ga0466703_303628|Ga0466703_303628_4213_5781
Length
522 aa
Sequence
MAMQKLFKQGFFRNFGLWKNIFGFKGTSGLPAAFLLLPILIFSGAGAAYTQQRYPTGAILDKAAYNALPRKAPLATRAXXXXPEMVSLKRYAPLPGDQTEYGTCVAWASAYAARTISESIALNRNSQTETTRNVFSPVYIYRNIRPDDPECQRGAQIHWALDLMKDSGAVRMLEIERSVDFPRVDLSYYQESRRYPIADYVTLFSRDENSKTNLIVRTVKKSLVEGKPVIIGMNTPFSFMEAEGAWRPSESPDNYYGGHAMCVVGYDDNREGGAFEILNSWGRKWGNGGFIWIPYRAFQDFVMEGYEMIENLATYSDTVKFAGFARIEIEEAGSSSPAPLVFFPGAESPDPADTTAGFFKTAAPLRQGTEFRFVLGAAESAYVYAFAASQPQTGAEDHAGAAFSGAVYSPVQLFPQPGVSPLLNYSDSAVALPGEDKTLVLDNVPGMEYLVVLYAKQSLNILDIMRRFEKAEGTVNARLSAVIGENLLSVNTAADTGREAAFTAESSDAKTVAALVVAIDHR

📊 Sample Types

Isolate 5.5%
Metagenome 94.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 38.9%
Kalotermitidae 33.3%
Unclassified 19.4%
Termopsidae 5.6%
Rhinotermitidae 2.8%

🌳 Taxonomy

Archaea 1
Bacteria 102
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
14 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
15 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
16 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
17 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
18 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
19 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
20 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
25 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
26 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
27 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
28 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
29 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
30 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
31 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
34 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
35 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
36 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_271103 3300042614 Bacteria 6967
2 Ga0466718_040875 3300042617 Bacteria 3844
3 Ga0466707_396443 3300042601 Bacteria 1547
4 Ga0466720_043964 3300042607 Bacteria 8445
5 Ga0466720_051080 3300042607 Bacteria 3265
6 Ga0466720_087053 3300042607 Bacteria 5202
7 Ga0466720_172250 3300042607 Bacteria 10718
8 Ga0466722_052247 3300042609 Bacteria 1939
9 Ga0466702_135558 3300042635 Bacteria 18963
10 Ga0466703_409249 3300042636 Unclassified 4246
11 AustNasuHG_c1000891 3300000089 Bacteria 10774
12 AustNasuHG_c1003212 3300000089 Bacteria 5900
13 JGI24695J34938_10001194 3300002450 Bacteria 23018
14 JGI24695J34938_10005682 3300002450 Bacteria 7700
15 Ga0068302_10199862 3300005071 Bacteria 2526
16 Ga0072941_1004232 3300005201 Bacteria 14640
17 Ga0466696_421546 3300042596 Bacteria 28748
18 Ga0466699_092447 3300042597 Bacteria 42528
19 Ga0466712_016835 3300042614 Archaea 3667
20 Ga0466718_016001 3300042617 Unclassified 2865
21 Ga0466718_045056 3300042617 Bacteria 11672
22 Ga0466720_059006 3300042607 Bacteria 7710
23 Ga0466720_087496 3300042607 Bacteria 12622
24 Ga0466720_112824 3300042607 Bacteria 9572
25 Ga0466708_219903 3300042652 Bacteria 33244
26 AustNasuHG_c1018430 3300000089 Bacteria 2304
27 JGI24695J34938_10000632 3300002450 Bacteria 33543
28 JGI24695J34938_10001068 3300002450 Bacteria 24786
29 Ga0466705_287503 3300042612 Bacteria 9145
30 Ga0123356_10001954 3300010049 Bacteria 22316
31 Ga0466691_087711 3300042593 Bacteria 4953
32 Ga0466694_266228 3300042594 Bacteria 7604
33 Ga0466699_211009 3300042597 Bacteria 48420
34 Ga0466699_318736 3300042597 Bacteria 6134
35 Ga0466718_119080 3300042617 Bacteria 2462
36 Ga0466720_006714 3300042607 Bacteria 7145
37 Ga0466720_150298 3300042607 Bacteria 2400
38 Ga0466720_155383 3300042607 Bacteria 2378
39 Ga0466708_276885 3300042652 Bacteria 2052
40 Ga0072940_1062762 3300005200 Bacteria 7066
41 Ga0072941_1084932 3300005201 Bacteria 2146
42 Ga0466732_051479 3300042656 Bacteria 2400
43 Ga0123356_10000344 3300010049 Bacteria 53657
44 Ga0123353_10118887 3300010167 Bacteria 4250
45 Ga0466699_252562 3300042597 Bacteria 9165
46 Ga0466705_391799 3300042612 Bacteria 4813
47 Ga0466712_144716 3300042614 Bacteria 5499
48 Ga0466715_285840 3300042616 Bacteria 21443
49 Ga0466709_285973 3300042648 Bacteria 3128
50 JGI24695J34938_10001656 3300002450 Bacteria 18523
51 JGI24695J34938_10002412 3300002450 Bacteria 14335
52 Ga0264413_101471 3300024493 Bacteria 49537
53 Ga0466693_147270 3300042592 Bacteria 11696
54 Ga0466699_002401 3300042597 Bacteria 74503
55 Ga0466699_055351 3300042597 Bacteria 5101
56 Ga0466699_246316 3300042597 Bacteria 1828
57 Ga0466711_135447 3300042615 Bacteria 3692
58 Ga0466718_017209 3300042617 Bacteria 2940
59 Ga0466723_003985 3300042618 Unclassified 1791
60 Ga0466720_118229 3300042607 Bacteria 2218
61 Ga0466703_040924 3300042636 Bacteria 12128
62 Ga0466704_095731 3300042643 Bacteria 6436
63 Ga0466709_003306 3300042648 Bacteria 12751
64 Ga0466727_089165 3300042655 Bacteria 1591
65 Ga0072940_1045244 3300005200 Bacteria 5193
66 Ga0072940_1121330 3300005200 Bacteria 3797
67 Ga0466705_050150 3300042612 Bacteria 30586
68 Ga0123356_10002586 3300010049 Bacteria 19291
69 Ga0123356_10016944 3300010049 Bacteria 6939
70 Ga0123356_10114074 3300010049 Bacteria 2615
71 Ga0466696_180132 3300042596 Bacteria 2181
72 Ga0466718_092897 3300042617 Bacteria 10704
73 Ga0466720_005981 3300042607 Bacteria 6068
74 Ga0466722_259532 3300042609 Bacteria 2213
75 Ga0466703_164835 3300042636 Bacteria 3269
76 Ga0466703_169741 3300042636 Bacteria 11654
77 Ga0466703_220039 3300042636 Bacteria 4690
78 Ga0466703_303628 3300042636 Bacteria 9928
79 Ga0466709_147502 3300042648 Unclassified 2950
80 JGI24698J34947_10003168 3300002449 Bacteria 8906
81 JGI24695J34938_10026392 3300002450 Bacteria 2761
82 Ga0466699_170740 3300042597 Bacteria 35644
83 Ga0466728_222053 3300042620 Unclassified 3029
84 Ga0466719_024195 3300042606 Bacteria 4717
85 Ga0466719_376908 3300042606 Bacteria 2773
86 Ga0466704_141383 3300042643 Bacteria 4372
87 Ga0466704_433789 3300042643 Bacteria 54851
88 Ga0466709_368277 3300042648 Bacteria 2808
89 Ga0466708_192114 3300042652 Unclassified 3361
90 JGI24698J34947_10020764 3300002449 Bacteria 3536
91 JGI24695J34938_10000294 3300002450 Bacteria 49200
92 JGI24695J34938_10001085 3300002450 Bacteria 24581
93 Ga0466705_196375 3300042612 Bacteria 6146
94 Ga0466691_081052 3300042593 Bacteria 6669
95 Ga0466691_115889 3300042593 Bacteria 21188
96 Ga0466694_002749 3300042594 Bacteria 3102
97 Ga0466699_138737 3300042597 Bacteria 2462
98 Ga0466711_140332 3300042615 Bacteria 8972
99 Ga0466720_008712 3300042607 Bacteria 2123
100 Ga0466709_036205 3300042648 Bacteria 1755
101 Ga0466709_308989 3300042648 Bacteria 13963
102 AustNasuHG_c1008625 3300000089 Bacteria 3607
103 AustNasuHG_c1017766 3300000089 Bacteria 2359
104 JGI24695J34938_10010379 3300002450 Unclassified 5101

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13529 Peptidase_C39_2 Peptidase_C39 like family 194 270 0.84
PF00112 Peptidase_C1 Papain family cysteine protease 213 294 0.7

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.