Protein Family IF09062

Metagenome Isolate
128 Members
45 Samples
113 Scaffolds
349.7 Avg Length

🧬 Representative Sequence

ID
3300042635|Ga0466702_277608|Ga0466702_277608_3214_4275
Length
353 aa
Sequence
MYTREILAPVNSPIEDGKPLYGTWNRAFEKVDLQEIRRPYRYPLPRWARNYRIKEWECFSAQDEHFLLEAIFCNVKLYRMAQVVLYDKDNDKKFVFRKIKPGTGWQLPLSLSNASVDSHSSSFYFRIHSWLDADTIKLDINVEASRSRPSLTVHLAYNVSRQDVTPMAVSLGISEQRSMYAYKALAPVRGDIVLGGRHIIFKQDACSGFFCDYKGYFPYRMQTTFCSAMGFSDTAGEEKKRFGFHIAESQTRESNRNNENAMWINGQLTPLPPVLITMPHGSDADWVIQDLEGMVDLTFTPKEQNKSGVNLLFTNADFNAPIGYYNGMLVSSDGTQIQIKNLIGIGEKLYLRV

📊 Sample Types

Isolate 11.7%
Metagenome 88.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 48.8%
Unclassified 37.2%
Kalotermitidae 11.6%
Rhinotermitidae 2.3%

🌳 Taxonomy

Archaea 0
Bacteria 124
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
8 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
9 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
10 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
11 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
12 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
15 2228664001 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4a from Florida USA Metagenome Termitidae
16 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
17 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
18 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
19 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
20 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
21 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
22 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
25 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
26 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
27 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
36 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
37 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
38 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
39 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
40 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
41 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
42 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
43 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
44 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
45 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466721_315556 3300042608 Bacteria 9037
2 Ga0466712_036926 3300042614 Bacteria 53774
3 Ga0466690_013107 3300042590 Bacteria 3135
4 Ga0466691_169516 3300042593 Bacteria 3644
5 Ga0466699_425977 3300042597 Unclassified 18731
6 AustNasuHG_c1014541 3300000089 Bacteria 2673
7 JGI24695J34938_10001204 3300002450 Bacteria 22938
8 JGI24695J34938_10010402 3300002450 Bacteria 5093
9 JGI24695J34938_10067429 3300002450 Bacteria 1505
10 Ga0072941_1011847 3300005201 Bacteria 41565
11 Ga0466705_170422 3300042612 Bacteria 3524
12 Ga0466720_083736 3300042607 Bacteria 5023
13 Ga0466720_151136 3300042607 Bacteria 2097
14 Ga0123356_10002659 3300010049 Bacteria 18993
15 Ga0123356_10009883 3300010049 Unclassified 9395
16 Ga0264413_108324 3300024493 Bacteria 12410
17 Ga0466694_069852 3300042594 Bacteria 47276
18 JGI24698J34947_10000491 3300002449 Bacteria 18592
19 JGI24698J34947_10013673 3300002449 Bacteria 4422
20 JGI24695J34938_10000239 3300002450 Bacteria 52549
21 JGI24695J34938_10006995 3300002450 Bacteria 6688
22 Ga0466731_265933 3300042622 Bacteria 3680
23 Ga0466720_146820 3300042607 Bacteria 22628
24 Ga0123356_10003181 3300010049 Bacteria 17262
25 Ga0123356_10006588 3300010049 Bacteria 11702
26 Ga0123356_10151220 3300010049 Bacteria 2305
27 Ga0466718_064176 3300042617 Bacteria 9765
28 Ga0264413_111735 3300024493 Bacteria 3444
29 Ga0466694_001700 3300042594 Bacteria 12564
30 Ga0466694_404902 3300042594 Bacteria 9975
31 2230969614 2228664004 Bacteria 11396
32 JGI24698J34947_10001672 3300002449 Bacteria 11841
33 JGI24695J34938_10000205 3300002450 Bacteria 55959
34 JGI24695J34938_10000613 3300002450 Bacteria 34131
35 JGI24695J34938_10012418 3300002450 Bacteria 4514
36 JGI24695J34938_10022343 3300002450 Bacteria 3073
37 Ga0072940_1004044 3300005200 Bacteria 5082
38 Ga0072941_1022554 3300005201 Bacteria 12389
39 Ga0466702_277608 3300042635 Bacteria 17818
40 Ga0123356_10000747 3300010049 Bacteria 35948
41 Ga0123356_10002137 3300010049 Bacteria 21316
42 Ga0123356_10034226 3300010049 Bacteria 4749
43 Ga0466712_065088 3300042614 Bacteria 15347
44 Ga0466712_162807 3300042614 Bacteria 18281
45 Ga0466718_008050 3300042617 Bacteria 9988
46 Ga0466718_017588 3300042617 Bacteria 6508
47 Ga0466718_128558 3300042617 Bacteria 2679
48 Ga0264413_117182 3300024493 Bacteria 1602
49 Ga0415639_017351 3300038395 Bacteria 6845
50 Ga0415639_021237 3300038395 Bacteria 2632
51 Ga0466693_230190 3300042592 Bacteria 5780
52 Ga0466691_029797 3300042593 Bacteria 4715
53 JGI24698J34947_10000928 3300002449 Bacteria 14892
54 JGI24695J34938_10000248 3300002450 Bacteria 52089
55 JGI24695J34938_10003599 3300002450 Bacteria 10654
56 JGI24702J35022_10002662 3300002462 Bacteria 10841
57 Ga0466702_159365 3300042635 Bacteria 1598
58 Ga0466705_160074 3300042612 Bacteria 9700
59 Ga0466716_173189 3300042605 Bacteria 10968
60 Ga0466720_017268 3300042607 Bacteria 4927
61 Ga0466712_024215 3300042614 Bacteria 4169
62 Ga0466712_026794 3300042614 Bacteria 12133
63 Ga0466712_071809 3300042614 Bacteria 23029
64 Ga0466712_106730 3300042614 Bacteria 12105
65 Ga0466718_076204 3300042617 Bacteria 27138
66 Ga0264413_103451 3300024493 Bacteria 5523
67 Ga0264413_116050 3300024493 Bacteria 3797
68 AustNasuHG_c1010930 3300000089 Bacteria 3151
69 JGI24698J34947_10075353 3300002449 Bacteria 1604
70 JGI24695J34938_10000902 3300002450 Bacteria 27417
71 JGI24695J34938_10001396 3300002450 Bacteria 20635
72 JGI24695J34938_10003023 3300002450 Bacteria 12079
73 Ga0072941_1000864 3300005201 Bacteria 37095
74 Ga0072941_1000901 3300005201 Bacteria 12380
75 Ga0072941_1052162 3300005201 Bacteria 3823
76 Ga0466698_350036 3300042610 Bacteria 21324
77 Ga0123356_10359546 3300010049 Bacteria 1582
78 Ga0123353_10005537 3300010167 Bacteria 16599
79 Ga0466712_029724 3300042614 Bacteria 17236
80 Ga0466712_073680 3300042614 Bacteria 30571
81 Ga0466718_003703 3300042617 Bacteria 8470
82 Ga0264413_102974 3300024493 Bacteria 24770
83 Ga0466696_300163 3300042596 Bacteria 19461
84 Ga0466699_065431 3300042597 Bacteria 25231
85 2230930164 2228664001 Bacteria 2493
86 JGI24695J34938_10000054 3300002450 Bacteria 90526
87 JGI24695J34938_10000204 3300002450 Bacteria 55960
88 JGI24695J34938_10003431 3300002450 Bacteria 11093
89 Ga0466702_391567 3300042635 Bacteria 17763
90 Ga0466707_186394 3300042601 Bacteria 3136
91 Ga0466720_006698 3300042607 Bacteria 5891
92 Ga0466720_065223 3300042607 Bacteria 24050
93 Ga0123356_10325885 3300010049 Bacteria 1651
94 Ga0466712_167627 3300042614 Unclassified 13851
95 Ga0466718_005767 3300042617 Bacteria 3617
96 Ga0264413_126988 3300024493 Unclassified 3472
97 Ga0466696_076558 3300042596 Bacteria 15277
98 Ga0466699_053212 3300042597 Bacteria 3057
99 AustNasuHG_c1004238 3300000089 Bacteria 5147
100 JGI24698J34947_10000083 3300002449 Bacteria 31087
101 JGI24698J34947_10043032 3300002449 Bacteria 2317
102 JGI24700J35501_10930874 3300002508 Bacteria 31128
103 Ga0072941_1052160 3300005201 Bacteria 9148
104 Ga0123356_10078267 3300010049 Bacteria 3121
105 Ga0466718_024621 3300042617 Bacteria 2232
106 Ga0466692_044094 3300042591 Bacteria 1395
107 Ga0466693_361217 3300042592 Bacteria 6615
108 AustNasuHG_c1000990 3300000089 Bacteria 10244
109 JGI24698J34947_10005600 3300002449 Bacteria 6890
110 JGI24695J34938_10000267 3300002450 Bacteria 50738
111 JGI24695J34938_10000722 3300002450 Bacteria 31183
112 JGI24695J34938_10004027 3300002450 Bacteria 9871
113 Ga0466702_454726 3300042635 Bacteria 1596

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22866 DUF2804_C Domain of unknown function (DUF2804), C-terminal 236 347 0.92
PF10974 DUF2804_N Domain of unknown function (DUF2804), N-terminal 48 208 0.81

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.