Protein Family IF09051

Metagenome Isolate
118 Members
41 Samples
114 Scaffolds
182.36 Avg Length

🧬 Representative Sequence

ID
3300042635|Ga0466702_168648|Ga0466702_168648_769_1383
Length
204 aa
Sequence
MVRLFIAVNCNDETKTQLLSVRDCIKAQSIKGNFSRAENLHLTLAFLGETPEEQIPLISRLITQAATQPPVSPFALNFTHTGCFKHSNKELWWIGADSKDPALCALTDLRQKLAAGLLEAGIKFDNRAFNPHITLGREIKHSAPIKLPETKVVMPVDRISLMKSEHLGGKLVYTSGGCLAASIYNSSRARPERTYTEVFGQGLR

📊 Sample Types

Isolate 3.4%
Metagenome 96.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 51.3%
Kalotermitidae 33.3%
Unclassified 12.8%
Rhinotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 112
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
2 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
12 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
15 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
16 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
19 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
20 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
21 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
24 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
25 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
26 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
27 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
28 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
29 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
30 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
31 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
32 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
33 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
34 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
35 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
36 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
37 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
38 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
39 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
40 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
41 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_134594 3300024493 Bacteria 999
2 Ga0466690_306767 3300042590 Bacteria 6939
3 Ga0466695_006011 3300042595 Unclassified 1708
4 Ga0466712_001612 3300042614 Bacteria 6936
5 Ga0466712_174633 3300042614 Bacteria 3179
6 Ga0466712_234638 3300042614 Bacteria 8887
7 Ga0466718_057107 3300042617 Bacteria 1040
8 Ga0466718_069119 3300042617 Bacteria 1983
9 Ga0466723_080142 3300042618 Bacteria 6159
10 Ga0466731_156364 3300042622 Bacteria 2387
11 Ga0466702_438622 3300042635 Bacteria 7511
12 Ga0466704_390340 3300042643 Bacteria 5427
13 Ga0466698_392266 3300042610 Bacteria 2158
14 JGI24698J34947_10055275 3300002449 Bacteria 1979
15 Ga0072941_1015641 3300005201 Bacteria 5875
16 Ga0123356_11102877 3300010049 Bacteria 962
17 Ga0466732_043918 3300042656 Bacteria 2736
18 Ga0466696_250239 3300042596 Bacteria 1078
19 Ga0466699_433842 3300042597 Bacteria 2443
20 Ga0466718_169696 3300042617 Bacteria 1429
21 JGI24698J34947_10007312 3300002449 Bacteria 6069
22 JGI24698J34947_10028357 3300002449 Bacteria 2964
23 JGI24698J34947_10157643 3300002449 Bacteria 934
24 Ga0072941_1028847 3300005201 Bacteria 8501
25 Ga0072941_1037596 3300005201 Bacteria 5821
26 Ga0072941_1048256 3300005201 Bacteria 848
27 Ga0072941_1060250 3300005201 Bacteria 1475
28 Ga0072941_1075630 3300005201 Bacteria 1156
29 Ga0123353_10249937 3300010167 Bacteria 2747
30 Ga0123354_10082148 3300010882 Bacteria 4545
31 Ga0466712_001851 3300042614 Bacteria 5888
32 Ga0466712_317721 3300042614 Bacteria 3314
33 Ga0466718_018824 3300042617 Bacteria 1533
34 Ga0466723_060220 3300042618 Bacteria 35228
35 Ga0466723_338577 3300042618 Bacteria 2226
36 Ga0466702_061583 3300042635 Bacteria 1741
37 Ga0466702_097006 3300042635 Bacteria 1039
38 Ga0466704_053949 3300042643 Bacteria 11015
39 Ga0466709_307196 3300042648 Bacteria 1145
40 Ga0466719_490176 3300042606 Unclassified 1292
41 JGI24698J34947_10000005 3300002449 Bacteria 60180
42 JGI24698J34947_10115431 3300002449 Bacteria 1176
43 Ga0072941_1002056 3300005201 Bacteria 13571
44 Ga0123357_10535778 3300009784 Bacteria 945
45 Ga0123353_10310167 3300010167 Bacteria 2402
46 Ga0466705_275037 3300042612 Bacteria 6951
47 Ga0466732_250749 3300042656 Bacteria 2066
48 Ga0466690_123246 3300042590 Bacteria 14507
49 Ga0466699_124276 3300042597 Bacteria 2679
50 Ga0466712_001635 3300042614 Bacteria 7371
51 Ga0466712_022064 3300042614 Bacteria 3077
52 Ga0466712_054773 3300042614 Bacteria 5486
53 Ga0466712_280072 3300042614 Bacteria 1390
54 Ga0466718_090363 3300042617 Bacteria 1966
55 Ga0466728_074101 3300042620 Bacteria 5442
56 Ga0466704_142741 3300042643 Bacteria 2505
57 Ga0466709_272878 3300042648 Bacteria 8766
58 Ga0466709_365062 3300042648 Bacteria 1258
59 Ga0466713_120802 3300042602 Bacteria 4365
60 JGI24698J34947_10041239 3300002449 Bacteria 2378
61 JGI24698J34947_10167917 3300002449 Bacteria 891
62 Ga0072941_1026674 3300005201 Bacteria 3059
63 Ga0123357_10000236 3300009784 Bacteria 52499
64 Ga0123353_10816483 3300010167 Bacteria 1285
65 Ga0466691_195425 3300042593 Unclassified 1169
66 Ga0466712_009893 3300042614 Bacteria 1170
67 Ga0466712_028926 3300042614 Bacteria 19762
68 Ga0466712_078497 3300042614 Bacteria 1676
69 Ga0466712_288009 3300042614 Bacteria 1850
70 Ga0466704_561432 3300042643 Bacteria 5138
71 Ga0466719_364487 3300042606 Bacteria 5381
72 Ga0466722_183762 3300042609 Bacteria 3081
73 JGI24698J34947_10137947 3300002449 Bacteria 1032
74 Ga0072941_1010474 3300005201 Bacteria 5656
75 Ga0072941_1200503 3300005201 Bacteria 1224
76 Ga0466705_194007 3300042612 Bacteria 5390
77 Ga0466694_083944 3300042594 Bacteria 13067
78 Ga0466712_029190 3300042614 Bacteria 4122
79 Ga0466712_060898 3300042614 Bacteria 5491
80 Ga0466715_130553 3300042616 Bacteria 2237
81 Ga0466718_112028 3300042617 Bacteria 2526
82 Ga0466728_091251 3300042620 Bacteria 4672
83 Ga0466716_109493 3300042605 Bacteria 6007
84 Ga0466716_114793 3300042605 Bacteria 22083
85 JGI24698J34947_10041566 3300002449 Bacteria 2367
86 JGI24697J35500_11271783 3300002507 Bacteria 4665
87 Ga0072940_1021072 3300005200 Unclassified 4456
88 Ga0123353_11258783 3300010167 Bacteria 965
89 Ga0466696_075747 3300042596 Unclassified 2381
90 Ga0466718_112091 3300042617 Bacteria 2117
91 Ga0466728_021268 3300042620 Bacteria 9101
92 Ga0466708_056844 3300042652 Bacteria 13240
93 JGI24705J35276_12128877 3300002504 Bacteria 1097
94 Ga0072940_1184046 3300005200 Unclassified 1837
95 Ga0072941_1001032 3300005201 Bacteria 18229
96 Ga0072941_1009206 3300005201 Bacteria 12545
97 Ga0123357_10041220 3300009784 Bacteria 6278
98 Ga0123357_10326658 3300009784 Bacteria 1506
99 Ga0123353_10226369 3300010167 Bacteria 2919
100 Ga0123353_11273598 3300010167 Bacteria 957
101 Ga0466691_025735 3300042593 Bacteria 7688
102 Ga0466694_398355 3300042594 Bacteria 1033
103 Ga0466723_345541 3300042618 Bacteria 8295
104 Ga0466728_415915 3300042620 Bacteria 1010
105 Ga0466702_168648 3300042635 Bacteria 2083
106 Ga0466703_060909 3300042636 Bacteria 24088
107 Ga0466700_117576 3300042600 Bacteria 1742
108 Ga0466722_017093 3300042609 Bacteria 1783
109 Ga0466722_191827 3300042609 Bacteria 2634
110 AustNasuHG_c1002265 3300000089 Bacteria 6943
111 JGI24698J34947_10024311 3300002449 Bacteria 3236
112 JGI24698J34947_10067908 3300002449 Bacteria 1727
113 JGI24702J35022_10012930 3300002462 Bacteria 4630
114 JGI24702J35022_10039614 3300002462 Bacteria 2514

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300002449 JGI24698J34947_10067908 JGI24698J34947_100679082 169
2 3300002449 JGI24698J34947_10167917 JGI24698J34947_101679171 170
3 3300024493 Ga0264413_134594 Ga0264413_1345941 170
4 3300042656 Ga0466732_250749 Ga0466732_250749_800_1312 170
5 3300042597 Ga0466699_124276 Ga0466699_124276_356_874 172
6 3300042622 Ga0466731_156364 Ga0466731_156364_1598_2116 172
7 3300002462 JGI24702J35022_10012930 JGI24702J35022_100129303 173
8 3300005200 Ga0072940_1184046 Ga0072940_11840463 173
9 3300005201 Ga0072941_1009206 Ga0072941_100920611 173
10 3300005201 Ga0072941_1028847 Ga0072941_10288475 173
11 3300042600 Ga0466700_117576 Ga0466700_117576_179_700 173
12 3300042614 Ga0466712_060898 Ga0466712_060898_1479_2003 174
13 3300042648 Ga0466709_307196 Ga0466709_307196_109_633 174
14 3300042656 Ga0466732_043918 Ga0466732_043918_461_985 174
15 3300010167 Ga0123353_11258783 Ga0123353_112587831 175
16 3300010167 Ga0123353_11273598 Ga0123353_112735982 175
17 3300000089 AustNasuHG_c1002265 AustNasuHG_10022652 176
18 3300005200 Ga0072940_1021072 Ga0072940_10210721 176
19 3300042594 Ga0466694_083944 Ga0466694_083944_5177_5707 176
20 3300042597 Ga0466699_433842 Ga0466699_433842_298_828 176
21 3300042606 Ga0466719_364487 Ga0466719_364487_508_1059 176
22 3300042606 Ga0466719_490176 Ga0466719_490176_602_1132 176
23 3300042610 Ga0466698_392266 Ga0466698_392266_1514_2044 176
24 3300042614 Ga0466712_288009 Ga0466712_288009_645_1175 176
25 3300042616 Ga0466715_130553 Ga0466715_130553_459_989 176
26 3300042617 Ga0466718_018824 Ga0466718_018824_134_664 176
27 3300042618 Ga0466723_345541 Ga0466723_345541_5143_5673 176
28 3300042643 Ga0466704_142741 Ga0466704_142741_1567_2097 176
29 3300042648 Ga0466709_365062 Ga0466709_365062_35_565 176
30 3300002449 JGI24698J34947_10000005 JGI24698J34947_100000052 177
31 3300002462 JGI24702J35022_10039614 JGI24702J35022_100396141 177
32 3300009784 Ga0123357_10041220 Ga0123357_100412203 177
33 3300009784 Ga0123357_10535778 Ga0123357_105357782 177
34 3300010167 Ga0123353_10816483 Ga0123353_108164832 177
35 3300002504 JGI24705J35276_12128877 JGI24705J35276_121288771 178
36 3300042595 Ga0466695_006011 Ga0466695_006011_639_1175 178
37 3300042617 Ga0466718_057107 Ga0466718_057107_235_771 178
38 3300042617 Ga0466718_069119 Ga0466718_069119_427_963 178
39 3300042617 Ga0466718_090363 Ga0466718_090363_472_1008 178
40 3300042617 Ga0466718_112028 Ga0466718_112028_1280_1816 178
41 iso_pr_bacteria 2781125666 2781343660 178
42 3300009784 Ga0123357_10000236 Ga0123357_1000023618 179
43 3300009784 Ga0123357_10326658 Ga0123357_103266581 179
44 3300010167 Ga0123353_10249937 Ga0123353_102499372 179
45 3300042602 Ga0466713_120802 Ga0466713_120802_2439_2978 179
46 3300042614 Ga0466712_022064 Ga0466712_022064_671_1210 179
47 3300042617 Ga0466718_112091 Ga0466718_112091_159_698 179
48 3300042617 Ga0466718_169696 Ga0466718_169696_732_1271 179
49 3300002449 JGI24698J34947_10007312 JGI24698J34947_100073122 180
50 3300042596 Ga0466696_250239 Ga0466696_250239_306_848 180
51 3300042614 Ga0466712_001612 Ga0466712_001612_2425_2967 180
52 3300042614 Ga0466712_028926 Ga0466712_028926_11280_11822 180
53 3300042620 Ga0466728_074101 Ga0466728_074101_4772_5314 180
54 3300042620 Ga0466728_415915 Ga0466728_415915_341_883 180
55 3300042635 Ga0466702_438622 Ga0466702_438622_5532_6074 180
56 iso_pr_bacteria 2820016619 2820018323 180
57 3300010167 Ga0123353_10310167 Ga0123353_103101672 181
58 3300042609 Ga0466722_183762 Ga0466722_183762_2282_2827 181
59 3300042614 Ga0466712_078497 Ga0466712_078497_884_1429 181
60 3300042614 Ga0466712_174633 Ga0466712_174633_2339_2884 181
61 3300002449 JGI24698J34947_10028357 JGI24698J34947_100283572 182
62 3300002449 JGI24698J34947_10041566 JGI24698J34947_100415663 182
63 3300002449 JGI24698J34947_10115431 JGI24698J34947_101154312 182
64 3300002449 JGI24698J34947_10137947 JGI24698J34947_101379472 182
65 3300005201 Ga0072941_1026674 Ga0072941_10266743 182
66 3300005201 Ga0072941_1037596 Ga0072941_10375966 182
67 3300005201 Ga0072941_1048256 Ga0072941_10482561 182
68 3300005201 Ga0072941_1075630 Ga0072941_10756301 182
69 3300005201 Ga0072941_1200503 Ga0072941_12005031 182
70 3300010049 Ga0123356_11102877 Ga0123356_111028771 182
71 3300042635 Ga0466702_061583 Ga0466702_061583_823_1371 182
72 3300042635 Ga0466702_097006 Ga0466702_097006_319_867 182
73 3300002449 JGI24698J34947_10024311 JGI24698J34947_100243113 183
74 3300002449 JGI24698J34947_10041239 JGI24698J34947_100412394 183
75 3300005201 Ga0072941_1002056 Ga0072941_10020563 183
76 3300042614 Ga0466712_029190 Ga0466712_029190_1017_1568 183
77 3300010167 Ga0123353_10226369 Ga0123353_102263693 184
78 iso_pr_bacteria 2781125692 2781432611 184
79 3300002507 JGI24697J35500_11271783 JGI24697J35500_112717834 185
80 3300005201 Ga0072941_1010474 Ga0072941_10104742 185
81 3300005201 Ga0072941_1015641 Ga0072941_10156416 185
82 3300042614 Ga0466712_001851 Ga0466712_001851_2118_2675 185
83 3300042620 Ga0466728_091251 Ga0466728_091251_1738_2295 185
84 iso_pr_bacteria 2781125687 2781420959 185
85 3300010882 Ga0123354_10082148 Ga0123354_100821483 186
86 3300002449 JGI24698J34947_10055275 JGI24698J34947_100552752 187
87 3300042612 Ga0466705_275037 Ga0466705_275037_3655_4218 187
88 3300042636 Ga0466703_060909 Ga0466703_060909_22168_22731 187
89 3300042590 Ga0466690_123246 Ga0466690_123246_1611_2177 188
90 3300042614 Ga0466712_001635 Ga0466712_001635_1426_1992 188
91 3300042618 Ga0466723_060220 Ga0466723_060220_1142_1708 188
92 3300002449 JGI24698J34947_10157643 JGI24698J34947_101576432 189
93 3300042609 Ga0466722_191827 Ga0466722_191827_38_631 189
94 3300042612 Ga0466705_194007 Ga0466705_194007_4303_4872 189
95 3300042620 Ga0466728_021268 Ga0466728_021268_8398_8967 189
96 3300042643 Ga0466704_053949 Ga0466704_053949_5579_6148 189
97 3300042643 Ga0466704_390340 Ga0466704_390340_3558_4127 189
98 3300042593 Ga0466691_025735 Ga0466691_025735_6724_7296 190
99 3300042609 Ga0466722_017093 Ga0466722_017093_119_691 190
100 3300005201 Ga0072941_1060250 Ga0072941_10602502 191
101 3300042614 Ga0466712_009893 Ga0466712_009893_494_1069 191
102 3300042614 Ga0466712_054773 Ga0466712_054773_608_1183 191
103 3300042614 Ga0466712_280072 Ga0466712_280072_580_1155 191
104 3300042643 Ga0466704_561432 Ga0466704_561432_316_891 191
105 3300042652 Ga0466708_056844 Ga0466708_056844_9169_9744 191
106 3300042618 Ga0466723_080142 Ga0466723_080142_1864_2442 192
107 3300042593 Ga0466691_195425 Ga0466691_195425_488_1072 194
108 3300042594 Ga0466694_398355 Ga0466694_398355_237_821 194
109 3300042596 Ga0466696_075747 Ga0466696_075747_1766_2353 195
110 3300042605 Ga0466716_109493 Ga0466716_109493_315_905 196
111 3300042605 Ga0466716_114793 Ga0466716_114793_14528_15118 196
112 3300005201 Ga0072941_1001032 Ga0072941_10010328 197
113 3300042590 Ga0466690_306767 Ga0466690_306767_3482_4075 197
114 3300042614 Ga0466712_317721 Ga0466712_317721_1488_2081 197
115 3300042618 Ga0466723_338577 Ga0466723_338577_1344_1940 198
116 3300042648 Ga0466709_272878 Ga0466709_272878_6597_7193 198
117 3300042614 Ga0466712_234638 Ga0466712_234638_3477_4076 199
118 3300042635 Ga0466702_168648 Ga0466702_168648_769_1383 204

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF02834 LigT_PEase LigT like Phosphoesterase 10 87 0.84
PF13563 2_5_RNA_ligase2 2'-5' RNA ligase superfamily 31 164 0.79

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.85 0.91 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.