Protein Family IF08736

Metagenome Isolate
121 Members
28 Samples
118 Scaffolds
360.08 Avg Length

🧬 Representative Sequence

ID
3300042624|Ga0466735_022823|Ga0466735_022823_382_1608
Length
408 aa
Sequence
MVFQAGYIPAPPFYGILKGYLGLKNGSDEVFVAKEKRKYWIILGFFVFVVYIFVAAEPIPLETVLLPRWLSSLESDYSTFLGDDTPLPGDYLVPFKLGNRFGFVDTRGQFTINQAVKGRVSLSDERWSEFEAIPETVSIRSPAGEELALIKGGRGYPLFLDGRIFLIGEEQNSLSLVSEAGELLWTYDFAAPLTSIDAGAGLILTGSLDGTVELLDSSGKRVFFFEPGGSRLSVIAGCRISRDGARIAIVSGYDDQRFLLLERLGDSYKVAYHEFLEDGFRHAVHIAFVDNDSWVAFERQGGLGIYEVESRRSLKVPFPGTIRALDEMGSQGLLFVITANSGDTPNYGAGPANGAMRGREKTLTAIRLPGAIVMQAPFKSETAFLSRRGQELYVGGGMTLASFELEKR

📊 Sample Types

Isolate 2.5%
Metagenome 97.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 46.4%
Termitidae 17.9%
Unclassified 10.7%
Rhinotermitidae 10.7%
Termopsidae 10.7%
Blaberidae 3.6%

🌳 Taxonomy

Archaea 0
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 7

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2772190975 Treponema sp. RmG30 Isolate Blaberidae
2 650716102 Treponema primitia ZAS-2 Isolate Unclassified
3 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
8 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
9 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
12 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
13 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
14 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
15 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
16 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
17 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
18 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
19 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
20 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
23 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
24 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
25 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
26 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
27 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_185586 3300042612 Bacteria 13913
2 Ga0466705_362590 3300042612 Bacteria 4921
3 Ga0466712_016782 3300042614 Bacteria 18547
4 Ga0466711_172842 3300042615 Bacteria 2411
5 Ga0466715_082384 3300042616 Bacteria 15813
6 Ga0466723_077259 3300042618 Bacteria 4922
7 Ga0466729_239425 3300042621 Bacteria 6279
8 Ga0466703_278021 3300042636 Bacteria 19324
9 Ga0466704_337010 3300042643 Unclassified 2042
10 Ga0466708_071052 3300042652 Bacteria 9202
11 Ga0466708_146632 3300042652 Bacteria 3002
12 Ga0466708_292724 3300042652 Bacteria 2307
13 Ga0466719_183004 3300042606 Bacteria 7170
14 Ga0466690_375381 3300042590 Bacteria 1089
15 Ga0466691_174970 3300042593 Bacteria 1833
16 Ga0466696_081887 3300042596 Bacteria 28320
17 Ga0466696_451060 3300042596 Bacteria 1488
18 Ga0466723_043829 3300042618 Bacteria 3666
19 Ga0466723_065507 3300042618 Bacteria 10182
20 Ga0466728_459694 3300042620 Bacteria 17339
21 Ga0466707_296642 3300042601 Bacteria 1427
22 Ga0466722_140233 3300042609 Bacteria 2004
23 Ga0466690_008125 3300042590 Bacteria 2390
24 Ga0466690_102522 3300042590 Bacteria 2540
25 Ga0466705_317090 3300042612 Bacteria 17360
26 Ga0466715_325939 3300042616 Bacteria 2021
27 Ga0466723_327840 3300042618 Bacteria 24752
28 Ga0466729_044260 3300042621 Bacteria 8860
29 Ga0466703_007874 3300042636 Bacteria 8507
30 Ga0466703_076968 3300042636 Bacteria 13513
31 Ga0466703_089779 3300042636 Bacteria 6473
32 Ga0466708_126203 3300042652 Bacteria 4899
33 Ga0466707_240167 3300042601 Unclassified 1370
34 Ga0466707_278193 3300042601 Bacteria 3142
35 Ga0466707_420258 3300042601 Bacteria 2341
36 Ga0466692_078299 3300042591 Bacteria 18549
37 Ga0466694_152584 3300042594 Bacteria 3113
38 Ga0466696_313273 3300042596 Bacteria 11151
39 Ga0466699_116470 3300042597 Bacteria 1185
40 Ga0466705_125414 3300042612 Bacteria 3917
41 Ga0466715_091162 3300042616 Bacteria 3883
42 Ga0466723_149667 3300042618 Bacteria 1376
43 Ga0466723_275885 3300042618 Bacteria 2848
44 Ga0466723_328437 3300042618 Bacteria 3458
45 Ga0466726_077116 3300042619 Bacteria 2055
46 Ga0466726_254077 3300042619 Bacteria 2204
47 Ga0466728_074317 3300042620 Bacteria 4346
48 Ga0466704_028904 3300042643 Unclassified 3260
49 Ga0466704_055884 3300042643 Bacteria 73215
50 Ga0466708_405050 3300042652 Bacteria 47340
51 Ga0466708_446042 3300042652 Bacteria 2521
52 Ga0466707_411839 3300042601 Bacteria 1635
53 Ga0466716_434659 3300042605 Bacteria 3355
54 Ga0466719_392039 3300042606 Bacteria 2269
55 Ga0466691_085069 3300042593 Bacteria 9789
56 Ga0466691_157060 3300042593 Bacteria 27926
57 Ga0466715_034473 3300042616 Bacteria 16723
58 Ga0466728_440671 3300042620 Bacteria 1722
59 Ga0466729_210333 3300042621 Bacteria 1838
60 Ga0466729_304336 3300042621 Bacteria 2210
61 Ga0466735_078101 3300042624 Bacteria 14005
62 Ga0466704_295872 3300042643 Bacteria 7427
63 Ga0466708_005556 3300042652 Bacteria 7144
64 Ga0466708_032080 3300042652 Bacteria 5302
65 Ga0466708_051445 3300042652 Bacteria 1407
66 Ga0466708_066515 3300042652 Bacteria 8031
67 Ga0466716_029649 3300042605 Bacteria 26526
68 Ga0466719_158267 3300042606 Bacteria 2767
69 Ga0466690_011381 3300042590 Bacteria 15120
70 Ga0466690_412301 3300042590 Bacteria 1383
71 Ga0466699_373146 3300042597 Bacteria 13024
72 JGI24698J34947_10000905 3300002449 Bacteria 15011
73 Ga0466715_073807 3300042616 Bacteria 13111
74 Ga0466723_219105 3300042618 Bacteria 5013
75 Ga0466723_241063 3300042618 Bacteria 25345
76 Ga0466726_064967 3300042619 Unclassified 4846
77 Ga0466726_314554 3300042619 Bacteria 8912
78 Ga0466703_017560 3300042636 Bacteria 9933
79 Ga0466703_042331 3300042636 Bacteria 9252
80 Ga0466703_203152 3300042636 Bacteria 11778
81 Ga0466704_095845 3300042643 Bacteria 89284
82 Ga0466708_082899 3300042652 Bacteria 5416
83 Ga0466708_246134 3300042652 Bacteria 1003
84 Ga0466716_421801 3300042605 Bacteria 10458
85 Ga0466722_028991 3300042609 Bacteria 3106
86 Ga0466691_188131 3300042593 Bacteria 4565
87 Ga0466694_259645 3300042594 Bacteria 1272
88 Ga0466696_009002 3300042596 Bacteria 4374
89 Ga0466696_217133 3300042596 Bacteria 1830
90 Ga0466705_152975 3300042612 Bacteria 6931
91 Ga0466705_395889 3300042612 Bacteria 2699
92 Ga0466723_113302 3300042618 Bacteria 24927
93 Ga0466723_134372 3300042618 Bacteria 4728
94 Ga0466708_057346 3300042652 Bacteria 4647
95 Ga0466727_282735 3300042655 Bacteria 3135
96 Ga0466707_261336 3300042601 Bacteria 1387
97 Ga0466691_158896 3300042593 Bacteria 91295
98 Ga0466691_222900 3300042593 Bacteria 9677
99 Ga0466696_018524 3300042596 Bacteria 5052
100 Ga0466696_021735 3300042596 Bacteria 3744
101 Ga0466705_354189 3300042612 Bacteria 14692
102 Ga0466711_192602 3300042615 Bacteria 12297
103 Ga0466723_091665 3300042618 Bacteria 33303
104 Ga0466728_027351 3300042620 Bacteria 7712
105 Ga0466728_106895 3300042620 Bacteria 2829
106 Ga0466728_326385 3300042620 Bacteria 5158
107 Ga0466735_015701 3300042624 Bacteria 6140
108 Ga0466735_022823 3300042624 Bacteria 1737
109 Ga0466703_034204 3300042636 Bacteria 7467
110 Ga0466704_081706 3300042643 Bacteria 6410
111 Ga0466704_102232 3300042643 Bacteria 6650
112 Ga0466704_613707 3300042643 Unclassified 6946
113 Ga0466727_233724 3300042655 Unclassified 4892
114 Ga0466719_212391 3300042606 Bacteria 2255
115 Ga0466722_119081 3300042609 Bacteria 5042
116 Ga0466690_352812 3300042590 Bacteria 2785
117 Ga0466691_041165 3300042593 Bacteria 3499
118 JGI24700J35501_10927686 3300002508 Unclassified 6990

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.