Protein Family IF08542
Metagenome
Isolate
155
Members
27
Samples
154
Scaffolds
379.47
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_216623|Ga0466729_216623_5782_6996
- Length
- 404 aa
- Sequence
- LGYNIIFYTLIIFTIMNNTFKTILLSGMAAVTFASCEKDNPSGTKGSPLDEQYKNILAQYVDGTVVPTYKALAEAALEMRTANNALKDNPTDAAMKAASDAWMKARIEWEKSEAFLFGPVGEDGFDIDGHIDSWPLELQEIQASIAAGSAATGATMWSEYDSEVIGFHVTEYLLYRNGQPRPAADLSVAELNYLTSATDALVWDCVLAYVAWAGEDNVSTDIKTVFRANQDVVDALNDKAAFKNFAATLKNATGKYAGNFVAAISEISDGAADIAGEVGATKIESPFTSGRVEDVESWYSWHSLDDYQNNIHSIKNAYFGGIGLTAPTGNSLSAFVAAKNAQLDADIKGKIEDCLAKIAAIGAGGKSFYEVVRDHSNEDAVSAAVDACAELEGLFKRVSSSVIE
Sample Types
Isolate
0.7%
Metagenome
99.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
51.9%
Unclassified
14.8%
Termopsidae
14.8%
Termitidae
14.8%
Rhinotermitidae
3.7%
Taxonomy
Archaea
0
Bacteria
134
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_077431 | 3300042612 | Bacteria | 39083 |
| 2 | Ga0466705_354809 | 3300042612 | Bacteria | 40859 |
| 3 | Ga0466711_013538 | 3300042615 | Bacteria | 3349 |
| 4 | Ga0466715_478175 | 3300042616 | Bacteria | 20980 |
| 5 | Ga0466723_135882 | 3300042618 | Bacteria | 78165 |
| 6 | Ga0466723_158707 | 3300042618 | Bacteria | 21014 |
| 7 | Ga0466728_005521 | 3300042620 | Unclassified | 1410 |
| 8 | Ga0466707_296352 | 3300042601 | Bacteria | 4271 |
| 9 | Ga0466707_328413 | 3300042601 | Bacteria | 8263 |
| 10 | Ga0466716_085852 | 3300042605 | Bacteria | 4191 |
| 11 | Ga0466698_151798 | 3300042610 | Bacteria | 1644 |
| 12 | Ga0466691_117628 | 3300042593 | Bacteria | 15003 |
| 13 | Ga0466735_062568 | 3300042624 | Bacteria | 4281 |
| 14 | Ga0466735_121339 | 3300042624 | Unclassified | 2913 |
| 15 | Ga0466704_065871 | 3300042643 | Bacteria | 5565 |
| 16 | Ga0466709_309159 | 3300042648 | Bacteria | 10680 |
| 17 | Ga0466727_208452 | 3300042655 | Bacteria | 6004 |
| 18 | Ga0466715_122360 | 3300042616 | Bacteria | 7951 |
| 19 | Ga0466726_225202 | 3300042619 | Bacteria | 4621 |
| 20 | Ga0466728_194702 | 3300042620 | Bacteria | 13922 |
| 21 | Ga0466716_057605 | 3300042605 | Unclassified | 3075 |
| 22 | Ga0466716_095541 | 3300042605 | Bacteria | 62772 |
| 23 | Ga0466719_559088 | 3300042606 | Bacteria | 5930 |
| 24 | Ga0466690_275689 | 3300042590 | Bacteria | 12494 |
| 25 | Ga0466691_019174 | 3300042593 | Bacteria | 14878 |
| 26 | Ga0466735_159444 | 3300042624 | Bacteria | 3875 |
| 27 | Ga0466735_194450 | 3300042624 | Bacteria | 3611 |
| 28 | Ga0466703_240216 | 3300042636 | Unclassified | 1519 |
| 29 | Ga0466708_049337 | 3300042652 | Bacteria | 27530 |
| 30 | Ga0466708_271175 | 3300042652 | Bacteria | 49420 |
| 31 | Ga0466727_307411 | 3300042655 | Bacteria | 80907 |
| 32 | Ga0466733_086734 | 3300042659 | Bacteria | 3472 |
| 33 | Ga0466711_231531 | 3300042615 | Bacteria | 4817 |
| 34 | Ga0466711_265244 | 3300042615 | Bacteria | 22035 |
| 35 | Ga0466715_017264 | 3300042616 | Bacteria | 33622 |
| 36 | Ga0466715_208336 | 3300042616 | Bacteria | 27563 |
| 37 | Ga0466723_195700 | 3300042618 | Bacteria | 1590 |
| 38 | Ga0466723_263766 | 3300042618 | Bacteria | 1621 |
| 39 | Ga0466723_351617 | 3300042618 | Bacteria | 2066 |
| 40 | Ga0466726_188605 | 3300042619 | Bacteria | 3955 |
| 41 | Ga0466728_004937 | 3300042620 | Bacteria | 1395 |
| 42 | Ga0466707_046363 | 3300042601 | Bacteria | 7864 |
| 43 | Ga0466690_152381 | 3300042590 | Bacteria | 5508 |
| 44 | Ga0466690_245385 | 3300042590 | Bacteria | 1464 |
| 45 | Ga0466691_225989 | 3300042593 | Bacteria | 15891 |
| 46 | Ga0466735_017958 | 3300042624 | Bacteria | 5611 |
| 47 | Ga0466735_055098 | 3300042624 | Unclassified | 6169 |
| 48 | Ga0466735_106526 | 3300042624 | Unclassified | 1311 |
| 49 | Ga0466735_158160 | 3300042624 | Unclassified | 1613 |
| 50 | Ga0466703_179299 | 3300042636 | Bacteria | 6481 |
| 51 | Ga0466704_014419 | 3300042643 | Bacteria | 5318 |
| 52 | Ga0466709_009125 | 3300042648 | Bacteria | 2308 |
| 53 | Ga0466709_021250 | 3300042648 | Bacteria | 1582 |
| 54 | Ga0466709_044740 | 3300042648 | Bacteria | 3777 |
| 55 | Ga0466709_331055 | 3300042648 | Bacteria | 8608 |
| 56 | Ga0466727_219954 | 3300042655 | Bacteria | 5271 |
| 57 | Ga0466727_246192 | 3300042655 | Bacteria | 6810 |
| 58 | Ga0466733_040691 | 3300042659 | Bacteria | 8694 |
| 59 | Ga0466711_075432 | 3300042615 | Bacteria | 8627 |
| 60 | Ga0466711_344185 | 3300042615 | Bacteria | 5619 |
| 61 | Ga0466711_348283 | 3300042615 | Bacteria | 2670 |
| 62 | Ga0466715_055692 | 3300042616 | Bacteria | 4646 |
| 63 | Ga0466723_348523 | 3300042618 | Bacteria | 8215 |
| 64 | Ga0466726_310707 | 3300042619 | Bacteria | 11512 |
| 65 | Ga0466726_326037 | 3300042619 | Unclassified | 4783 |
| 66 | Ga0466728_246683 | 3300042620 | Bacteria | 2484 |
| 67 | Ga0466728_249094 | 3300042620 | Bacteria | 125538 |
| 68 | Ga0466719_004176 | 3300042606 | Bacteria | 3235 |
| 69 | Ga0466698_027181 | 3300042610 | Bacteria | 1582 |
| 70 | Ga0466735_154310 | 3300042624 | Unclassified | 1571 |
| 71 | Ga0466735_156660 | 3300042624 | Bacteria | 5680 |
| 72 | Ga0466703_054747 | 3300042636 | Bacteria | 2850 |
| 73 | Ga0466703_229649 | 3300042636 | Bacteria | 11553 |
| 74 | Ga0466703_326608 | 3300042636 | Bacteria | 7253 |
| 75 | Ga0466704_343706 | 3300042643 | Bacteria | 5834 |
| 76 | Ga0466708_088041 | 3300042652 | Bacteria | 4041 |
| 77 | Ga0466708_135821 | 3300042652 | Bacteria | 3414 |
| 78 | Ga0466727_071761 | 3300042655 | Bacteria | 2420 |
| 79 | Ga0068305_10120048 | 3300005083 | Unclassified | 8310 |
| 80 | Ga0466705_236390 | 3300042612 | Bacteria | 7015 |
| 81 | Ga0466705_238605 | 3300042612 | Bacteria | 8587 |
| 82 | Ga0466711_177255 | 3300042615 | Bacteria | 5290 |
| 83 | Ga0466723_289833 | 3300042618 | Bacteria | 9686 |
| 84 | Ga0466726_271135 | 3300042619 | Bacteria | 2887 |
| 85 | Ga0466728_093776 | 3300042620 | Unclassified | 1950 |
| 86 | Ga0466728_435917 | 3300042620 | Bacteria | 18038 |
| 87 | Ga0466707_131270 | 3300042601 | Bacteria | 23399 |
| 88 | Ga0466707_380799 | 3300042601 | Bacteria | 9618 |
| 89 | Ga0466716_217651 | 3300042605 | Bacteria | 21641 |
| 90 | Ga0466690_002563 | 3300042590 | Bacteria | 35514 |
| 91 | Ga0466691_062506 | 3300042593 | Bacteria | 9669 |
| 92 | Ga0466691_087123 | 3300042593 | Bacteria | 15868 |
| 93 | Ga0466735_027479 | 3300042624 | Unclassified | 1629 |
| 94 | Ga0466704_100528 | 3300042643 | Unclassified | 1379 |
| 95 | Ga0466704_266118 | 3300042643 | Bacteria | 9921 |
| 96 | Ga0466709_306794 | 3300042648 | Bacteria | 8551 |
| 97 | Ga0068302_10056412 | 3300005071 | Unclassified | 5752 |
| 98 | Ga0466705_366818 | 3300042612 | Bacteria | 2223 |
| 99 | Ga0466711_137330 | 3300042615 | Bacteria | 35994 |
| 100 | Ga0466711_289343 | 3300042615 | Bacteria | 1928 |
| 101 | Ga0466715_355429 | 3300042616 | Bacteria | 12118 |
| 102 | Ga0466707_120427 | 3300042601 | Bacteria | 18303 |
| 103 | Ga0466714_123988 | 3300042603 | Bacteria | 2066 |
| 104 | Ga0466690_430735 | 3300042590 | Bacteria | 6393 |
| 105 | Ga0466735_055383 | 3300042624 | Bacteria | 10880 |
| 106 | Ga0466735_109432 | 3300042624 | Bacteria | 1968 |
| 107 | Ga0466735_197628 | 3300042624 | Bacteria | 2390 |
| 108 | Ga0466735_232335 | 3300042624 | Unclassified | 2267 |
| 109 | Ga0466703_319134 | 3300042636 | Bacteria | 3657 |
| 110 | Ga0466704_033147 | 3300042643 | Unclassified | 3250 |
| 111 | Ga0466704_033765 | 3300042643 | Bacteria | 45083 |
| 112 | Ga0466704_242414 | 3300042643 | Bacteria | 10846 |
| 113 | Ga0466727_113681 | 3300042655 | Bacteria | 4160 |
| 114 | Ga0466727_277142 | 3300042655 | Bacteria | 3017 |
| 115 | Ga0068302_10228013 | 3300005071 | Unclassified | 1471 |
| 116 | Ga0466705_041128 | 3300042612 | Bacteria | 36311 |
| 117 | Ga0466711_019319 | 3300042615 | Bacteria | 2765 |
| 118 | Ga0466723_164522 | 3300042618 | Bacteria | 20800 |
| 119 | Ga0466723_287950 | 3300042618 | Bacteria | 10333 |
| 120 | Ga0466726_313457 | 3300042619 | Bacteria | 11242 |
| 121 | Ga0466728_324731 | 3300042620 | Bacteria | 2985 |
| 122 | Ga0466713_017744 | 3300042602 | Bacteria | 33043 |
| 123 | Ga0466713_084205 | 3300042602 | Bacteria | 8158 |
| 124 | Ga0466716_259264 | 3300042605 | Unclassified | 4714 |
| 125 | Ga0466719_022176 | 3300042606 | Bacteria | 1454 |
| 126 | Ga0466698_480251 | 3300042610 | Bacteria | 2228 |
| 127 | Ga0466690_014363 | 3300042590 | Bacteria | 61479 |
| 128 | Ga0466690_042487 | 3300042590 | Bacteria | 10239 |
| 129 | Ga0466690_126357 | 3300042590 | Bacteria | 6061 |
| 130 | Ga0466691_008268 | 3300042593 | Bacteria | 2011 |
| 131 | Ga0466729_216623 | 3300042621 | Bacteria | 7827 |
| 132 | Ga0466704_275294 | 3300042643 | Bacteria | 1271 |
| 133 | Ga0466708_012007 | 3300042652 | Bacteria | 3231 |
| 134 | Ga0466708_147988 | 3300042652 | Bacteria | 7656 |
| 135 | Ga0068302_10234604 | 3300005071 | Bacteria | 2884 |
| 136 | Ga0466715_213254 | 3300042616 | Unclassified | 1618 |
| 137 | Ga0466715_290449 | 3300042616 | Bacteria | 7168 |
| 138 | Ga0466718_056233 | 3300042617 | Bacteria | 2320 |
| 139 | Ga0466723_312753 | 3300042618 | Bacteria | 6442 |
| 140 | Ga0466726_287520 | 3300042619 | Bacteria | 4052 |
| 141 | Ga0466729_184366 | 3300042621 | Bacteria | 7001 |
| 142 | Ga0466713_027886 | 3300042602 | Bacteria | 10444 |
| 143 | Ga0466716_100749 | 3300042605 | Bacteria | 16042 |
| 144 | Ga0466719_159603 | 3300042606 | Bacteria | 3661 |
| 145 | Ga0466698_012511 | 3300042610 | Bacteria | 2480 |
| 146 | Ga0466690_414291 | 3300042590 | Bacteria | 10706 |
| 147 | Ga0466691_125480 | 3300042593 | Bacteria | 4967 |
| 148 | Ga0466691_130274 | 3300042593 | Bacteria | 11715 |
| 149 | Ga0466696_124388 | 3300042596 | Bacteria | 36262 |
| 150 | Ga0466696_424707 | 3300042596 | Bacteria | 44406 |
| 151 | Ga0466727_037894 | 3300042655 | Bacteria | 109077 |
| 152 | Ga0466727_141214 | 3300042655 | Bacteria | 3424 |
| 153 | Ga0068302_10112268 | 3300005071 | Unclassified | 1597 |
| 154 | Ga0068305_10183901 | 3300005083 | Unclassified | 3555 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF09375 | Peptidase_M75 | Imelysin | 66 | 392 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.