Protein Family IF08532
Metagenome
Isolate
120
Members
40
Samples
116
Scaffolds
367.36
Avg Length
Representative Sequence
- ID
- 3300042621|Ga0466729_182717|Ga0466729_182717_206_1339
- Length
- 377 aa
- Sequence
- MKSFKNSQIYQLTITQVLETIREPEVLFWGILFPVLISIGLGFAFTQTAESKFHVILVETQHTELDSLLKVYAQPNQIKGKSLLTWKITDKTLGNTEFNFEHSDWKSAIIALKRGEADVIVTDSLGKAAYHFDPHNSQAQLVYMKLSALMQNPTSGDVETPNLGVSTTTANIQPLTLKGVRYIDFLVPGLISMGVMSSIMWGLSYTIIERRSQKLLRRMVATPMKKSNFLIAMMFVRTVMNIVEALILFLAMWLLFGIQIQGNIGALAVLFLAGNIAFTGIAVLVSCRTSKTEVGTGWINAVQMPMMILSGIFFSYHNFPEWSIGIIRLLPLTALTDGIRSIFNEGAGWMEIITPSIALSAFGLLCFVVGAKWFKWY
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
27.5%
Unclassified
15.0%
Termopsidae
10.0%
Rhinotermitidae
7.5%
Blattidae
2.5%
Passalidae
2.5%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 9 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 10 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 26 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 27 | 2695420931 | Dysgonomonas macrotermitis DSM 27370 | Isolate | Unclassified |
| 28 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 29 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 30 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 31 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 32 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 33 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 36 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24699J35502_11134110 | 3300002509 | Bacteria | 31696 |
| 2 | Ga0123357_10247021 | 3300009784 | Unclassified | 1919 |
| 3 | Ga0466693_052554 | 3300042592 | Bacteria | 1327 |
| 4 | Ga0466707_236564 | 3300042601 | Bacteria | 1784 |
| 5 | Ga0466713_011249 | 3300042602 | Bacteria | 73032 |
| 6 | Ga0466713_033492 | 3300042602 | Bacteria | 93098 |
| 7 | Ga0466719_392710 | 3300042606 | Bacteria | 3731 |
| 8 | Ga0466722_184321 | 3300042609 | Bacteria | 3738 |
| 9 | Ga0466711_115683 | 3300042615 | Bacteria | 2650 |
| 10 | Ga0466711_283506 | 3300042615 | Bacteria | 5158 |
| 11 | Ga0466729_221665 | 3300042621 | Bacteria | 2691 |
| 12 | Ga0466735_147538 | 3300042624 | Bacteria | 1167 |
| 13 | Ga0466725_093239 | 3300042654 | Bacteria | 2043 |
| 14 | Ga0466690_243211 | 3300042590 | Bacteria | 30186 |
| 15 | Ga0466696_185735 | 3300042596 | Bacteria | 7006 |
| 16 | Ga0466715_223934 | 3300042616 | Bacteria | 10658 |
| 17 | Ga0466723_038855 | 3300042618 | Bacteria | 1466 |
| 18 | Ga0466728_477928 | 3300042620 | Bacteria | 2156 |
| 19 | Ga0466703_102327 | 3300042636 | Bacteria | 38440 |
| 20 | Ga0123357_10152378 | 3300009784 | Unclassified | 2800 |
| 21 | Ga0466692_190403 | 3300042591 | Bacteria | 7652 |
| 22 | Ga0466692_194959 | 3300042591 | Bacteria | 3727 |
| 23 | Ga0466707_303412 | 3300042601 | Bacteria | 16171 |
| 24 | Ga0466713_010763 | 3300042602 | Bacteria | 24879 |
| 25 | Ga0466713_021849 | 3300042602 | Bacteria | 33152 |
| 26 | Ga0466713_075755 | 3300042602 | Bacteria | 6362 |
| 27 | Ga0466713_134989 | 3300042602 | Bacteria | 147812 |
| 28 | Ga0466719_263126 | 3300042606 | Bacteria | 10431 |
| 29 | Ga0466711_090944 | 3300042615 | Bacteria | 9574 |
| 30 | Ga0466711_256566 | 3300042615 | Bacteria | 4242 |
| 31 | Ga0466715_208973 | 3300042616 | Bacteria | 4735 |
| 32 | Ga0466715_455852 | 3300042616 | Bacteria | 4665 |
| 33 | Ga0466726_132397 | 3300042619 | Bacteria | 2025 |
| 34 | Ga0466726_160426 | 3300042619 | Bacteria | 3664 |
| 35 | Ga0466703_402764 | 3300042636 | Bacteria | 9092 |
| 36 | Ga0466704_494108 | 3300042643 | Bacteria | 2654 |
| 37 | Ga0466709_133004 | 3300042648 | Bacteria | 188114 |
| 38 | 2227521291 | 2225789004 | Bacteria | 3337 |
| 39 | Ga0068302_10065512 | 3300005071 | Unclassified | 4486 |
| 40 | Ga0123357_10289652 | 3300009784 | Bacteria | 1675 |
| 41 | Ga0123356_10072359 | 3300010049 | Bacteria | 3239 |
| 42 | Ga0123356_10103558 | 3300010049 | Bacteria | 2734 |
| 43 | Ga0466707_271826 | 3300042601 | Bacteria | 4095 |
| 44 | Ga0466707_422975 | 3300042601 | Bacteria | 2964 |
| 45 | Ga0466716_200126 | 3300042605 | Bacteria | 7938 |
| 46 | Ga0466726_083270 | 3300042619 | Bacteria | 8732 |
| 47 | Ga0466735_041751 | 3300042624 | Bacteria | 10920 |
| 48 | Ga0466704_560027 | 3300042643 | Bacteria | 32253 |
| 49 | Ga0466727_065742 | 3300042655 | Bacteria | 1918 |
| 50 | Ga0466705_356162 | 3300042612 | Bacteria | 11092 |
| 51 | Ga0068305_10072459 | 3300005083 | Unclassified | 1801 |
| 52 | Ga0068305_10083417 | 3300005083 | Bacteria | 20277 |
| 53 | Ga0123354_10212641 | 3300010882 | Bacteria | 2084 |
| 54 | Ga0466700_040163 | 3300042600 | Bacteria | 3184 |
| 55 | Ga0466707_150366 | 3300042601 | Bacteria | 4868 |
| 56 | Ga0466707_306634 | 3300042601 | Bacteria | 1970 |
| 57 | Ga0466707_388357 | 3300042601 | Bacteria | 2920 |
| 58 | Ga0466713_048680 | 3300042602 | Bacteria | 9581 |
| 59 | Ga0466716_296888 | 3300042605 | Bacteria | 12415 |
| 60 | Ga0466719_378735 | 3300042606 | Bacteria | 28336 |
| 61 | Ga0466722_000434 | 3300042609 | Bacteria | 3185 |
| 62 | Ga0466726_354589 | 3300042619 | Bacteria | 2146 |
| 63 | Ga0466728_378452 | 3300042620 | Bacteria | 2879 |
| 64 | Ga0466729_118038 | 3300042621 | Unclassified | 3894 |
| 65 | Ga0466729_182717 | 3300042621 | Bacteria | 2076 |
| 66 | Ga0466729_273974 | 3300042621 | Bacteria | 6059 |
| 67 | Ga0466703_292262 | 3300042636 | Bacteria | 2033 |
| 68 | Ga0466704_085998 | 3300042643 | Bacteria | 25452 |
| 69 | Ga0466704_558088 | 3300042643 | Unclassified | 7097 |
| 70 | Ga0466724_32435 | 3300042649 | Bacteria | 1779 |
| 71 | Ga0068305_10042016 | 3300005083 | Bacteria | 3573 |
| 72 | Ga0068305_10173742 | 3300005083 | Bacteria | 9267 |
| 73 | Ga0466701_022679 | 3300042598 | Bacteria | 29742 |
| 74 | Ga0466701_074447 | 3300042598 | Bacteria | 2988 |
| 75 | Ga0466716_309564 | 3300042605 | Bacteria | 24840 |
| 76 | Ga0466722_255236 | 3300042609 | Bacteria | 60597 |
| 77 | Ga0466711_374284 | 3300042615 | Bacteria | 8076 |
| 78 | Ga0466723_095121 | 3300042618 | Bacteria | 177949 |
| 79 | Ga0466726_355971 | 3300042619 | Bacteria | 2761 |
| 80 | Ga0466728_472553 | 3300042620 | Bacteria | 1811 |
| 81 | Ga0466735_225831 | 3300042624 | Bacteria | 2432 |
| 82 | Ga0466703_339301 | 3300042636 | Bacteria | 24167 |
| 83 | Ga0466704_121170 | 3300042643 | Bacteria | 11346 |
| 84 | Ga0466725_379192 | 3300042654 | Bacteria | 6549 |
| 85 | Ga0466727_152017 | 3300042655 | Bacteria | 6086 |
| 86 | Ga0466727_238405 | 3300042655 | Bacteria | 4213 |
| 87 | Ga0466697_261516 | 3300042611 | Bacteria | 1952 |
| 88 | Ga0466705_266272 | 3300042612 | Bacteria | 4872 |
| 89 | Ga0123357_10001254 | 3300009784 | Bacteria | 26697 |
| 90 | Ga0123357_10047410 | 3300009784 | Bacteria | 5824 |
| 91 | Ga0123354_10000231 | 3300010882 | Bacteria | 49858 |
| 92 | Ga0123354_10229702 | 3300010882 | Bacteria | 1944 |
| 93 | Ga0466707_285562 | 3300042601 | Bacteria | 8700 |
| 94 | Ga0466716_143423 | 3300042605 | Bacteria | 3742 |
| 95 | Ga0466698_485512 | 3300042610 | Bacteria | 2490 |
| 96 | Ga0466703_432703 | 3300042636 | Bacteria | 3925 |
| 97 | Ga0466708_424277 | 3300042652 | Bacteria | 5494 |
| 98 | Ga0466727_029090 | 3300042655 | Bacteria | 4318 |
| 99 | Ga0466727_077095 | 3300042655 | Bacteria | 8053 |
| 100 | Ga0466727_097138 | 3300042655 | Unclassified | 3025 |
| 101 | Ga0466727_190390 | 3300042655 | Bacteria | 7860 |
| 102 | 2227128020 | 2225789004 | Bacteria | 9048 |
| 103 | Ga0068302_10099050 | 3300005071 | Bacteria | 4739 |
| 104 | Ga0466690_067892 | 3300042590 | Bacteria | 24202 |
| 105 | Ga0466691_016200 | 3300042593 | Bacteria | 5108 |
| 106 | Ga0466700_193127 | 3300042600 | Bacteria | 4826 |
| 107 | Ga0466707_313455 | 3300042601 | Bacteria | 1509 |
| 108 | Ga0466713_024278 | 3300042602 | Bacteria | 4814 |
| 109 | Ga0466715_076703 | 3300042616 | Unclassified | 3439 |
| 110 | Ga0466726_287212 | 3300042619 | Bacteria | 3127 |
| 111 | Ga0466735_031090 | 3300042624 | Bacteria | 2845 |
| 112 | Ga0466703_146730 | 3300042636 | Bacteria | 5079 |
| 113 | Ga0466703_194794 | 3300042636 | Bacteria | 11339 |
| 114 | Ga0466704_360200 | 3300042643 | Bacteria | 9391 |
| 115 | Ga0466708_016107 | 3300042652 | Bacteria | 19240 |
| 116 | Ga0466727_031320 | 3300042655 | Unclassified | 4170 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.