Protein Family IF08477
Metagenome
Isolate
127
Members
29
Samples
126
Scaffolds
392.54
Avg Length
Representative Sequence
- ID
- 3300042620|Ga0466728_480762|Ga0466728_480762_1220_2503
- Length
- 427 aa
- Sequence
- MSIKCFLILYNRRFSLVKRQRGFKYMMDIGPIHRKEYELDADRSEPVVIAEAPGRIHYLGEHGEPKAGLYLSSAIDRYIRVAVSMRKDNSLRFFAADLGERKRTTLVNLKYKREDRWANHIKVAIHIFAELGYPVKGLNFTMAGDIPQQVGLASSSALETAAAVALKGFFKAPVSEKELLNRLAASKTLFFGKNFSPVDYLVILQAKKNQFLLVDEATLEVKRIKSPLSKYKLLIMDSRVPRMGAEEELNQRLEDIKKGLELLSRKKQGASFRDYVTADLVESMGNLSEEIRRRSMHVIQEIRRVNDAEDALKKEDFPSLSKIIYHSHESLRDLYEVSCPEIDWLVKRAQELEGALGSRMTGQGFGGCTYTFIKESAISDYKKKLEDYERIFGFHPVIYEIRLATGARIVPEDQKLVRAKGKAGNSG
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
50.0%
Termitidae
21.4%
Rhinotermitidae
10.7%
Termopsidae
10.7%
Unclassified
7.1%
Taxonomy
Archaea
0
Bacteria
121
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 14 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 15 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 16 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_210489 | 3300042593 | Bacteria | 6638 |
| 2 | Ga0466699_012876 | 3300042597 | Bacteria | 1748 |
| 3 | Ga0466716_052216 | 3300042605 | Bacteria | 6322 |
| 4 | Ga0466719_146973 | 3300042606 | Bacteria | 6526 |
| 5 | Ga0466722_170982 | 3300042609 | Bacteria | 10335 |
| 6 | Ga0466722_234306 | 3300042609 | Bacteria | 2459 |
| 7 | Ga0466711_236060 | 3300042615 | Bacteria | 9441 |
| 8 | Ga0466715_017458 | 3300042616 | Bacteria | 2899 |
| 9 | Ga0466715_071147 | 3300042616 | Bacteria | 1808 |
| 10 | Ga0466728_480762 | 3300042620 | Bacteria | 2868 |
| 11 | Ga0466729_012519 | 3300042621 | Bacteria | 1917 |
| 12 | Ga0466704_123193 | 3300042643 | Bacteria | 9664 |
| 13 | Ga0466709_029034 | 3300042648 | Bacteria | 17943 |
| 14 | Ga0466709_170909 | 3300042648 | Bacteria | 9131 |
| 15 | Ga0466709_400325 | 3300042648 | Bacteria | 4654 |
| 16 | Ga0466708_127770 | 3300042652 | Bacteria | 5044 |
| 17 | Ga0072941_1002755 | 3300005201 | Bacteria | 5549 |
| 18 | Ga0072941_1013540 | 3300005201 | Bacteria | 9254 |
| 19 | Ga0466696_185771 | 3300042596 | Bacteria | 2940 |
| 20 | Ga0466696_236256 | 3300042596 | Bacteria | 9193 |
| 21 | Ga0466716_234589 | 3300042605 | Bacteria | 18743 |
| 22 | Ga0466715_038471 | 3300042616 | Bacteria | 14523 |
| 23 | Ga0466715_120957 | 3300042616 | Bacteria | 3508 |
| 24 | Ga0466715_161310 | 3300042616 | Bacteria | 19000 |
| 25 | Ga0466715_552892 | 3300042616 | Bacteria | 8190 |
| 26 | Ga0466726_155921 | 3300042619 | Bacteria | 16976 |
| 27 | Ga0466728_344395 | 3300042620 | Bacteria | 1689 |
| 28 | Ga0466708_062527 | 3300042652 | Bacteria | 36730 |
| 29 | Ga0466705_218655 | 3300042612 | Bacteria | 5811 |
| 30 | Ga0466732_125342 | 3300042656 | Bacteria | 4223 |
| 31 | Ga0466690_098390 | 3300042590 | Bacteria | 19097 |
| 32 | Ga0466690_123461 | 3300042590 | Bacteria | 11477 |
| 33 | Ga0466694_014929 | 3300042594 | Bacteria | 1974 |
| 34 | Ga0466719_033879 | 3300042606 | Bacteria | 18159 |
| 35 | Ga0466719_116137 | 3300042606 | Bacteria | 7752 |
| 36 | Ga0466722_191746 | 3300042609 | Bacteria | 17517 |
| 37 | Ga0466715_159039 | 3300042616 | Bacteria | 24553 |
| 38 | Ga0466718_077162 | 3300042617 | Bacteria | 1494 |
| 39 | Ga0466703_135800 | 3300042636 | Bacteria | 2698 |
| 40 | Ga0466704_318355 | 3300042643 | Bacteria | 8379 |
| 41 | Ga0466704_566362 | 3300042643 | Bacteria | 3983 |
| 42 | Ga0466708_090544 | 3300042652 | Bacteria | 36740 |
| 43 | Ga0466708_101976 | 3300042652 | Bacteria | 9047 |
| 44 | Ga0466727_290729 | 3300042655 | Bacteria | 2954 |
| 45 | Ga0466705_095695 | 3300042612 | Bacteria | 9175 |
| 46 | Ga0466691_088497 | 3300042593 | Unclassified | 2921 |
| 47 | Ga0466691_176051 | 3300042593 | Bacteria | 11368 |
| 48 | Ga0466691_180552 | 3300042593 | Bacteria | 23586 |
| 49 | Ga0466696_328391 | 3300042596 | Bacteria | 16310 |
| 50 | Ga0466716_054694 | 3300042605 | Bacteria | 6604 |
| 51 | Ga0466719_088550 | 3300042606 | Bacteria | 22253 |
| 52 | Ga0466719_457871 | 3300042606 | Bacteria | 1828 |
| 53 | Ga0466711_044510 | 3300042615 | Bacteria | 12780 |
| 54 | Ga0466711_135544 | 3300042615 | Bacteria | 26216 |
| 55 | Ga0466715_030833 | 3300042616 | Bacteria | 7984 |
| 56 | Ga0466723_317332 | 3300042618 | Bacteria | 7111 |
| 57 | Ga0466728_022815 | 3300042620 | Bacteria | 13977 |
| 58 | Ga0466728_068052 | 3300042620 | Bacteria | 10664 |
| 59 | Ga0466728_231062 | 3300042620 | Bacteria | 10677 |
| 60 | Ga0466703_038424 | 3300042636 | Bacteria | 14630 |
| 61 | Ga0466703_060769 | 3300042636 | Bacteria | 7073 |
| 62 | Ga0466694_123542 | 3300042594 | Bacteria | 2948 |
| 63 | Ga0466719_292138 | 3300042606 | Bacteria | 2885 |
| 64 | Ga0466719_297647 | 3300042606 | Bacteria | 41658 |
| 65 | Ga0466722_059803 | 3300042609 | Bacteria | 24916 |
| 66 | Ga0466705_432179 | 3300042612 | Unclassified | 11376 |
| 67 | Ga0466705_489561 | 3300042612 | Bacteria | 2179 |
| 68 | Ga0466712_005457 | 3300042614 | Bacteria | 4188 |
| 69 | Ga0466711_409816 | 3300042615 | Bacteria | 4055 |
| 70 | Ga0466715_071701 | 3300042616 | Bacteria | 16717 |
| 71 | Ga0466715_557463 | 3300042616 | Bacteria | 12317 |
| 72 | Ga0466723_043646 | 3300042618 | Bacteria | 2111 |
| 73 | Ga0466726_043758 | 3300042619 | Bacteria | 3902 |
| 74 | Ga0466703_190431 | 3300042636 | Bacteria | 5571 |
| 75 | Ga0466708_081131 | 3300042652 | Bacteria | 20083 |
| 76 | Ga0466708_460396 | 3300042652 | Bacteria | 3704 |
| 77 | Ga0466705_207521 | 3300042612 | Bacteria | 3465 |
| 78 | Ga0466690_284777 | 3300042590 | Bacteria | 2972 |
| 79 | Ga0466691_055171 | 3300042593 | Bacteria | 14611 |
| 80 | Ga0466696_287416 | 3300042596 | Bacteria | 3271 |
| 81 | Ga0466707_335159 | 3300042601 | Bacteria | 2388 |
| 82 | Ga0466719_089881 | 3300042606 | Bacteria | 12285 |
| 83 | Ga0466711_427949 | 3300042615 | Bacteria | 2867 |
| 84 | Ga0466715_429031 | 3300042616 | Bacteria | 2592 |
| 85 | Ga0466715_526925 | 3300042616 | Bacteria | 3109 |
| 86 | Ga0466718_107985 | 3300042617 | Bacteria | 9726 |
| 87 | Ga0466723_345702 | 3300042618 | Bacteria | 6529 |
| 88 | Ga0466726_189176 | 3300042619 | Bacteria | 6098 |
| 89 | Ga0466728_036121 | 3300042620 | Bacteria | 12465 |
| 90 | Ga0466704_035569 | 3300042643 | Bacteria | 21995 |
| 91 | Ga0466704_220620 | 3300042643 | Bacteria | 18406 |
| 92 | Ga0466709_082284 | 3300042648 | Bacteria | 24819 |
| 93 | Ga0466708_351296 | 3300042652 | Bacteria | 2743 |
| 94 | Ga0466727_080128 | 3300042655 | Bacteria | 3084 |
| 95 | Ga0466727_281079 | 3300042655 | Bacteria | 2994 |
| 96 | Ga0466705_162890 | 3300042612 | Bacteria | 2964 |
| 97 | Ga0466705_385985 | 3300042612 | Bacteria | 13657 |
| 98 | Ga0072940_1020326 | 3300005200 | Bacteria | 2113 |
| 99 | Ga0466692_097561 | 3300042591 | Bacteria | 53967 |
| 100 | Ga0466696_396944 | 3300042596 | Bacteria | 3234 |
| 101 | Ga0466719_369214 | 3300042606 | Unclassified | 3217 |
| 102 | Ga0466728_390489 | 3300042620 | Unclassified | 5009 |
| 103 | Ga0466703_382867 | 3300042636 | Bacteria | 1650 |
| 104 | Ga0466704_343782 | 3300042643 | Bacteria | 17755 |
| 105 | Ga0466709_172900 | 3300042648 | Bacteria | 6290 |
| 106 | Ga0466709_188703 | 3300042648 | Bacteria | 9107 |
| 107 | Ga0466727_176950 | 3300042655 | Bacteria | 21135 |
| 108 | Ga0072941_1003788 | 3300005201 | Bacteria | 18720 |
| 109 | Ga0466691_080916 | 3300042593 | Bacteria | 2203 |
| 110 | Ga0466716_176770 | 3300042605 | Bacteria | 23050 |
| 111 | Ga0466719_005301 | 3300042606 | Bacteria | 2435 |
| 112 | Ga0466719_132596 | 3300042606 | Unclassified | 13183 |
| 113 | Ga0466719_547707 | 3300042606 | Bacteria | 2405 |
| 114 | Ga0466715_119279 | 3300042616 | Bacteria | 6013 |
| 115 | Ga0466715_196890 | 3300042616 | Bacteria | 23985 |
| 116 | Ga0466723_147070 | 3300042618 | Bacteria | 16221 |
| 117 | Ga0466726_138450 | 3300042619 | Bacteria | 2536 |
| 118 | Ga0466726_240290 | 3300042619 | Bacteria | 1997 |
| 119 | Ga0466728_156223 | 3300042620 | Bacteria | 2161 |
| 120 | Ga0466735_049275 | 3300042624 | Bacteria | 1408 |
| 121 | Ga0466704_134527 | 3300042643 | Unclassified | 4233 |
| 122 | Ga0466709_185307 | 3300042648 | Bacteria | 1436 |
| 123 | Ga0466708_027385 | 3300042652 | Bacteria | 4814 |
| 124 | Ga0466708_113182 | 3300042652 | Bacteria | 1563 |
| 125 | Ga0466708_140935 | 3300042652 | Bacteria | 12492 |
| 126 | Ga0466708_459830 | 3300042652 | Bacteria | 3332 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00288 | GO:0005524 | ATP binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.