Protein Family IF08294
Metagenome
Isolate
144
Members
24
Samples
142
Scaffolds
246.23
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_293762|Ga0466726_293762_60_938
- Length
- 292 aa
- Sequence
- MEFSKMSYLQVQNISYSYEGKFPALSNISFDVEKGSCLCLAGANGSGKSTLLQIIAACIKPDAGDVCICNDAPPSPKKVSVLRDESARRKIGIVFQEPDNQLFMPTVWEDVAFAIMNKGCAMSEAKAKALNALRAVEAEHLAERPPYKLSGGEKQRAALASVLITFQNNDEHGILLIDEPTAYLDPRARKNFIQLLKKLSCTKIIATHDLDMALTISDEILFLNNGTLAARSPAPGLLSDEVFLQSIGLELPLSSPAPRRFEKLLGLPLCGSCSAIPISDHEPXXXXERIQK
Sample Types
Isolate
1.4%
Metagenome
98.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
58.3%
Termopsidae
16.7%
Termitidae
8.3%
Rhinotermitidae
8.3%
Unclassified
8.3%
Taxonomy
Archaea
1
Bacteria
141
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 4 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 5 | 2820157249 | Unclassified Proteobacteria Cu122P4bin11 | Isolate | Unclassified |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 2820077244 | Unclassified Proteobacteria Lab288P4bin72 | Isolate | Unclassified |
| 13 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 16 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 17 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 18 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466711_062448 | 3300042615 | Bacteria | 1573 |
| 2 | Ga0466726_096217 | 3300042619 | Bacteria | 1343 |
| 3 | Ga0466726_214489 | 3300042619 | Bacteria | 1339 |
| 4 | Ga0466726_357033 | 3300042619 | Bacteria | 2406 |
| 5 | Ga0466728_127047 | 3300042620 | Bacteria | 13170 |
| 6 | Ga0466690_431520 | 3300042590 | Bacteria | 3774 |
| 7 | Ga0466692_001200 | 3300042591 | Bacteria | 7053 |
| 8 | Ga0466691_078847 | 3300042593 | Bacteria | 17731 |
| 9 | Ga0466691_103225 | 3300042593 | Bacteria | 4349 |
| 10 | Ga0466696_144320 | 3300042596 | Bacteria | 4810 |
| 11 | Ga0466719_362748 | 3300042606 | Bacteria | 1665 |
| 12 | Ga0466722_015528 | 3300042609 | Bacteria | 3893 |
| 13 | Ga0466735_149493 | 3300042624 | Bacteria | 5442 |
| 14 | Ga0466703_225399 | 3300042636 | Bacteria | 10397 |
| 15 | Ga0466703_325062 | 3300042636 | Bacteria | 20758 |
| 16 | Ga0466708_031565 | 3300042652 | Bacteria | 13526 |
| 17 | Ga0466708_034596 | 3300042652 | Bacteria | 7086 |
| 18 | Ga0466708_057152 | 3300042652 | Bacteria | 2085 |
| 19 | Ga0466708_117695 | 3300042652 | Bacteria | 2110 |
| 20 | Ga0466708_183384 | 3300042652 | Bacteria | 4467 |
| 21 | Ga0466715_032548 | 3300042616 | Bacteria | 5942 |
| 22 | Ga0466723_082831 | 3300042618 | Bacteria | 9177 |
| 23 | Ga0466723_336116 | 3300042618 | Bacteria | 4957 |
| 24 | Ga0466726_147780 | 3300042619 | Bacteria | 1438 |
| 25 | Ga0466728_247366 | 3300042620 | Bacteria | 2204 |
| 26 | Ga0466728_290413 | 3300042620 | Bacteria | 2125 |
| 27 | Ga0466690_022768 | 3300042590 | Bacteria | 6536 |
| 28 | Ga0466690_031719 | 3300042590 | Unclassified | 3045 |
| 29 | Ga0466691_041381 | 3300042593 | Bacteria | 5368 |
| 30 | Ga0466696_115924 | 3300042596 | Bacteria | 4218 |
| 31 | Ga0466705_041779 | 3300042612 | Bacteria | 3418 |
| 32 | Ga0466705_099189 | 3300042612 | Bacteria | 1675 |
| 33 | Ga0466719_014975 | 3300042606 | Bacteria | 21358 |
| 34 | Ga0466735_174953 | 3300042624 | Bacteria | 2070 |
| 35 | Ga0466704_473339 | 3300042643 | Bacteria | 2397 |
| 36 | Ga0466708_103562 | 3300042652 | Bacteria | 4275 |
| 37 | Ga0466727_312821 | 3300042655 | Bacteria | 1646 |
| 38 | Ga0466715_151766 | 3300042616 | Unclassified | 7911 |
| 39 | Ga0466723_145570 | 3300042618 | Bacteria | 8323 |
| 40 | Ga0466690_008072 | 3300042590 | Bacteria | 1386 |
| 41 | Ga0466692_172087 | 3300042591 | Bacteria | 21719 |
| 42 | Ga0466691_009954 | 3300042593 | Bacteria | 5493 |
| 43 | Ga0466691_161823 | 3300042593 | Archaea | 2111 |
| 44 | Ga0466691_186160 | 3300042593 | Bacteria | 2001 |
| 45 | Ga0466705_044490 | 3300042612 | Bacteria | 4224 |
| 46 | Ga0466722_007342 | 3300042609 | Bacteria | 3738 |
| 47 | Ga0466735_085728 | 3300042624 | Bacteria | 5787 |
| 48 | Ga0466703_111148 | 3300042636 | Bacteria | 2320 |
| 49 | Ga0466704_151653 | 3300042643 | Bacteria | 6262 |
| 50 | Ga0466709_365978 | 3300042648 | Bacteria | 5374 |
| 51 | Ga0466709_375803 | 3300042648 | Bacteria | 1328 |
| 52 | Ga0466708_019692 | 3300042652 | Bacteria | 15266 |
| 53 | Ga0466708_088320 | 3300042652 | Bacteria | 11160 |
| 54 | Ga0466708_227399 | 3300042652 | Bacteria | 5223 |
| 55 | Ga0466708_291183 | 3300042652 | Bacteria | 1450 |
| 56 | Ga0466727_298423 | 3300042655 | Bacteria | 1143 |
| 57 | Ga0466711_120901 | 3300042615 | Bacteria | 24588 |
| 58 | Ga0466711_451007 | 3300042615 | Bacteria | 1649 |
| 59 | Ga0466726_336529 | 3300042619 | Bacteria | 2500 |
| 60 | Ga0466728_084942 | 3300042620 | Bacteria | 2355 |
| 61 | Ga0123354_10000052 | 3300010882 | Bacteria | 88097 |
| 62 | Ga0466690_222699 | 3300042590 | Bacteria | 7398 |
| 63 | Ga0466691_110577 | 3300042593 | Bacteria | 15696 |
| 64 | Ga0466691_120522 | 3300042593 | Bacteria | 5757 |
| 65 | Ga0466705_156017 | 3300042612 | Bacteria | 4783 |
| 66 | Ga0466722_032174 | 3300042609 | Bacteria | 3280 |
| 67 | Ga0466703_110858 | 3300042636 | Bacteria | 2238 |
| 68 | Ga0466703_392632 | 3300042636 | Bacteria | 3960 |
| 69 | Ga0466704_436204 | 3300042643 | Bacteria | 3808 |
| 70 | Ga0466704_506123 | 3300042643 | Bacteria | 10442 |
| 71 | Ga0466708_173475 | 3300042652 | Bacteria | 44078 |
| 72 | Ga0466708_199680 | 3300042652 | Bacteria | 2971 |
| 73 | Ga0466727_121921 | 3300042655 | Bacteria | 2122 |
| 74 | Ga0466727_207174 | 3300042655 | Bacteria | 2616 |
| 75 | Ga0466727_278795 | 3300042655 | Bacteria | 2191 |
| 76 | Ga0466727_283730 | 3300042655 | Bacteria | 2985 |
| 77 | Ga0466715_025931 | 3300042616 | Bacteria | 4761 |
| 78 | Ga0466715_505086 | 3300042616 | Bacteria | 2194 |
| 79 | Ga0466726_146811 | 3300042619 | Bacteria | 4734 |
| 80 | Ga0466726_154675 | 3300042619 | Bacteria | 2027 |
| 81 | Ga0466726_378806 | 3300042619 | Bacteria | 1137 |
| 82 | Ga0466728_267446 | 3300042620 | Bacteria | 1204 |
| 83 | Ga0466696_074224 | 3300042596 | Bacteria | 5291 |
| 84 | Ga0466696_100232 | 3300042596 | Bacteria | 9652 |
| 85 | Ga0466716_261615 | 3300042605 | Bacteria | 3758 |
| 86 | Ga0466716_521941 | 3300042605 | Bacteria | 4376 |
| 87 | Ga0466722_115519 | 3300042609 | Bacteria | 3297 |
| 88 | Ga0466704_022871 | 3300042643 | Bacteria | 6900 |
| 89 | Ga0466704_036882 | 3300042643 | Bacteria | 35525 |
| 90 | Ga0466704_185523 | 3300042643 | Bacteria | 8369 |
| 91 | Ga0466709_068814 | 3300042648 | Bacteria | 12085 |
| 92 | Ga0466708_137656 | 3300042652 | Bacteria | 4703 |
| 93 | Ga0466727_264993 | 3300042655 | Bacteria | 3524 |
| 94 | Ga0466715_027089 | 3300042616 | Bacteria | 3918 |
| 95 | Ga0466715_153016 | 3300042616 | Bacteria | 5172 |
| 96 | Ga0466715_519722 | 3300042616 | Bacteria | 1999 |
| 97 | Ga0466723_185033 | 3300042618 | Bacteria | 8447 |
| 98 | Ga0466728_074121 | 3300042620 | Bacteria | 3739 |
| 99 | Ga0466690_383915 | 3300042590 | Bacteria | 1327 |
| 100 | Ga0466692_005082 | 3300042591 | Bacteria | 4025 |
| 101 | Ga0466691_018371 | 3300042593 | Bacteria | 9742 |
| 102 | Ga0466691_090263 | 3300042593 | Bacteria | 10919 |
| 103 | Ga0466691_147572 | 3300042593 | Bacteria | 4784 |
| 104 | Ga0466691_170498 | 3300042593 | Bacteria | 4237 |
| 105 | Ga0466717_048985 | 3300042604 | Bacteria | 20927 |
| 106 | Ga0466716_287592 | 3300042605 | Bacteria | 4081 |
| 107 | Ga0466722_005338 | 3300042609 | Bacteria | 57258 |
| 108 | Ga0466722_135363 | 3300042609 | Bacteria | 7070 |
| 109 | Ga0466704_135383 | 3300042643 | Bacteria | 1124 |
| 110 | Ga0466704_149032 | 3300042643 | Bacteria | 4661 |
| 111 | Ga0466704_166163 | 3300042643 | Bacteria | 2281 |
| 112 | Ga0466709_087227 | 3300042648 | Bacteria | 37592 |
| 113 | Ga0466709_171466 | 3300042648 | Bacteria | 3752 |
| 114 | Ga0466711_178292 | 3300042615 | Bacteria | 1841 |
| 115 | Ga0466711_306012 | 3300042615 | Bacteria | 3160 |
| 116 | Ga0466715_215723 | 3300042616 | Bacteria | 10154 |
| 117 | Ga0466723_017241 | 3300042618 | Bacteria | 4402 |
| 118 | Ga0466723_328422 | 3300042618 | Bacteria | 4251 |
| 119 | Ga0466726_102837 | 3300042619 | Bacteria | 1170 |
| 120 | Ga0466726_293762 | 3300042619 | Bacteria | 6805 |
| 121 | Ga0466692_116127 | 3300042591 | Bacteria | 20676 |
| 122 | Ga0466691_083739 | 3300042593 | Bacteria | 2283 |
| 123 | Ga0466705_213304 | 3300042612 | Bacteria | 3779 |
| 124 | Ga0466705_227634 | 3300042612 | Bacteria | 8431 |
| 125 | Ga0466716_075396 | 3300042605 | Bacteria | 8981 |
| 126 | Ga0466709_298740 | 3300042648 | Bacteria | 3346 |
| 127 | Ga0466709_308706 | 3300042648 | Bacteria | 9036 |
| 128 | Ga0466727_284930 | 3300042655 | Bacteria | 4101 |
| 129 | Ga0068302_10140770 | 3300005071 | Bacteria | 851 |
| 130 | Ga0466711_345275 | 3300042615 | Bacteria | 3576 |
| 131 | Ga0466723_019726 | 3300042618 | Bacteria | 3777 |
| 132 | Ga0466728_274313 | 3300042620 | Bacteria | 4440 |
| 133 | Ga0466690_334677 | 3300042590 | Bacteria | 1833 |
| 134 | Ga0466705_222538 | 3300042612 | Bacteria | 10577 |
| 135 | Ga0466727_352193 | 3300042655 | Bacteria | 2665 |
| 136 | Ga0466722_045617 | 3300042609 | Bacteria | 3533 |
| 137 | Ga0466722_217324 | 3300042609 | Bacteria | 2776 |
| 138 | Ga0466722_264626 | 3300042609 | Bacteria | 4222 |
| 139 | Ga0466735_086999 | 3300042624 | Bacteria | 10592 |
| 140 | Ga0466703_189431 | 3300042636 | Bacteria | 12406 |
| 141 | Ga0466703_310555 | 3300042636 | Bacteria | 1942 |
| 142 | Ga0466704_166055 | 3300042643 | Bacteria | 5443 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.