Protein Family IF08201
Metagenome
157
Members
27
Samples
157
Scaffolds
265.73
Avg Length
Representative Sequence
- ID
- 3300042619|Ga0466726_055570|Ga0466726_055570_3996_4844
- Length
- 282 aa
- Sequence
- VWFAWFVVYFFISRKNMKGLTGKAAIVTGGSRGIGKAVVERLLEEGVKVLFCGRTEKTGEETLALFKKKYADAVTFVKADMEDRNAPEILISKGRSLFGELDFLVNNAFPFTAKALDASYDDWMHTFMAGPAAYARMIAEFAKGRTKKKGAVVCVSSISGHIAQPKRWTYNAAKGAVKQIIRNAALDLAPEIRVNCISPGWVKTDEVLKATPKHTWESAPQAWAEYHMLQALQEPADIAAAIAFLLSDDAALITGHDLDASSGYLAMGPEGLGKTANYAGSD
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
51.9%
Termopsidae
14.8%
Rhinotermitidae
11.1%
Termitidae
11.1%
Unclassified
11.1%
Taxonomy
Archaea
2
Bacteria
122
Eukaryota
1
Viruses
0
Unclassified
32
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 13 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_007766 | 3300042602 | Bacteria | 67445 |
| 2 | Ga0466713_030820 | 3300042602 | Bacteria | 5632 |
| 3 | Ga0466716_418814 | 3300042605 | Unclassified | 3173 |
| 4 | Ga0466722_012420 | 3300042609 | Bacteria | 20847 |
| 5 | Ga0466705_120120 | 3300042612 | Unclassified | 1037 |
| 6 | Ga0466703_125241 | 3300042636 | Bacteria | 2419 |
| 7 | Ga0466703_371429 | 3300042636 | Bacteria | 2822 |
| 8 | Ga0466704_320652 | 3300042643 | Bacteria | 12398 |
| 9 | Ga0466709_068654 | 3300042648 | Bacteria | 41681 |
| 10 | Ga0466705_422505 | 3300042612 | Unclassified | 1462 |
| 11 | Ga0466711_007967 | 3300042615 | Bacteria | 23939 |
| 12 | Ga0466711_297581 | 3300042615 | Bacteria | 5369 |
| 13 | Ga0466696_091679 | 3300042596 | Bacteria | 5134 |
| 14 | JGI24702J35022_10005820 | 3300002462 | Bacteria | 7173 |
| 15 | Ga0466707_183064 | 3300042601 | Bacteria | 7671 |
| 16 | Ga0466719_122127 | 3300042606 | Unclassified | 2039 |
| 17 | Ga0466719_338579 | 3300042606 | Bacteria | 9531 |
| 18 | Ga0466722_003949 | 3300042609 | Bacteria | 18396 |
| 19 | Ga0466722_113308 | 3300042609 | Bacteria | 11594 |
| 20 | Ga0466705_013155 | 3300042612 | Unclassified | 3836 |
| 21 | Ga0466705_108221 | 3300042612 | Unclassified | 10035 |
| 22 | Ga0466705_379374 | 3300042612 | Bacteria | 4030 |
| 23 | Ga0466703_183395 | 3300042636 | Bacteria | 7614 |
| 24 | Ga0466703_409083 | 3300042636 | Bacteria | 4493 |
| 25 | Ga0466704_438256 | 3300042643 | Unclassified | 6386 |
| 26 | Ga0466709_189509 | 3300042648 | Bacteria | 4898 |
| 27 | Ga0466708_031275 | 3300042652 | Unclassified | 9142 |
| 28 | Ga0466727_071919 | 3300042655 | Bacteria | 3879 |
| 29 | Ga0466727_143399 | 3300042655 | Unclassified | 2048 |
| 30 | Ga0466727_297497 | 3300042655 | Unclassified | 1580 |
| 31 | Ga0466727_307411 | 3300042655 | Bacteria | 80907 |
| 32 | Ga0466705_469032 | 3300042612 | Bacteria | 5721 |
| 33 | Ga0466715_110158 | 3300042616 | Bacteria | 1485 |
| 34 | Ga0466726_468936 | 3300042619 | Archaea | 1877 |
| 35 | Ga0466728_267424 | 3300042620 | Bacteria | 1299 |
| 36 | Ga0466690_199920 | 3300042590 | Bacteria | 33657 |
| 37 | Ga0466690_278301 | 3300042590 | Unclassified | 3052 |
| 38 | Ga0466691_150508 | 3300042593 | Bacteria | 10434 |
| 39 | Ga0466696_185820 | 3300042596 | Bacteria | 2865 |
| 40 | Ga0466696_327792 | 3300042596 | Bacteria | 8976 |
| 41 | Ga0466707_046222 | 3300042601 | Bacteria | 1616 |
| 42 | Ga0466707_083965 | 3300042601 | Bacteria | 3503 |
| 43 | Ga0466707_126065 | 3300042601 | Bacteria | 1951 |
| 44 | Ga0466713_118713 | 3300042602 | Unclassified | 3755 |
| 45 | Ga0466722_048331 | 3300042609 | Bacteria | 7454 |
| 46 | Ga0466722_105500 | 3300042609 | Bacteria | 2622 |
| 47 | Ga0466703_310057 | 3300042636 | Bacteria | 5514 |
| 48 | Ga0466704_280963 | 3300042643 | Bacteria | 68260 |
| 49 | Ga0466708_203575 | 3300042652 | Bacteria | 2747 |
| 50 | Ga0466711_310148 | 3300042615 | Bacteria | 9276 |
| 51 | Ga0466715_091879 | 3300042616 | Bacteria | 83726 |
| 52 | Ga0466715_481725 | 3300042616 | Bacteria | 6384 |
| 53 | Ga0466723_353459 | 3300042618 | Unclassified | 5737 |
| 54 | Ga0466726_017392 | 3300042619 | Bacteria | 3854 |
| 55 | Ga0466726_308403 | 3300042619 | Bacteria | 1311 |
| 56 | Ga0466728_162531 | 3300042620 | Bacteria | 7731 |
| 57 | Ga0466691_141839 | 3300042593 | Bacteria | 6485 |
| 58 | Ga0466696_013454 | 3300042596 | Bacteria | 3246 |
| 59 | Ga0466707_142172 | 3300042601 | Bacteria | 9812 |
| 60 | Ga0466707_392924 | 3300042601 | Bacteria | 1870 |
| 61 | Ga0466713_006243 | 3300042602 | Bacteria | 73153 |
| 62 | Ga0466713_013227 | 3300042602 | Bacteria | 38001 |
| 63 | Ga0466719_029128 | 3300042606 | Bacteria | 6514 |
| 64 | Ga0466722_123031 | 3300042609 | Bacteria | 32122 |
| 65 | Ga0466705_349708 | 3300042612 | Bacteria | 12181 |
| 66 | Ga0466703_086390 | 3300042636 | Bacteria | 2338 |
| 67 | Ga0466704_160990 | 3300042643 | Bacteria | 7021 |
| 68 | Ga0466704_373640 | 3300042643 | Bacteria | 36240 |
| 69 | Ga0466727_005529 | 3300042655 | Bacteria | 3537 |
| 70 | Ga0466727_246309 | 3300042655 | Bacteria | 5013 |
| 71 | Ga0466711_101207 | 3300042615 | Bacteria | 8662 |
| 72 | Ga0466715_156690 | 3300042616 | Unclassified | 9481 |
| 73 | Ga0466715_545886 | 3300042616 | Unclassified | 1064 |
| 74 | Ga0466723_048721 | 3300042618 | Bacteria | 7703 |
| 75 | Ga0466726_055570 | 3300042619 | Bacteria | 16834 |
| 76 | Ga0466726_268471 | 3300042619 | Bacteria | 3023 |
| 77 | Ga0466692_164500 | 3300042591 | Bacteria | 2732 |
| 78 | Ga0068302_10211571 | 3300005071 | Bacteria | 1394 |
| 79 | Ga0068302_10325442 | 3300005071 | Bacteria | 3041 |
| 80 | Ga0466722_010107 | 3300042609 | Bacteria | 10080 |
| 81 | Ga0466698_357155 | 3300042610 | Bacteria | 1558 |
| 82 | Ga0466705_191397 | 3300042612 | Bacteria | 1595 |
| 83 | Ga0466703_060919 | 3300042636 | Bacteria | 17743 |
| 84 | Ga0466704_281171 | 3300042643 | Unclassified | 8116 |
| 85 | Ga0466708_065072 | 3300042652 | Bacteria | 16015 |
| 86 | Ga0466715_063090 | 3300042616 | Bacteria | 8778 |
| 87 | Ga0466723_026140 | 3300042618 | Bacteria | 2263 |
| 88 | Ga0466726_095971 | 3300042619 | Bacteria | 1293 |
| 89 | Ga0466691_002018 | 3300042593 | Bacteria | 4613 |
| 90 | Ga0466691_177563 | 3300042593 | Bacteria | 51941 |
| 91 | Ga0466707_230109 | 3300042601 | Unclassified | 1189 |
| 92 | Ga0466716_495979 | 3300042605 | Bacteria | 4026 |
| 93 | Ga0466722_173178 | 3300042609 | Bacteria | 13686 |
| 94 | Ga0466735_158549 | 3300042624 | Eukaryota | 1373 |
| 95 | Ga0466703_048882 | 3300042636 | Bacteria | 42148 |
| 96 | Ga0466704_120602 | 3300042643 | Unclassified | 2399 |
| 97 | Ga0466709_155776 | 3300042648 | Bacteria | 1544 |
| 98 | Ga0466709_370073 | 3300042648 | Bacteria | 1398 |
| 99 | Ga0466708_033230 | 3300042652 | Bacteria | 2114 |
| 100 | Ga0466727_172448 | 3300042655 | Bacteria | 11126 |
| 101 | Ga0466711_083989 | 3300042615 | Archaea | 1385 |
| 102 | Ga0466711_170649 | 3300042615 | Bacteria | 11471 |
| 103 | Ga0466711_422797 | 3300042615 | Bacteria | 2630 |
| 104 | Ga0466715_022139 | 3300042616 | Bacteria | 16991 |
| 105 | Ga0466715_156430 | 3300042616 | Bacteria | 2251 |
| 106 | Ga0466715_509485 | 3300042616 | Bacteria | 12944 |
| 107 | Ga0466723_049328 | 3300042618 | Unclassified | 7440 |
| 108 | Ga0466723_151180 | 3300042618 | Bacteria | 44562 |
| 109 | Ga0466723_210529 | 3300042618 | Bacteria | 2154 |
| 110 | Ga0466728_390335 | 3300042620 | Bacteria | 2222 |
| 111 | Ga0466690_118711 | 3300042590 | Bacteria | 1901 |
| 112 | Ga0123353_10239717 | 3300010167 | Bacteria | 2819 |
| 113 | Ga0068305_10303126 | 3300005083 | Bacteria | 6611 |
| 114 | Ga0466716_080864 | 3300042605 | Unclassified | 6183 |
| 115 | Ga0466716_317483 | 3300042605 | Bacteria | 12875 |
| 116 | Ga0466722_025554 | 3300042609 | Bacteria | 5823 |
| 117 | Ga0466705_178756 | 3300042612 | Bacteria | 34494 |
| 118 | Ga0466703_118587 | 3300042636 | Bacteria | 9325 |
| 119 | Ga0466703_242070 | 3300042636 | Unclassified | 4667 |
| 120 | Ga0466704_111833 | 3300042643 | Bacteria | 1569 |
| 121 | Ga0466704_524304 | 3300042643 | Unclassified | 5790 |
| 122 | Ga0466709_352575 | 3300042648 | Unclassified | 2262 |
| 123 | Ga0466727_271258 | 3300042655 | Bacteria | 1703 |
| 124 | Ga0466705_462180 | 3300042612 | Bacteria | 1492 |
| 125 | Ga0466711_139186 | 3300042615 | Bacteria | 22031 |
| 126 | Ga0466715_053438 | 3300042616 | Unclassified | 15686 |
| 127 | Ga0466715_466787 | 3300042616 | Bacteria | 13785 |
| 128 | Ga0466715_524563 | 3300042616 | Unclassified | 1767 |
| 129 | Ga0466723_072821 | 3300042618 | Bacteria | 15618 |
| 130 | Ga0466723_225794 | 3300042618 | Bacteria | 1751 |
| 131 | Ga0466726_115418 | 3300042619 | Bacteria | 15505 |
| 132 | Ga0466728_016042 | 3300042620 | Bacteria | 1448 |
| 133 | Ga0466728_027304 | 3300042620 | Bacteria | 5526 |
| 134 | Ga0466728_484545 | 3300042620 | Bacteria | 1636 |
| 135 | Ga0466690_093203 | 3300042590 | Bacteria | 3371 |
| 136 | Ga0466691_001639 | 3300042593 | Unclassified | 1913 |
| 137 | Ga0466696_059664 | 3300042596 | Bacteria | 7481 |
| 138 | Ga0466696_485741 | 3300042596 | Unclassified | 1303 |
| 139 | Ga0466707_215741 | 3300042601 | Bacteria | 1934 |
| 140 | Ga0466713_070893 | 3300042602 | Unclassified | 9625 |
| 141 | Ga0466713_129873 | 3300042602 | Bacteria | 2450 |
| 142 | Ga0466719_226725 | 3300042606 | Bacteria | 3903 |
| 143 | Ga0466705_283307 | 3300042612 | Bacteria | 2619 |
| 144 | Ga0466703_206243 | 3300042636 | Bacteria | 2562 |
| 145 | Ga0466704_276252 | 3300042643 | Bacteria | 15592 |
| 146 | Ga0466708_331071 | 3300042652 | Bacteria | 2034 |
| 147 | Ga0466727_169716 | 3300042655 | Bacteria | 2877 |
| 148 | Ga0466727_182458 | 3300042655 | Bacteria | 15360 |
| 149 | Ga0466723_043479 | 3300042618 | Unclassified | 3178 |
| 150 | Ga0466723_189207 | 3300042618 | Bacteria | 12898 |
| 151 | Ga0466726_192442 | 3300042619 | Unclassified | 1073 |
| 152 | Ga0466729_016314 | 3300042621 | Bacteria | 1189 |
| 153 | Ga0466690_224201 | 3300042590 | Unclassified | 6568 |
| 154 | Ga0466690_267041 | 3300042590 | Unclassified | 5329 |
| 155 | Ga0466691_157725 | 3300042593 | Bacteria | 4940 |
| 156 | Ga0466691_200167 | 3300042593 | Bacteria | 8881 |
| 157 | Ga0123353_10386332 | 3300010167 | Bacteria | 2091 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.