Protein Family IF08126
Metagenome
Isolate
118
Members
40
Samples
113
Scaffolds
111.19
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_238494|Ga0466723_238494_6681_7061
- Length
- 126 aa
- Sequence
- MQGNEGKERMKKEKVNFFDLIPLISESISTEKEGELSVIAFPRFRSRFMQKYFIPKNKSTIIRIRLEEHGTAVWDLIDGKRTIKEIAETLAEHFHHEENYEYRIITYLSQLQKQGFVKYIKAPVTG
Sample Types
Isolate
4.2%
Metagenome
95.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.0%
Kalotermitidae
32.5%
Unclassified
12.5%
Rhinotermitidae
7.5%
Termopsidae
7.5%
Taxonomy
Archaea
1
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820774381 | Unclassified Bacteroidetes Lab288P1bin37 | Isolate | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2820767225 | Unclassified Bacteroidetes Lab288P3bin34 | Isolate | Unclassified |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 19 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 22 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 28 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 38 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 39 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 40 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466734_072799 | 3300042623 | Bacteria | 2660 |
| 2 | Ga0466734_149454 | 3300042623 | Bacteria | 1020 |
| 3 | Ga0466710_218694 | 3300042613 | Bacteria | 1033 |
| 4 | Ga0466711_069683 | 3300042615 | Bacteria | 2938 |
| 5 | Ga0466715_362458 | 3300042616 | Bacteria | 13258 |
| 6 | Ga0466693_251476 | 3300042592 | Bacteria | 1013 |
| 7 | Ga0123357_10137427 | 3300009784 | Bacteria | 3017 |
| 8 | Ga0123354_10522822 | 3300010882 | Bacteria | 911 |
| 9 | Ga0466701_069737 | 3300042598 | Bacteria | 1984 |
| 10 | Ga0466722_190168 | 3300042609 | Bacteria | 1847 |
| 11 | JGI24702J35022_10812969 | 3300002462 | Bacteria | 582 |
| 12 | JGI24699J35502_11085383 | 3300002509 | Bacteria | 2040 |
| 13 | Ga0123357_10002545 | 3300009784 | Bacteria | 20418 |
| 14 | Ga0466735_097562 | 3300042624 | Bacteria | 2339 |
| 15 | Ga0466735_218862 | 3300042624 | Bacteria | 2181 |
| 16 | Ga0466704_389301 | 3300042643 | Bacteria | 2454 |
| 17 | Ga0466709_048836 | 3300042648 | Bacteria | 9066 |
| 18 | Ga0466727_199782 | 3300042655 | Bacteria | 4401 |
| 19 | Ga0466712_078234 | 3300042614 | Unclassified | 1410 |
| 20 | Ga0466711_391482 | 3300042615 | Bacteria | 2020 |
| 21 | Ga0466723_238494 | 3300042618 | Bacteria | 7296 |
| 22 | Ga0466690_123578 | 3300042590 | Bacteria | 14547 |
| 23 | Ga0466692_006967 | 3300042591 | Bacteria | 1090 |
| 24 | Ga0466692_030788 | 3300042591 | Bacteria | 34612 |
| 25 | Ga0466691_160797 | 3300042593 | Bacteria | 12348 |
| 26 | Ga0123356_12134749 | 3300010049 | Bacteria | 700 |
| 27 | Ga0123354_10398926 | 3300010882 | Bacteria | 1167 |
| 28 | JGI24702J35022_10025819 | 3300002462 | Bacteria | 3167 |
| 29 | JGI24702J35022_10105222 | 3300002462 | Bacteria | 1548 |
| 30 | Ga0466729_242355 | 3300042621 | Bacteria | 4772 |
| 31 | Ga0466735_003586 | 3300042624 | Bacteria | 1346 |
| 32 | Ga0466704_478384 | 3300042643 | Bacteria | 27201 |
| 33 | Ga0466709_364325 | 3300042648 | Bacteria | 2990 |
| 34 | Ga0466727_084171 | 3300042655 | Bacteria | 3389 |
| 35 | Ga0466710_053601 | 3300042613 | Bacteria | 1688 |
| 36 | Ga0466711_048662 | 3300042615 | Bacteria | 31707 |
| 37 | Ga0466715_105452 | 3300042616 | Bacteria | 35313 |
| 38 | Ga0466715_217598 | 3300042616 | Bacteria | 4356 |
| 39 | Ga0466729_111156 | 3300042621 | Bacteria | 20136 |
| 40 | Ga0466692_182444 | 3300042591 | Bacteria | 4878 |
| 41 | Ga0123356_13950581 | 3300010049 | Bacteria | 511 |
| 42 | Ga0123353_10193768 | 3300010167 | Unclassified | 3205 |
| 43 | Ga0123354_10059335 | 3300010882 | Bacteria | 5674 |
| 44 | Ga0466707_258487 | 3300042601 | Bacteria | 6602 |
| 45 | Ga0466722_013200 | 3300042609 | Bacteria | 5815 |
| 46 | JGI24702J35022_10020088 | 3300002462 | Bacteria | 3629 |
| 47 | Ga0466715_177718 | 3300042616 | Bacteria | 2381 |
| 48 | Ga0466715_186961 | 3300042616 | Bacteria | 8053 |
| 49 | Ga0123357_10069620 | 3300009784 | Bacteria | 4676 |
| 50 | Ga0123356_10120744 | 3300010049 | Bacteria | 2548 |
| 51 | Ga0123353_10002417 | 3300010167 | Bacteria | 23208 |
| 52 | Ga0123354_10278148 | 3300010882 | Bacteria | 1632 |
| 53 | Ga0466707_135003 | 3300042601 | Bacteria | 3503 |
| 54 | Ga0466707_341424 | 3300042601 | Bacteria | 1460 |
| 55 | Ga0466719_113425 | 3300042606 | Bacteria | 3744 |
| 56 | Ga0123357_10002535 | 3300009784 | Bacteria | 20437 |
| 57 | Ga0466735_133152 | 3300042624 | Bacteria | 4261 |
| 58 | Ga0466735_161261 | 3300042624 | Bacteria | 2047 |
| 59 | Ga0466704_512798 | 3300042643 | Bacteria | 3606 |
| 60 | Ga0466709_095978 | 3300042648 | Bacteria | 34809 |
| 61 | Ga0466727_266656 | 3300042655 | Bacteria | 6138 |
| 62 | Ga0466723_187839 | 3300042618 | Bacteria | 2725 |
| 63 | Ga0466726_145705 | 3300042619 | Bacteria | 31377 |
| 64 | Ga0466693_016502 | 3300042592 | Bacteria | 1225 |
| 65 | Ga0123357_10064113 | 3300009784 | Archaea | 4912 |
| 66 | Ga0123353_10442419 | 3300010167 | Bacteria | 1917 |
| 67 | Ga0123353_11899050 | 3300010167 | Bacteria | 735 |
| 68 | Ga0123354_10385157 | 3300010882 | Bacteria | 1205 |
| 69 | Ga0466707_256476 | 3300042601 | Bacteria | 4279 |
| 70 | JGI24699J35502_11133938 | 3300002509 | Bacteria | 20170 |
| 71 | Ga0466734_009608 | 3300042623 | Bacteria | 1611 |
| 72 | Ga0466703_081110 | 3300042636 | Bacteria | 9134 |
| 73 | Ga0466708_148606 | 3300042652 | Unclassified | 1214 |
| 74 | Ga0466727_199703 | 3300042655 | Bacteria | 1701 |
| 75 | Ga0466710_160864 | 3300042613 | Bacteria | 2145 |
| 76 | Ga0466723_045997 | 3300042618 | Bacteria | 5897 |
| 77 | Ga0466692_005818 | 3300042591 | Bacteria | 74984 |
| 78 | Ga0466692_039195 | 3300042591 | Bacteria | 13793 |
| 79 | Ga0466693_196200 | 3300042592 | Bacteria | 1122 |
| 80 | Ga0466701_005506 | 3300042598 | Bacteria | 15362 |
| 81 | Ga0466701_013613 | 3300042598 | Bacteria | 2031 |
| 82 | Ga0123357_10284263 | 3300009784 | Bacteria | 1703 |
| 83 | Ga0123354_10321269 | 3300010882 | Bacteria | 1428 |
| 84 | Ga0466701_039578 | 3300042598 | Bacteria | 3809 |
| 85 | Ga0466707_092432 | 3300042601 | Bacteria | 2201 |
| 86 | Ga0466707_127159 | 3300042601 | Bacteria | 1085 |
| 87 | Ga0466722_049429 | 3300042609 | Bacteria | 30179 |
| 88 | Ga0466722_240450 | 3300042609 | Bacteria | 8464 |
| 89 | Ga0466731_134412 | 3300042622 | Bacteria | 1094 |
| 90 | Ga0466708_345803 | 3300042652 | Bacteria | 1013 |
| 91 | Ga0466711_097849 | 3300042615 | Bacteria | 6782 |
| 92 | Ga0466715_339150 | 3300042616 | Bacteria | 9992 |
| 93 | Ga0466729_188705 | 3300042621 | Bacteria | 3949 |
| 94 | Ga0466690_174976 | 3300042590 | Bacteria | 26076 |
| 95 | Ga0466700_198375 | 3300042600 | Bacteria | 7072 |
| 96 | Ga0466716_330599 | 3300042605 | Bacteria | 1028 |
| 97 | JGI24705J35276_12228173 | 3300002504 | Bacteria | 3136 |
| 98 | Ga0466697_214588 | 3300042611 | Bacteria | 8149 |
| 99 | Ga0466705_196267 | 3300042612 | Unclassified | 3860 |
| 100 | Ga0466735_127066 | 3300042624 | Bacteria | 1278 |
| 101 | Ga0466703_101704 | 3300042636 | Bacteria | 2479 |
| 102 | Ga0466703_166032 | 3300042636 | Bacteria | 1501 |
| 103 | Ga0466727_068629 | 3300042655 | Bacteria | 1525 |
| 104 | Ga0466715_042244 | 3300042616 | Bacteria | 25310 |
| 105 | Ga0466691_119329 | 3300042593 | Bacteria | 1032 |
| 106 | Ga0466696_036938 | 3300042596 | Bacteria | 11954 |
| 107 | Ga0123356_10699030 | 3300010049 | Bacteria | 1183 |
| 108 | Ga0123353_10030119 | 3300010167 | Bacteria | 8379 |
| 109 | Ga0123354_10114068 | 3300010882 | Bacteria | 3544 |
| 110 | Ga0466700_024764 | 3300042600 | Bacteria | 2985 |
| 111 | Ga0466707_203601 | 3300042601 | Bacteria | 6660 |
| 112 | Ga0466719_245951 | 3300042606 | Bacteria | 6118 |
| 113 | JGI24696J40584_12959404 | 3300002834 | Bacteria | 5082 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05402 | PqqD | Coenzyme PQQ synthesis protein D (PqqD) | 64 | 117 | 0.93 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.