Protein Family IF08008
Metagenome
Metatranscriptome
Isolate
140
Members
36
Samples
138
Scaffolds
256.87
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_027813|Ga0466723_027813_18_902
- Length
- 294 aa
- Sequence
- MREKNGENMGNIDKNTDKRYNRPKNSFPGIGIRSSLMKQGSFRAVCVVLLACMALVSAYGDERTINSEAVIIEPFDGDTAHEWTVEGRTGSYEFDWSKDASKFATVAEGDEYPRLTYVSAWPQALFGNNRQGIDYKSLGIWGRFDRRGYNWIDIYPVEVGTDTPFEIPLPGRVHYLDMWVWGSNLQFYIEAFVRDYQGVVHTLRLGDISYTGWRNLRVSIPNTIRQSKRILPHYAGLQFVKFRIWTQPSERVDDFYIYFDQFKIVTDTFESFFDGDELADPEHVQELWAVSGNN
Sample Types
Isolate
1.4%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
1.4%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
42.4%
Termitidae
30.3%
Unclassified
9.1%
Termopsidae
9.1%
Rhinotermitidae
6.1%
Blaberidae
3.0%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300021220 | Termite gut microbial communities from nest from French Guiana - FG16_9_6 mRNA SA | Metatranscriptome | |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 4 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 5 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 26 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 30 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466716_370937 | 3300042605 | Bacteria | 2890 |
| 2 | Ga0466716_536308 | 3300042605 | Bacteria | 1824 |
| 3 | Ga0466720_031852 | 3300042607 | Bacteria | 7594 |
| 4 | Ga0466720_062325 | 3300042607 | Bacteria | 28961 |
| 5 | Ga0466722_183378 | 3300042609 | Bacteria | 7506 |
| 6 | Ga0466718_023500 | 3300042617 | Bacteria | 3189 |
| 7 | Ga0466723_024084 | 3300042618 | Bacteria | 42350 |
| 8 | Ga0466729_168704 | 3300042621 | Bacteria | 3442 |
| 9 | Ga0466696_180220 | 3300042596 | Bacteria | 6308 |
| 10 | Ga0466699_122766 | 3300042597 | Bacteria | 7781 |
| 11 | AustNasuHG_c1002884 | 3300000089 | Bacteria | 6208 |
| 12 | Ga0466713_031672 | 3300042602 | Bacteria | 3842 |
| 13 | Ga0466720_088525 | 3300042607 | Bacteria | 28475 |
| 14 | Ga0466718_142814 | 3300042617 | Bacteria | 16284 |
| 15 | Ga0466723_195456 | 3300042618 | Bacteria | 36467 |
| 16 | Ga0264413_100619 | 3300024493 | Bacteria | 17189 |
| 17 | Ga0466691_168729 | 3300042593 | Bacteria | 1483 |
| 18 | Ga0466696_278873 | 3300042596 | Unclassified | 1694 |
| 19 | Ga0072940_1051788 | 3300005200 | Bacteria | 3705 |
| 20 | Ga0466705_169714 | 3300042612 | Bacteria | 6814 |
| 21 | Ga0466704_249706 | 3300042643 | Bacteria | 5732 |
| 22 | Ga0466704_279746 | 3300042643 | Bacteria | 16266 |
| 23 | Ga0466709_115105 | 3300042648 | Bacteria | 20186 |
| 24 | Ga0466708_131985 | 3300042652 | Bacteria | 5705 |
| 25 | Ga0466732_390376 | 3300042656 | Bacteria | 5205 |
| 26 | Ga0466700_212205 | 3300042600 | Bacteria | 1275 |
| 27 | Ga0466716_201114 | 3300042605 | Bacteria | 39030 |
| 28 | Ga0466720_082193 | 3300042607 | Bacteria | 6153 |
| 29 | Ga0466720_226798 | 3300042607 | Bacteria | 5016 |
| 30 | Ga0466722_125859 | 3300042609 | Bacteria | 5198 |
| 31 | Ga0466712_274787 | 3300042614 | Bacteria | 6963 |
| 32 | Ga0466711_113548 | 3300042615 | Bacteria | 36298 |
| 33 | Ga0466723_148519 | 3300042618 | Bacteria | 15080 |
| 34 | Ga0466723_318907 | 3300042618 | Bacteria | 3991 |
| 35 | Ga0466728_475229 | 3300042620 | Bacteria | 3890 |
| 36 | Ga0264413_122530 | 3300024493 | Bacteria | 2864 |
| 37 | Ga0466694_274033 | 3300042594 | Bacteria | 26693 |
| 38 | Ga0466705_271225 | 3300042612 | Bacteria | 3560 |
| 39 | Ga0466704_305606 | 3300042643 | Bacteria | 29402 |
| 40 | Ga0466709_399705 | 3300042648 | Bacteria | 2373 |
| 41 | Ga0466708_199104 | 3300042652 | Bacteria | 3204 |
| 42 | Ga0466708_456071 | 3300042652 | Bacteria | 2806 |
| 43 | Ga0466700_005809 | 3300042600 | Bacteria | 2613 |
| 44 | Ga0466715_063066 | 3300042616 | Bacteria | 49420 |
| 45 | Ga0466723_291250 | 3300042618 | Bacteria | 3078 |
| 46 | Ga0466726_232852 | 3300042619 | Bacteria | 1320 |
| 47 | Ga0264413_100618 | 3300024493 | Bacteria | 16207 |
| 48 | Ga0466690_068739 | 3300042590 | Unclassified | 3737 |
| 49 | Ga0466696_041001 | 3300042596 | Bacteria | 21262 |
| 50 | Ga0466696_206474 | 3300042596 | Bacteria | 3988 |
| 51 | Ga0466696_331190 | 3300042596 | Bacteria | 65152 |
| 52 | Ga0466699_181103 | 3300042597 | Bacteria | 2424 |
| 53 | Ga0466705_054661 | 3300042612 | Bacteria | 27078 |
| 54 | Ga0466705_167883 | 3300042612 | Bacteria | 3257 |
| 55 | Ga0466704_592969 | 3300042643 | Bacteria | 6625 |
| 56 | Ga0466708_202662 | 3300042652 | Bacteria | 29963 |
| 57 | Ga0466732_051898 | 3300042656 | Bacteria | 74540 |
| 58 | Ga0466720_062128 | 3300042607 | Bacteria | 4068 |
| 59 | Ga0466722_111888 | 3300042609 | Bacteria | 6156 |
| 60 | Ga0466715_206361 | 3300042616 | Bacteria | 12461 |
| 61 | Ga0466723_300287 | 3300042618 | Bacteria | 3238 |
| 62 | Ga0466726_004928 | 3300042619 | Bacteria | 2166 |
| 63 | Ga0466728_080024 | 3300042620 | Bacteria | 18381 |
| 64 | Ga0466728_160568 | 3300042620 | Bacteria | 17497 |
| 65 | Ga0223680_102059 | 3300021220 | Bacteria | 1614 |
| 66 | Ga0223677_1009021 | 3300021239 | Bacteria | 1433 |
| 67 | Ga0264413_104183 | 3300024493 | Bacteria | 6600 |
| 68 | Ga0264413_119379 | 3300024493 | Bacteria | 2984 |
| 69 | Ga0466690_346053 | 3300042590 | Bacteria | 2455 |
| 70 | Ga0466691_089756 | 3300042593 | Bacteria | 7175 |
| 71 | Ga0466694_324243 | 3300042594 | Bacteria | 1754 |
| 72 | Ga0466696_218027 | 3300042596 | Bacteria | 9062 |
| 73 | Ga0466696_244990 | 3300042596 | Bacteria | 5062 |
| 74 | AustNasuHG_c1029702 | 3300000089 | Bacteria | 1593 |
| 75 | Ga0123353_10080020 | 3300010167 | Bacteria | 5255 |
| 76 | Ga0466703_015135 | 3300042636 | Bacteria | 49157 |
| 77 | Ga0466703_023767 | 3300042636 | Bacteria | 2726 |
| 78 | Ga0466704_128155 | 3300042643 | Bacteria | 28523 |
| 79 | Ga0466704_263856 | 3300042643 | Bacteria | 3831 |
| 80 | Ga0466709_130608 | 3300042648 | Bacteria | 7106 |
| 81 | Ga0466708_280160 | 3300042652 | Bacteria | 9278 |
| 82 | Ga0466719_203977 | 3300042606 | Bacteria | 7740 |
| 83 | Ga0466720_091144 | 3300042607 | Bacteria | 2875 |
| 84 | Ga0466711_183178 | 3300042615 | Bacteria | 53190 |
| 85 | Ga0466715_536951 | 3300042616 | Bacteria | 7249 |
| 86 | Ga0466718_086776 | 3300042617 | Bacteria | 73105 |
| 87 | Ga0466728_027336 | 3300042620 | Bacteria | 21574 |
| 88 | Ga0466728_127916 | 3300042620 | Bacteria | 3626 |
| 89 | Ga0466728_162119 | 3300042620 | Bacteria | 8718 |
| 90 | Ga0466690_109219 | 3300042590 | Bacteria | 1409 |
| 91 | Ga0466690_205288 | 3300042590 | Bacteria | 1222 |
| 92 | Ga0466691_034660 | 3300042593 | Bacteria | 57357 |
| 93 | Ga0466696_423691 | 3300042596 | Bacteria | 31979 |
| 94 | Ga0466705_127577 | 3300042612 | Bacteria | 32685 |
| 95 | Ga0466705_338674 | 3300042612 | Bacteria | 3456 |
| 96 | Ga0466703_049531 | 3300042636 | Bacteria | 42822 |
| 97 | Ga0466704_163988 | 3300042643 | Bacteria | 31139 |
| 98 | Ga0466709_280168 | 3300042648 | Bacteria | 28407 |
| 99 | Ga0466727_066843 | 3300042655 | Bacteria | 1171 |
| 100 | Ga0466727_074225 | 3300042655 | Bacteria | 3053 |
| 101 | Ga0466719_048637 | 3300042606 | Bacteria | 10963 |
| 102 | Ga0466719_347153 | 3300042606 | Bacteria | 4026 |
| 103 | Ga0466719_376993 | 3300042606 | Bacteria | 5034 |
| 104 | Ga0466719_526121 | 3300042606 | Bacteria | 1133 |
| 105 | Ga0466720_004688 | 3300042607 | Bacteria | 13252 |
| 106 | Ga0466720_015865 | 3300042607 | Bacteria | 15796 |
| 107 | Ga0466720_067267 | 3300042607 | Bacteria | 8369 |
| 108 | Ga0466720_091089 | 3300042607 | Bacteria | 3133 |
| 109 | Ga0466720_106657 | 3300042607 | Bacteria | 19707 |
| 110 | Ga0466722_007037 | 3300042609 | Bacteria | 4648 |
| 111 | Ga0466711_236469 | 3300042615 | Bacteria | 97130 |
| 112 | Ga0466723_089597 | 3300042618 | Bacteria | 3572 |
| 113 | Ga0466723_233143 | 3300042618 | Bacteria | 28706 |
| 114 | Ga0466691_068316 | 3300042593 | Bacteria | 35532 |
| 115 | Ga0466694_113535 | 3300042594 | Bacteria | 5330 |
| 116 | Ga0466699_157697 | 3300042597 | Bacteria | 2916 |
| 117 | Ga0068305_10800663 | 3300005083 | Bacteria | 8575 |
| 118 | Ga0466735_087009 | 3300042624 | Bacteria | 4182 |
| 119 | Ga0466704_250975 | 3300042643 | Bacteria | 3750 |
| 120 | Ga0466704_335796 | 3300042643 | Bacteria | 67702 |
| 121 | Ga0466708_455563 | 3300042652 | Bacteria | 2808 |
| 122 | Ga0466732_414063 | 3300042656 | Bacteria | 5558 |
| 123 | Ga0466720_021934 | 3300042607 | Bacteria | 78212 |
| 124 | Ga0466715_415539 | 3300042616 | Bacteria | 5510 |
| 125 | Ga0466715_432826 | 3300042616 | Bacteria | 7853 |
| 126 | Ga0466723_027813 | 3300042618 | Bacteria | 4459 |
| 127 | Ga0466728_227423 | 3300042620 | Bacteria | 6633 |
| 128 | Ga0466696_396821 | 3300042596 | Bacteria | 23354 |
| 129 | Ga0466699_060995 | 3300042597 | Bacteria | 46589 |
| 130 | Ga0466699_294709 | 3300042597 | Bacteria | 1226 |
| 131 | AustNasuHG_c1006172 | 3300000089 | Bacteria | 4282 |
| 132 | Ga0072940_1051775 | 3300005200 | Bacteria | 2478 |
| 133 | Ga0466705_105677 | 3300042612 | Bacteria | 19143 |
| 134 | Ga0466705_341846 | 3300042612 | Bacteria | 2786 |
| 135 | Ga0466703_220845 | 3300042636 | Bacteria | 51302 |
| 136 | Ga0466708_028808 | 3300042652 | Bacteria | 2129 |
| 137 | Ga0466708_068830 | 3300042652 | Bacteria | 16777 |
| 138 | Ga0466727_049047 | 3300042655 | Bacteria | 11026 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04620 | FlaA | Flagellar filament outer layer protein Flaa | 134 | 269 | 0.91 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.