Protein Family IF08000
Metagenome
Isolate
120
Members
35
Samples
116
Scaffolds
204.09
Avg Length
Representative Sequence
- ID
- 3300042618|Ga0466723_022565|Ga0466723_022565_2488_3189
- Length
- 233 aa
- Sequence
- VEFGVPLITKSPDSAGVGIRDDGKYHFQEKTMKELTQRQREVLTFISDYIRSHYYPPTIREVAEHFSISVKGAYDHVLALKKKGRLKLDDKRSRTMEVVHDEEDRAIEGFAEIRVLGVVAAGRPILAEENWDGSIPMHNSFLKKNKQYFALKVKGDSMKDAGILDKDTALIQEQDFARNGEIVVAVVDEAVTLKRFFKETNRIRLQPENPAYLPIYSQDVRILGKLAHIIRSY
Sample Types
Isolate
3.3%
Metagenome
96.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.0%
Termitidae
31.4%
Unclassified
14.3%
Termopsidae
8.6%
Rhinotermitidae
5.7%
Taxonomy
Archaea
0
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 2 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 3 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 4 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 5 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 22 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 25 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 26 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 27 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 28 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 29 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 34 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 35 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466722_090488 | 3300042609 | Bacteria | 1337 |
| 2 | Ga0466722_118888 | 3300042609 | Bacteria | 12085 |
| 3 | Ga0466690_135457 | 3300042590 | Unclassified | 1126 |
| 4 | Ga0466690_303226 | 3300042590 | Unclassified | 3480 |
| 5 | Ga0466695_063524 | 3300042595 | Bacteria | 5477 |
| 6 | Ga0466729_199377 | 3300042621 | Bacteria | 4237 |
| 7 | Ga0466735_037440 | 3300042624 | Bacteria | 20852 |
| 8 | Ga0466703_116071 | 3300042636 | Bacteria | 5249 |
| 9 | Ga0466703_239484 | 3300042636 | Unclassified | 1579 |
| 10 | Ga0466704_484696 | 3300042643 | Bacteria | 5878 |
| 11 | Ga0466709_159197 | 3300042648 | Bacteria | 4476 |
| 12 | Ga0466708_066838 | 3300042652 | Bacteria | 32818 |
| 13 | Ga0466708_343097 | 3300042652 | Bacteria | 24340 |
| 14 | JGI24698J34947_10039042 | 3300002449 | Bacteria | 2460 |
| 15 | Ga0123354_10016977 | 3300010882 | Bacteria | 11402 |
| 16 | Ga0466705_104098 | 3300042612 | Bacteria | 9560 |
| 17 | Ga0466691_142615 | 3300042593 | Bacteria | 2689 |
| 18 | Ga0466696_006913 | 3300042596 | Bacteria | 1612 |
| 19 | Ga0466696_179878 | 3300042596 | Bacteria | 10124 |
| 20 | Ga0466701_006364 | 3300042598 | Bacteria | 1410 |
| 21 | Ga0466712_039319 | 3300042614 | Bacteria | 3409 |
| 22 | Ga0466715_131105 | 3300042616 | Bacteria | 7317 |
| 23 | Ga0466715_463170 | 3300042616 | Bacteria | 10845 |
| 24 | Ga0466726_166077 | 3300042619 | Bacteria | 2576 |
| 25 | Ga0466731_247662 | 3300042622 | Bacteria | 2971 |
| 26 | Ga0466735_002079 | 3300042624 | Bacteria | 1368 |
| 27 | Ga0466735_020895 | 3300042624 | Bacteria | 1051 |
| 28 | Ga0466702_406002 | 3300042635 | Bacteria | 2704 |
| 29 | Ga0466704_107342 | 3300042643 | Bacteria | 3149 |
| 30 | Ga0466708_002668 | 3300042652 | Bacteria | 9345 |
| 31 | Ga0466727_048067 | 3300042655 | Bacteria | 1092 |
| 32 | JGI24698J34947_10050093 | 3300002449 | Bacteria | 2108 |
| 33 | Ga0466705_340330 | 3300042612 | Bacteria | 7504 |
| 34 | Ga0466707_206027 | 3300042601 | Bacteria | 1256 |
| 35 | Ga0466716_051618 | 3300042605 | Bacteria | 17911 |
| 36 | Ga0466690_040742 | 3300042590 | Bacteria | 2139 |
| 37 | Ga0466690_078911 | 3300042590 | Bacteria | 1130 |
| 38 | Ga0466715_312142 | 3300042616 | Bacteria | 12836 |
| 39 | Ga0466718_036178 | 3300042617 | Bacteria | 12806 |
| 40 | Ga0466723_017798 | 3300042618 | Bacteria | 9159 |
| 41 | Ga0466723_022565 | 3300042618 | Bacteria | 4838 |
| 42 | Ga0466728_459854 | 3300042620 | Bacteria | 3008 |
| 43 | Ga0466735_133048 | 3300042624 | Bacteria | 2145 |
| 44 | Ga0466702_126621 | 3300042635 | Bacteria | 1108 |
| 45 | Ga0466703_072716 | 3300042636 | Bacteria | 8555 |
| 46 | Ga0466709_050417 | 3300042648 | Bacteria | 2900 |
| 47 | Ga0466705_083290 | 3300042612 | Unclassified | 1462 |
| 48 | Ga0466719_520969 | 3300042606 | Bacteria | 1882 |
| 49 | Ga0466691_047050 | 3300042593 | Bacteria | 5769 |
| 50 | Ga0466712_117371 | 3300042614 | Bacteria | 5748 |
| 51 | Ga0466728_191092 | 3300042620 | Unclassified | 1885 |
| 52 | Ga0466728_258415 | 3300042620 | Bacteria | 5628 |
| 53 | Ga0466729_134193 | 3300042621 | Bacteria | 1205 |
| 54 | Ga0466702_436602 | 3300042635 | Bacteria | 2154 |
| 55 | Ga0466703_035407 | 3300042636 | Bacteria | 9054 |
| 56 | Ga0466704_161524 | 3300042643 | Bacteria | 7948 |
| 57 | Ga0466704_224322 | 3300042643 | Bacteria | 1138 |
| 58 | Ga0466704_302653 | 3300042643 | Bacteria | 5475 |
| 59 | Ga0466704_549246 | 3300042643 | Bacteria | 8888 |
| 60 | Ga0466709_381365 | 3300042648 | Bacteria | 28038 |
| 61 | Ga0466708_020095 | 3300042652 | Bacteria | 10835 |
| 62 | Ga0466707_199385 | 3300042601 | Bacteria | 1527 |
| 63 | Ga0466716_370062 | 3300042605 | Bacteria | 1560 |
| 64 | Ga0466719_352927 | 3300042606 | Bacteria | 1138 |
| 65 | Ga0466719_375505 | 3300042606 | Bacteria | 1474 |
| 66 | Ga0466715_049424 | 3300042616 | Bacteria | 22983 |
| 67 | Ga0466715_338445 | 3300042616 | Bacteria | 17601 |
| 68 | Ga0466735_065722 | 3300042624 | Bacteria | 2544 |
| 69 | Ga0466703_286328 | 3300042636 | Bacteria | 2389 |
| 70 | Ga0466709_068755 | 3300042648 | Bacteria | 5487 |
| 71 | Ga0466700_325490 | 3300042600 | Bacteria | 1329 |
| 72 | Ga0466719_033519 | 3300042606 | Bacteria | 1479 |
| 73 | Ga0466719_499064 | 3300042606 | Bacteria | 1103 |
| 74 | Ga0466719_558470 | 3300042606 | Unclassified | 1518 |
| 75 | Ga0466690_001340 | 3300042590 | Unclassified | 1287 |
| 76 | Ga0466715_481844 | 3300042616 | Bacteria | 7971 |
| 77 | Ga0466723_271934 | 3300042618 | Bacteria | 6848 |
| 78 | Ga0466702_222629 | 3300042635 | Bacteria | 24290 |
| 79 | Ga0466703_103947 | 3300042636 | Bacteria | 2447 |
| 80 | Ga0466708_008318 | 3300042652 | Bacteria | 7020 |
| 81 | Ga0466708_155816 | 3300042652 | Bacteria | 23783 |
| 82 | Ga0466708_232686 | 3300042652 | Bacteria | 4683 |
| 83 | Ga0466705_181501 | 3300042612 | Bacteria | 1639 |
| 84 | Ga0466707_180530 | 3300042601 | Bacteria | 1490 |
| 85 | Ga0466719_125550 | 3300042606 | Bacteria | 2385 |
| 86 | Ga0466690_389635 | 3300042590 | Bacteria | 2334 |
| 87 | Ga0466696_340779 | 3300042596 | Bacteria | 5891 |
| 88 | Ga0466715_314204 | 3300042616 | Bacteria | 4723 |
| 89 | Ga0466723_038166 | 3300042618 | Bacteria | 5521 |
| 90 | Ga0466723_139730 | 3300042618 | Bacteria | 2636 |
| 91 | Ga0466723_260693 | 3300042618 | Bacteria | 3433 |
| 92 | Ga0466728_007132 | 3300042620 | Bacteria | 16135 |
| 93 | Ga0466703_413370 | 3300042636 | Bacteria | 9727 |
| 94 | Ga0466704_144518 | 3300042643 | Bacteria | 13573 |
| 95 | Ga0466709_179037 | 3300042648 | Bacteria | 19623 |
| 96 | Ga0466709_331902 | 3300042648 | Bacteria | 6314 |
| 97 | Ga0466708_025410 | 3300042652 | Bacteria | 1670 |
| 98 | Ga0466727_163476 | 3300042655 | Bacteria | 6512 |
| 99 | Ga0466705_019389 | 3300042612 | Bacteria | 5246 |
| 100 | Ga0466705_218629 | 3300042612 | Bacteria | 9461 |
| 101 | Ga0466707_382239 | 3300042601 | Bacteria | 1045 |
| 102 | Ga0466716_143072 | 3300042605 | Bacteria | 4672 |
| 103 | Ga0466719_085927 | 3300042606 | Bacteria | 3528 |
| 104 | Ga0466696_386021 | 3300042596 | Bacteria | 12033 |
| 105 | Ga0466699_184149 | 3300042597 | Bacteria | 40447 |
| 106 | Ga0466711_308150 | 3300042615 | Bacteria | 3935 |
| 107 | Ga0466711_497397 | 3300042615 | Bacteria | 2618 |
| 108 | Ga0466715_226275 | 3300042616 | Bacteria | 9542 |
| 109 | Ga0466715_278389 | 3300042616 | Bacteria | 5972 |
| 110 | Ga0466723_226588 | 3300042618 | Bacteria | 6206 |
| 111 | Ga0466735_122506 | 3300042624 | Bacteria | 3724 |
| 112 | Ga0466704_228684 | 3300042643 | Bacteria | 10063 |
| 113 | Ga0466704_286001 | 3300042643 | Bacteria | 16185 |
| 114 | Ga0466708_030492 | 3300042652 | Bacteria | 4198 |
| 115 | JGI24698J34947_10002415 | 3300002449 | Bacteria | 10058 |
| 116 | Ga0123357_10014743 | 3300009784 | Bacteria | 10216 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.