Protein Family IF07965
Metagenome
Isolate
142
Members
45
Samples
131
Scaffolds
257.63
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_156446|Ga0466718_156446_59_937
- Length
- 292 aa
- Sequence
- VGTDITTTKLDVFFRNFLEIDSFAQADNSLNGIQVDNDGSSIRKIAFAVDAAMETFEQAAAAGAGMLFVHHGLFWGAPLRITGNLRRRIKFLLKCNICLYAVHLPLDQHPKMGNNACLAELLGLENIEPFGVYNGRKIGCKGVFPVPVTVEEAVKKIDFMGRPPLGVFPFGQSEIKSAAIVSGGAAKITLQAIEEGVDLFVTGEAGHQVYHDCLEGKLNMIAGGHYNTEVWGLRAVMRHCIACLGAEFGIDADFIDVPNGKKKKREYGIETFKANSPAAVINGVHYSGGSGG
Sample Types
Isolate
7.8%
Metagenome
92.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Unclassified
28.6%
Kalotermitidae
19.0%
Rhinotermitidae
2.4%
Taxonomy
Archaea
2
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 2 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 3 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 4 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 14 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 19 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 29 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 32 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 33 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 34 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 35 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 38 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 39 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 40 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_090749 | 3300042612 | Bacteria | 5471 |
| 2 | Ga0466732_217691 | 3300042656 | Bacteria | 3120 |
| 3 | Ga0466732_240626 | 3300042656 | Bacteria | 1035 |
| 4 | Ga0264413_120453 | 3300024493 | Bacteria | 4549 |
| 5 | Ga0466694_205754 | 3300042594 | Bacteria | 7559 |
| 6 | Ga0123356_10062570 | 3300010049 | Bacteria | 3476 |
| 7 | Ga0466720_012964 | 3300042607 | Bacteria | 8353 |
| 8 | Ga0466720_127163 | 3300042607 | Bacteria | 15897 |
| 9 | Ga0466720_146539 | 3300042607 | Bacteria | 24774 |
| 10 | Ga0466712_022676 | 3300042614 | Bacteria | 25093 |
| 11 | Ga0466712_062031 | 3300042614 | Bacteria | 9557 |
| 12 | Ga0466712_284077 | 3300042614 | Bacteria | 1443 |
| 13 | Ga0466718_030506 | 3300042617 | Bacteria | 1527 |
| 14 | Ga0466718_055116 | 3300042617 | Bacteria | 13015 |
| 15 | AustNasuHG_c1020039 | 3300000089 | Bacteria | 2184 |
| 16 | JGI24698J34947_10008552 | 3300002449 | Unclassified | 5618 |
| 17 | JGI24698J34947_10025645 | 3300002449 | Bacteria | 3136 |
| 18 | JGI24695J34938_10001759 | 3300002450 | Bacteria | 17889 |
| 19 | JGI24695J34938_10032496 | 3300002450 | Bacteria | 2410 |
| 20 | Ga0068305_10016636 | 3300005083 | Bacteria | 20797 |
| 21 | Ga0466708_158543 | 3300042652 | Bacteria | 5616 |
| 22 | Ga0264413_112647 | 3300024493 | Bacteria | 24407 |
| 23 | Ga0466691_058900 | 3300042593 | Bacteria | 12683 |
| 24 | Ga0466694_167502 | 3300042594 | Bacteria | 3146 |
| 25 | Ga0466699_003845 | 3300042597 | Bacteria | 2623 |
| 26 | Ga0466720_009728 | 3300042607 | Bacteria | 11017 |
| 27 | Ga0466720_046759 | 3300042607 | Bacteria | 24621 |
| 28 | Ga0466720_112861 | 3300042607 | Bacteria | 6917 |
| 29 | Ga0466722_123447 | 3300042609 | Bacteria | 25254 |
| 30 | Ga0466698_237749 | 3300042610 | Bacteria | 2685 |
| 31 | Ga0466712_018977 | 3300042614 | Bacteria | 23050 |
| 32 | Ga0466715_409416 | 3300042616 | Bacteria | 9813 |
| 33 | Ga0466718_066143 | 3300042617 | Bacteria | 4020 |
| 34 | Ga0466718_077989 | 3300042617 | Bacteria | 9049 |
| 35 | Ga0466718_156446 | 3300042617 | Bacteria | 1170 |
| 36 | JGI24698J34947_10002734 | 3300002449 | Bacteria | 9534 |
| 37 | JGI24695J34938_10018444 | 3300002450 | Bacteria | 3487 |
| 38 | Ga0072941_1066337 | 3300005201 | Bacteria | 1966 |
| 39 | Ga0072941_1100404 | 3300005201 | Bacteria | 2342 |
| 40 | Ga0466731_150824 | 3300042622 | Bacteria | 1962 |
| 41 | Ga0466732_376636 | 3300042656 | Bacteria | 1548 |
| 42 | Ga0466694_077836 | 3300042594 | Bacteria | 37129 |
| 43 | Ga0466720_058276 | 3300042607 | Bacteria | 42688 |
| 44 | Ga0466720_089732 | 3300042607 | Unclassified | 10190 |
| 45 | Ga0466720_111996 | 3300042607 | Bacteria | 8578 |
| 46 | Ga0466712_195821 | 3300042614 | Bacteria | 17019 |
| 47 | Ga0466715_180881 | 3300042616 | Bacteria | 5411 |
| 48 | Ga0466718_009948 | 3300042617 | Bacteria | 1389 |
| 49 | Ga0466718_083308 | 3300042617 | Bacteria | 4896 |
| 50 | AustNasuHG_c1013268 | 3300000089 | Bacteria | 2828 |
| 51 | JGI24698J34947_10007377 | 3300002449 | Bacteria | 6045 |
| 52 | JGI24698J34947_10016006 | 3300002449 | Unclassified | 4078 |
| 53 | JGI24702J35022_10003326 | 3300002462 | Bacteria | 9708 |
| 54 | Ga0072940_1057536 | 3300005200 | Bacteria | 5969 |
| 55 | Ga0072940_1068517 | 3300005200 | Bacteria | 1662 |
| 56 | Ga0466731_233896 | 3300042622 | Bacteria | 20635 |
| 57 | Ga0466705_086104 | 3300042612 | Bacteria | 4842 |
| 58 | Ga0264413_108871 | 3300024493 | Bacteria | 3797 |
| 59 | Ga0264413_134506 | 3300024493 | Bacteria | 4722 |
| 60 | Ga0415639_046599 | 3300038395 | Bacteria | 7247 |
| 61 | Ga0123356_10009396 | 3300010049 | Bacteria | 9659 |
| 62 | Ga0123356_10160699 | 3300010049 | Bacteria | 2243 |
| 63 | Ga0466700_392763 | 3300042600 | Bacteria | 2238 |
| 64 | Ga0466720_075575 | 3300042607 | Bacteria | 5582 |
| 65 | Ga0466712_064359 | 3300042614 | Bacteria | 30896 |
| 66 | Ga0466718_010770 | 3300042617 | Bacteria | 4466 |
| 67 | Ga0466718_101991 | 3300042617 | Bacteria | 3491 |
| 68 | Ga0466718_146918 | 3300042617 | Bacteria | 1195 |
| 69 | JGI24698J34947_10012911 | 3300002449 | Bacteria | 4564 |
| 70 | JGI24698J34947_10032160 | 3300002449 | Bacteria | 2756 |
| 71 | JGI24695J34938_10000312 | 3300002450 | Bacteria | 48010 |
| 72 | Ga0072941_1038834 | 3300005201 | Bacteria | 9129 |
| 73 | Ga0072941_1045615 | 3300005201 | Bacteria | 6549 |
| 74 | Ga0072941_1055137 | 3300005201 | Bacteria | 7057 |
| 75 | Ga0466702_242958 | 3300042635 | Bacteria | 12209 |
| 76 | Ga0466732_016065 | 3300042656 | Bacteria | 10755 |
| 77 | Ga0264413_102254 | 3300024493 | Bacteria | 3192 |
| 78 | Ga0466694_129034 | 3300042594 | Bacteria | 20288 |
| 79 | Ga0466699_064910 | 3300042597 | Bacteria | 2513 |
| 80 | Ga0123353_10341920 | 3300010167 | Bacteria | 2260 |
| 81 | Ga0466720_149433 | 3300042607 | Bacteria | 6931 |
| 82 | Ga0466720_159576 | 3300042607 | Bacteria | 7464 |
| 83 | Ga0466715_048849 | 3300042616 | Bacteria | 5654 |
| 84 | Ga0466718_107737 | 3300042617 | Bacteria | 57891 |
| 85 | Ga0466718_131715 | 3300042617 | Bacteria | 1604 |
| 86 | JGI24698J34947_10058444 | 3300002449 | Bacteria | 1910 |
| 87 | JGI24695J34938_10000327 | 3300002450 | Bacteria | 46825 |
| 88 | Ga0072941_1034213 | 3300005201 | Bacteria | 5764 |
| 89 | Ga0072941_1040782 | 3300005201 | Bacteria | 3835 |
| 90 | Ga0466696_243494 | 3300042596 | Bacteria | 5293 |
| 91 | Ga0466717_084924 | 3300042604 | Bacteria | 2045 |
| 92 | Ga0466720_027935 | 3300042607 | Bacteria | 23895 |
| 93 | Ga0466720_116644 | 3300042607 | Bacteria | 39029 |
| 94 | Ga0466718_157467 | 3300042617 | Bacteria | 1496 |
| 95 | Ga0466718_163457 | 3300042617 | Unclassified | 2999 |
| 96 | JGI24698J34947_10001451 | 3300002449 | Bacteria | 12460 |
| 97 | JGI24698J34947_10011129 | 3300002449 | Bacteria | 4937 |
| 98 | JGI24698J34947_10086000 | 3300002449 | Bacteria | 1459 |
| 99 | Ga0072941_1014418 | 3300005201 | Bacteria | 13817 |
| 100 | Ga0466702_290156 | 3300042635 | Bacteria | 2432 |
| 101 | Ga0466704_378188 | 3300042643 | Bacteria | 32721 |
| 102 | Ga0466690_232635 | 3300042590 | Bacteria | 21789 |
| 103 | Ga0466694_077702 | 3300042594 | Bacteria | 1503 |
| 104 | Ga0466695_259092 | 3300042595 | Bacteria | 134193 |
| 105 | Ga0466696_079733 | 3300042596 | Bacteria | 26699 |
| 106 | Ga0466699_150169 | 3300042597 | Bacteria | 2940 |
| 107 | Ga0123356_10409400 | 3300010049 | Bacteria | 1495 |
| 108 | Ga0123356_10869475 | 3300010049 | Bacteria | 1073 |
| 109 | Ga0466712_046435 | 3300042614 | Bacteria | 1273 |
| 110 | Ga0466715_008384 | 3300042616 | Bacteria | 4233 |
| 111 | FAAS_10005258 | 3300001880 | Bacteria | 973 |
| 112 | JGI24698J34947_10066954 | 3300002449 | Archaea | 1745 |
| 113 | JGI24695J34938_10009112 | 3300002450 | Bacteria | 5556 |
| 114 | JGI24699J35502_11131856 | 3300002509 | Bacteria | 6090 |
| 115 | Ga0466702_342474 | 3300042635 | Bacteria | 3327 |
| 116 | Ga0466702_452168 | 3300042635 | Bacteria | 15871 |
| 117 | Ga0466709_359317 | 3300042648 | Bacteria | 12043 |
| 118 | Ga0466708_110090 | 3300042652 | Bacteria | 4173 |
| 119 | Ga0466694_117791 | 3300042594 | Bacteria | 4539 |
| 120 | Ga0466694_290451 | 3300042594 | Bacteria | 4312 |
| 121 | Ga0123356_10078852 | 3300010049 | Bacteria | 3110 |
| 122 | Ga0466720_120845 | 3300042607 | Bacteria | 1601 |
| 123 | Ga0466718_032850 | 3300042617 | Bacteria | 7604 |
| 124 | Ga0466718_034280 | 3300042617 | Archaea | 4026 |
| 125 | Ga0466718_169854 | 3300042617 | Bacteria | 5490 |
| 126 | JGI24698J34947_10015694 | 3300002449 | Bacteria | 4120 |
| 127 | JGI24698J34947_10032027 | 3300002449 | Bacteria | 2763 |
| 128 | Ga0072941_1006513 | 3300005201 | Bacteria | 2511 |
| 129 | Ga0072941_1020631 | 3300005201 | Bacteria | 9782 |
| 130 | Ga0072941_1271783 | 3300005201 | Bacteria | 986 |
| 131 | Ga0466731_071156 | 3300042622 | Bacteria | 2352 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01784 | DUF34_NIF3 | Duf34/NIF3 (NGG1p interacting factor 3) | 13 | 238 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.