Protein Family IF07894

Metagenome Isolate
169 Members
34 Samples
165 Scaffolds
613.3 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_037272|Ga0466718_037272_2676_4751
Length
691 aa
Sequence
VFACGDKTKDNHADYRAENTYIYVYIIAPLMLRILSEAGGHFKKIQNCHNLAIITSYNCGMETAEEQGLQKRSFSIGGMYCVNCQNIIEKELKNTAGIKDAKVNYKTTAASVTYDTAITSFDKISAVIESLGYKTLEENSKNTVTQIIGTLVIILALFMLMRSFTTSKLAAAFPLAQEGMSYGMLLVIGLFTSVHCIAMCGGINLSQTLRKNGELGVGSGEQGKEKSTSTNTYSTLLPSFLYNGGRLVSYTAVGVLVGALGSVITLSGHFQGVVQLVAGVFMVIMGINMLGLFPSLRRFIPQMPAKLQEGLTSLFAKKIDGQKTGRGPLVVGFLNGFMPCGPLQAMQVYALSTGSPVRGGISMFLFCAGTIPLMFALGAVSSALSGTKGQAFSRHVMQIGAVLVAALGLVMFSSGWTLSGFANPLDKAAYLKPASAQTAGNAFIPVIQNGVQIVNSTLLPNRYPAITVQQGIPVRWIINAPPGSINGCNNRMIIREYGIQYTFKQGGNVIEFTPAKAGRFRYSCWMAMIHSTITVLAEGESVADVREPDTAPKPAGVEIPTDAVAIAQIADNAQTVTIRLTDDGFDPAIVVMQRRLPALWTITIDSIDPGNSSIIFPAYYAIMETGQGENQLQLVPRDDFEFYTADSIFYGYVKVVNDITRVNVEAVKEEAANFETLIYPQAYFDAAYGGY

📊 Sample Types

Isolate 2.4%
Metagenome 97.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 43.8%
Termitidae 28.1%
Unclassified 18.8%
Rhinotermitidae 6.2%
Termopsidae 3.1%

🌳 Taxonomy

Archaea 0
Bacteria 164
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
2 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
3 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
4 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
10 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
11 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
12 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
13 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
14 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
15 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
21 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
24 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
25 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
26 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
27 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
28 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
29 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
30 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
31 2820727601 Unclassified Cloacimonetes Nt197P3bin46 Isolate Unclassified
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466713_042258 3300042602 Bacteria 18185
2 Ga0466716_149094 3300042605 Bacteria 7326
3 Ga0466719_538625 3300042606 Bacteria 3437
4 Ga0466722_067692 3300042609 Bacteria 7988
5 AustNasuHG_c1001906 3300000089 Bacteria 7509
6 JGI24698J34947_10002406 3300002449 Bacteria 10071
7 JGI24698J34947_10005774 3300002449 Bacteria 6787
8 JGI24698J34947_10022817 3300002449 Bacteria 3351
9 JGI24698J34947_10023219 3300002449 Bacteria 3319
10 Ga0072940_1004397 3300005200 Bacteria 3229
11 Ga0072941_1023996 3300005201 Bacteria 18890
12 Ga0466703_086023 3300042636 Bacteria 4279
13 Ga0466704_109196 3300042643 Bacteria 4971
14 Ga0466712_023260 3300042614 Bacteria 5021
15 Ga0466712_079617 3300042614 Bacteria 3773
16 Ga0466712_160998 3300042614 Bacteria 9598
17 Ga0466711_068893 3300042615 Bacteria 5420
18 Ga0466711_087554 3300042615 Bacteria 4825
19 Ga0466718_009083 3300042617 Bacteria 13571
20 Ga0466718_061986 3300042617 Bacteria 2861
21 Ga0466718_076722 3300042617 Bacteria 5204
22 Ga0466718_146622 3300042617 Bacteria 2160
23 Ga0466723_038665 3300042618 Bacteria 29336
24 Ga0466728_319510 3300042620 Bacteria 10364
25 Ga0466691_104642 3300042593 Bacteria 3964
26 Ga0466696_090887 3300042596 Bacteria 7406
27 Ga0466699_044599 3300042597 Bacteria 15860
28 Ga0466719_148396 3300042606 Bacteria 8595
29 Ga0466719_152688 3300042606 Bacteria 2423
30 Ga0466720_135247 3300042607 Bacteria 17099
31 Ga0466722_181559 3300042609 Bacteria 13685
32 JGI24698J34947_10000779 3300002449 Bacteria 15815
33 JGI24698J34947_10025705 3300002449 Bacteria 3132
34 JGI24698J34947_10044720 3300002449 Bacteria 2264
35 Ga0466703_028727 3300042636 Bacteria 8419
36 Ga0466712_053999 3300042614 Bacteria 11777
37 Ga0466712_122592 3300042614 Bacteria 4432
38 Ga0466712_317150 3300042614 Unclassified 17236
39 Ga0466711_172387 3300042615 Bacteria 13096
40 Ga0466711_353133 3300042615 Bacteria 6253
41 Ga0466715_196957 3300042616 Bacteria 7264
42 Ga0466715_321699 3300042616 Bacteria 15126
43 Ga0466718_086031 3300042617 Bacteria 11178
44 Ga0264413_106601 3300024493 Bacteria 27928
45 Ga0466699_036090 3300042597 Bacteria 3764
46 Ga0466699_258954 3300042597 Bacteria 11627
47 Ga0466719_416536 3300042606 Bacteria 3777
48 Ga0466720_054034 3300042607 Bacteria 19093
49 JGI24698J34947_10009368 3300002449 Bacteria 5377
50 JGI24698J34947_10010137 3300002449 Unclassified 5164
51 JGI24698J34947_10018708 3300002449 Bacteria 3741
52 Ga0072941_1098620 3300005201 Bacteria 2637
53 Ga0466705_332606 3300042612 Bacteria 6087
54 Ga0466703_032152 3300042636 Bacteria 12033
55 Ga0466708_370005 3300042652 Bacteria 4577
56 Ga0466712_065504 3300042614 Bacteria 13077
57 Ga0466712_104880 3300042614 Bacteria 22225
58 Ga0466712_116358 3300042614 Bacteria 6793
59 Ga0466712_271950 3300042614 Bacteria 20534
60 Ga0466715_138077 3300042616 Bacteria 28303
61 Ga0466715_394631 3300042616 Bacteria 4086
62 Ga0466718_012692 3300042617 Bacteria 11382
63 Ga0466718_037272 3300042617 Bacteria 9825
64 Ga0466723_012081 3300042618 Bacteria 14979
65 Ga0466723_129920 3300042618 Bacteria 8113
66 Ga0466726_285300 3300042619 Bacteria 11106
67 Ga0466728_347710 3300042620 Bacteria 42490
68 Ga0466732_414195 3300042656 Bacteria 7038
69 Ga0466719_374911 3300042606 Bacteria 28594
70 Ga0466719_455820 3300042606 Bacteria 2893
71 Ga0466722_115318 3300042609 Bacteria 10822
72 AustNasuHG_c1000751 3300000089 Bacteria 11548
73 JGI24698J34947_10005585 3300002449 Bacteria 6900
74 JGI24698J34947_10008408 3300002449 Unclassified 5666
75 Ga0466703_143438 3300042636 Bacteria 5772
76 Ga0466704_191460 3300042643 Bacteria 34072
77 Ga0466709_335357 3300042648 Bacteria 5469
78 Ga0466708_167340 3300042652 Bacteria 11142
79 Ga0466712_111253 3300042614 Bacteria 12401
80 Ga0466711_202959 3300042615 Bacteria 30412
81 Ga0466715_345203 3300042616 Bacteria 7760
82 Ga0466718_036770 3300042617 Bacteria 4345
83 Ga0466718_037691 3300042617 Bacteria 4480
84 Ga0466723_067687 3300042618 Bacteria 2691
85 Ga0466690_036134 3300042590 Bacteria 12565
86 Ga0466699_240707 3300042597 Bacteria 23866
87 Ga0466699_430522 3300042597 Bacteria 4354
88 Ga0466732_015118 3300042656 Bacteria 10235
89 Ga0466732_023874 3300042656 Bacteria 9258
90 AustNasuHG_c1003739 3300000089 Bacteria 5488
91 JGI24698J34947_10002453 3300002449 Bacteria 9995
92 JGI24698J34947_10014868 3300002449 Bacteria 4239
93 JGI24698J34947_10023065 3300002449 Bacteria 3330
94 Ga0072941_1000967 3300005201 Bacteria 66192
95 Ga0466705_067474 3300042612 Bacteria 5445
96 Ga0466703_357153 3300042636 Bacteria 2628
97 Ga0466712_028563 3300042614 Bacteria 25335
98 Ga0466712_116817 3300042614 Bacteria 4965
99 Ga0466712_123870 3300042614 Bacteria 3499
100 Ga0466712_247226 3300042614 Bacteria 7840
101 Ga0466715_516407 3300042616 Bacteria 6436
102 Ga0466718_063315 3300042617 Bacteria 2992
103 Ga0466718_099906 3300042617 Bacteria 5330
104 Ga0466723_146995 3300042618 Bacteria 13213
105 Ga0466728_245942 3300042620 Bacteria 7142
106 Ga0466691_054012 3300042593 Bacteria 4338
107 Ga0466694_166767 3300042594 Bacteria 3133
108 Ga0466716_489603 3300042605 Bacteria 4389
109 Ga0466719_328459 3300042606 Bacteria 19533
110 Ga0466719_575206 3300042606 Bacteria 2174
111 JGI24698J34947_10000917 3300002449 Bacteria 14958
112 JGI24698J34947_10005680 3300002449 Bacteria 6839
113 Ga0072941_1011494 3300005201 Bacteria 16608
114 Ga0072941_1196351 3300005201 Bacteria 2680
115 Ga0466703_199435 3300042636 Bacteria 8606
116 Ga0466703_253997 3300042636 Bacteria 12715
117 Ga0466708_365429 3300042652 Bacteria 22126
118 Ga0466705_398946 3300042612 Bacteria 3277
119 Ga0466712_078299 3300042614 Bacteria 23319
120 Ga0466711_110592 3300042615 Bacteria 12346
121 Ga0466715_570575 3300042616 Bacteria 20092
122 Ga0466718_031919 3300042617 Bacteria 6787
123 Ga0466726_018611 3300042619 Bacteria 4600
124 Ga0466726_034944 3300042619 Bacteria 3282
125 Ga0466726_361805 3300042619 Bacteria 4724
126 Ga0264413_114001 3300024493 Bacteria 4022
127 Ga0466691_045640 3300042593 Bacteria 12384
128 Ga0466691_222207 3300042593 Bacteria 2835
129 Ga0466694_202227 3300042594 Bacteria 6112
130 Ga0466699_012857 3300042597 Bacteria 9542
131 Ga0466707_029176 3300042601 Bacteria 3193
132 Ga0466707_225544 3300042601 Bacteria 3967
133 AustNasuHG_c1000271 3300000089 Bacteria 17744
134 JGI24698J34947_10006692 3300002449 Bacteria 6328
135 JGI24698J34947_10012754 3300002449 Bacteria 4599
136 JGI24698J34947_10014654 3300002449 Bacteria 4270
137 Ga0072941_1038045 3300005201 Bacteria 9790
138 Ga0466705_160338 3300042612 Bacteria 5845
139 Ga0466712_002197 3300042614 Bacteria 12926
140 Ga0466712_070731 3300042614 Bacteria 4826
141 Ga0466712_170826 3300042614 Bacteria 11484
142 Ga0466712_182291 3300042614 Bacteria 19649
143 Ga0466718_023038 3300042617 Bacteria 7069
144 Ga0466718_029432 3300042617 Bacteria 6340
145 Ga0466723_003931 3300042618 Bacteria 68756
146 Ga0466723_163120 3300042618 Bacteria 30495
147 Ga0264413_116171 3300024493 Bacteria 2368
148 Ga0466692_109739 3300042591 Bacteria 3112
149 Ga0466691_108780 3300042593 Unclassified 3353
150 Ga0466720_044286 3300042607 Bacteria 6044
151 JGI24698J34947_10000008 3300002449 Bacteria 53028
152 JGI24698J34947_10006760 3300002449 Bacteria 6300
153 JGI24698J34947_10007028 3300002449 Unclassified 6187
154 JGI24698J34947_10022077 3300002449 Bacteria 3416
155 Ga0072941_1032238 3300005201 Bacteria 6016
156 Ga0466705_254645 3300042612 Bacteria 3746
157 Ga0466704_032707 3300042643 Bacteria 9282
158 Ga0466704_047359 3300042643 Bacteria 4746
159 Ga0466704_125342 3300042643 Bacteria 11447
160 Ga0466704_428240 3300042643 Bacteria 14598
161 Ga0466712_261145 3300042614 Bacteria 13881
162 Ga0466712_284237 3300042614 Bacteria 8418
163 Ga0466690_209720 3300042590 Bacteria 5606
164 Ga0466699_090719 3300042597 Bacteria 11658
165 Ga0466699_305929 3300042597 Bacteria 25158

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00403 HMA Heavy-metal-associated domain 74 134 0.98
PF13386 DsbD_2 Cytochrome C biogenesis protein transmembrane region 185 409 0.85
PF02683 DsbD Cytochrome C biogenesis protein transmembrane region 222 412 0.76

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00403 GO:0046872 metal ion binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.