Protein Family IF07890
Metagenome
Isolate
117
Members
51
Samples
106
Scaffolds
409.02
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_036284|Ga0466718_036284_1844_3256
- Length
- 470 aa
- Sequence
- VKKYNVTKTQNPAESRQQQNFCRLLGFRAILHSYVRLPLTLKTMEDILQAGPKMLKRTISGTILKTSSSWPVLFLTGPRQVGKSSVFQMIKEKGRKYVSLDSISVRNLAQSDPQAFLQKYSPPVVIDEVQYAPGLFPYIKIWVDERRFENKGGGRKSANPAGAFWLTGSQKFALMKGVKESLAGRIAIIDLLGFSYREISGKPEKSRPFRPDKIKAGKGAEKRTVPDVYRDIWNGSFPEFITNPSVGRDRFFSSYMQTYIERDVKDYQGTTNELKFYKFVRAVAVRTGNLINYDDLARDCDIDRRTAQKWMNTLQASALVYLLPPYSSNLTKRIVKTPKVYFLDTGLACFLAGIETPEVLEASYLSGSMLETYALCEILKGFWHNGKDTRNLFFYRDANKKEIDFVLERNMTLYPIEVKKTTSPLGTDCANFGIIDKLKKQSGKGAVICLCPDIMPVPKKNAVIVPVWEI
Sample Types
Isolate
9.4%
Metagenome
90.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.8%
Unclassified
24.5%
Kalotermitidae
22.4%
Termopsidae
8.2%
Rhinotermitidae
6.1%
Taxonomy
Archaea
0
Bacteria
92
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190889 | Unclassified Elusimicrobia Cu122P5_bin43 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 4 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 5 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 6 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 20 | 2820027804 | Unclassified Spirochaetes Lab288P1bin105 | Isolate | Unclassified |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 2891720358 | Azoarcus nasutitermitis CC-YHH838 | Isolate | Unclassified |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2820021908 | Unclassified Spirochaetes Lab288P4bin6 | Isolate | Unclassified |
| 28 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 34 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 35 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 36 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 37 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 38 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 39 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 40 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 41 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 42 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 43 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 44 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 45 | 2772190893 | Unclassified Elusimicrobia Nt197P4_bin29 | Isolate | Unclassified |
| 46 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 47 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 48 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 49 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 50 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 51 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_383378 | 3300042612 | Bacteria | 8066 |
| 2 | Ga0466715_303491 | 3300042616 | Unclassified | 3241 |
| 3 | Ga0466718_129984 | 3300042617 | Bacteria | 2200 |
| 4 | Ga0466726_006264 | 3300042619 | Bacteria | 1872 |
| 5 | Ga0466691_056704 | 3300042593 | Bacteria | 5109 |
| 6 | Ga0466696_501064 | 3300042596 | Bacteria | 4636 |
| 7 | Ga0123356_10505966 | 3300010049 | Unclassified | 1364 |
| 8 | Ga0123353_10657505 | 3300010167 | Unclassified | 1482 |
| 9 | Ga0466702_400696 | 3300042635 | Bacteria | 1795 |
| 10 | Ga0466709_158520 | 3300042648 | Bacteria | 3051 |
| 11 | Ga0466700_269669 | 3300042600 | Bacteria | 2096 |
| 12 | Ga0466720_042648 | 3300042607 | Bacteria | 13564 |
| 13 | Ga0466720_133130 | 3300042607 | Bacteria | 35831 |
| 14 | Ga0466711_018935 | 3300042615 | Bacteria | 46101 |
| 15 | Ga0466711_137470 | 3300042615 | Bacteria | 10732 |
| 16 | Ga0466723_352817 | 3300042618 | Bacteria | 8788 |
| 17 | Ga0466691_032585 | 3300042593 | Bacteria | 4730 |
| 18 | Ga0466691_045560 | 3300042593 | Unclassified | 15466 |
| 19 | Ga0123356_10000823 | 3300010049 | Bacteria | 34466 |
| 20 | Ga0123356_10176671 | 3300010049 | Bacteria | 2152 |
| 21 | Ga0123353_10440471 | 3300010167 | Unclassified | 1922 |
| 22 | Ga0123354_10174051 | 3300010882 | Bacteria | 2490 |
| 23 | AustNasuHG_c1001160 | 3300000089 | Bacteria | 9448 |
| 24 | Ga0072941_1042316 | 3300005201 | Unclassified | 3187 |
| 25 | Ga0072941_1042317 | 3300005201 | Unclassified | 6977 |
| 26 | Ga0466714_009599 | 3300042603 | Bacteria | 15556 |
| 27 | Ga0466711_428629 | 3300042615 | Bacteria | 7458 |
| 28 | Ga0466718_043045 | 3300042617 | Bacteria | 3871 |
| 29 | Ga0466726_088513 | 3300042619 | Bacteria | 2142 |
| 30 | Ga0466726_090896 | 3300042619 | Bacteria | 1479 |
| 31 | Ga0466726_341844 | 3300042619 | Unclassified | 2466 |
| 32 | Ga0264413_107582 | 3300024493 | Bacteria | 5830 |
| 33 | Ga0466691_152520 | 3300042593 | Bacteria | 2317 |
| 34 | Ga0466694_296078 | 3300042594 | Bacteria | 1777 |
| 35 | Ga0466699_283071 | 3300042597 | Bacteria | 5014 |
| 36 | Ga0466699_415454 | 3300042597 | Bacteria | 10214 |
| 37 | Ga0123353_10295963 | 3300010167 | Bacteria | 2474 |
| 38 | JGI24695J34938_10000377 | 3300002450 | Bacteria | 44279 |
| 39 | Ga0466727_255923 | 3300042655 | Bacteria | 3076 |
| 40 | Ga0466732_163218 | 3300042656 | Bacteria | 2753 |
| 41 | Ga0466705_517633 | 3300042612 | Bacteria | 1249 |
| 42 | Ga0466715_577676 | 3300042616 | Bacteria | 3868 |
| 43 | Ga0466728_080741 | 3300042620 | Bacteria | 5244 |
| 44 | Ga0466728_143316 | 3300042620 | Bacteria | 35676 |
| 45 | Ga0123356_10174488 | 3300010049 | Bacteria | 2164 |
| 46 | Ga0123356_10281452 | 3300010049 | Bacteria | 1758 |
| 47 | Ga0123356_10414461 | 3300010049 | Unclassified | 1487 |
| 48 | Ga0123353_10268080 | 3300010167 | Unclassified | 2633 |
| 49 | Ga0072941_1005136 | 3300005201 | Unclassified | 21528 |
| 50 | Ga0072941_1019395 | 3300005201 | Unclassified | 15899 |
| 51 | Ga0466727_047947 | 3300042655 | Unclassified | 1660 |
| 52 | Ga0466727_320106 | 3300042655 | Bacteria | 1781 |
| 53 | Ga0466716_544116 | 3300042605 | Bacteria | 2461 |
| 54 | Ga0466720_025606 | 3300042607 | Unclassified | 4061 |
| 55 | Ga0466712_233739 | 3300042614 | Bacteria | 4517 |
| 56 | Ga0466711_107067 | 3300042615 | Unclassified | 6240 |
| 57 | Ga0466718_036284 | 3300042617 | Bacteria | 4043 |
| 58 | Ga0466726_012690 | 3300042619 | Bacteria | 4829 |
| 59 | Ga0072941_1039966 | 3300005201 | Bacteria | 3432 |
| 60 | Ga0466731_252923 | 3300042622 | Bacteria | 2869 |
| 61 | Ga0466722_175564 | 3300042609 | Bacteria | 1728 |
| 62 | Ga0466705_130408 | 3300042612 | Bacteria | 10466 |
| 63 | Ga0466726_267261 | 3300042619 | Bacteria | 8369 |
| 64 | Ga0466692_009994 | 3300042591 | Bacteria | 2255 |
| 65 | Ga0466699_025006 | 3300042597 | Bacteria | 2360 |
| 66 | Ga0123353_10102514 | 3300010167 | Bacteria | 4613 |
| 67 | Ga0123353_10563830 | 3300010167 | Unclassified | 1639 |
| 68 | Ga0123354_10021507 | 3300010882 | Bacteria | 10166 |
| 69 | JGI24698J34947_10064379 | 3300002449 | Bacteria | 1792 |
| 70 | JGI24702J35022_10001061 | 3300002462 | Bacteria | 17186 |
| 71 | JGI24705J35276_12238756 | 3300002504 | Bacteria | 52543 |
| 72 | Ga0072941_1008198 | 3300005201 | Bacteria | 11454 |
| 73 | Ga0072941_1042281 | 3300005201 | Unclassified | 1504 |
| 74 | Ga0466731_062942 | 3300042622 | Bacteria | 4802 |
| 75 | Ga0466702_208661 | 3300042635 | Bacteria | 23441 |
| 76 | Ga0466703_139458 | 3300042636 | Unclassified | 6479 |
| 77 | Ga0466700_349000 | 3300042600 | Unclassified | 2207 |
| 78 | Ga0466707_126540 | 3300042601 | Unclassified | 1490 |
| 79 | Ga0466720_212218 | 3300042607 | Bacteria | 2335 |
| 80 | Ga0466711_243704 | 3300042615 | Bacteria | 2179 |
| 81 | Ga0466728_122728 | 3300042620 | Bacteria | 32353 |
| 82 | Ga0466729_125329 | 3300042621 | Bacteria | 2362 |
| 83 | Ga0466691_156898 | 3300042593 | Bacteria | 4259 |
| 84 | Ga0466699_050645 | 3300042597 | Bacteria | 1289 |
| 85 | Ga0466699_248791 | 3300042597 | Bacteria | 2261 |
| 86 | Ga0123353_10718302 | 3300010167 | Unclassified | 1398 |
| 87 | JGI24698J34947_10060359 | 3300002449 | Bacteria | 1871 |
| 88 | Ga0068302_10259358 | 3300005071 | Bacteria | 1706 |
| 89 | Ga0466735_027849 | 3300042624 | Bacteria | 1276 |
| 90 | Ga0466708_362352 | 3300042652 | Bacteria | 1837 |
| 91 | Ga0466713_122022 | 3300042602 | Bacteria | 7932 |
| 92 | Ga0466720_088516 | 3300042607 | Unclassified | 4131 |
| 93 | Ga0466733_179596 | 3300042659 | Bacteria | 3808 |
| 94 | Ga0466692_171693 | 3300042591 | Bacteria | 4941 |
| 95 | Ga0466694_349008 | 3300042594 | Bacteria | 2461 |
| 96 | Ga0466699_216802 | 3300042597 | Bacteria | 4869 |
| 97 | Ga0123356_10428445 | 3300010049 | Unclassified | 1467 |
| 98 | Ga0123353_10414067 | 3300010167 | Unclassified | 2000 |
| 99 | JGI24702J35022_10084153 | 3300002462 | Bacteria | 1726 |
| 100 | Ga0466702_315696 | 3300042635 | Bacteria | 6486 |
| 101 | Ga0466703_084334 | 3300042636 | Bacteria | 3063 |
| 102 | Ga0466703_102774 | 3300042636 | Bacteria | 1921 |
| 103 | Ga0466703_173194 | 3300042636 | Bacteria | 33174 |
| 104 | Ga0466716_161081 | 3300042605 | Unclassified | 7481 |
| 105 | Ga0466716_393102 | 3300042605 | Bacteria | 1655 |
| 106 | Ga0466716_466717 | 3300042605 | Bacteria | 4109 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.