Protein Family IF07875

Metagenome Isolate
153 Members
46 Samples
140 Scaffolds
339.84 Avg Length

🧬 Representative Sequence

ID
3300042617|Ga0466718_016287|Ga0466718_016287_1108_2208
Length
366 aa
Sequence
MPRINTAFISFIWNEEDNKKGSNGVVMIYVFTKKEASLKTAFPKNVTFVDTPLSKHSLENADITYFDVSGYSEEEVKKALAQLNKICKDTPWGIIDPKGSVKDIATLFFEGACDYLGTGVLKDAKGIDPKHFKEAVKWRKISPVASASADDEKAEVSSGTGFLKSGIKLPAAKSFPGWNKLTTGKDMPFYLLYCSLQGKTALDARLNDKTLNQIHKRFLSLLSGYMQAGDGLLWMNTGRDCLFLFPPRAKCAEAAIKACLGMIVSAPLFVLETFGISIPANFIFAMHYGTVTYKPPGKTGTVVSDAVNSIFHLGAKKSEPGRLTISGELPDVSVPASLQDLFVPAGEYEGRRIWQTKKFSYAKPWY

📊 Sample Types

Isolate 8.5%
Metagenome 91.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.7%
Unclassified 29.5%
Kalotermitidae 18.2%
Termopsidae 4.5%

🌳 Taxonomy

Archaea 2
Bacteria 146
Eukaryota 0
Viruses 0
Unclassified 5

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
2 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
3 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
4 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
5 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
6 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
7 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
8 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
9 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
10 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
11 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
12 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
13 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
14 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
15 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
16 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
17 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
22 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
23 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
24 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
25 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
26 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
27 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
28 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
29 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
30 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
31 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
32 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
33 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
34 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
35 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
36 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
37 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
38 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
39 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
40 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
41 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
42 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
43 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
44 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
45 2772190978 Treponema sp. Nt197P3bin57 Isolate Unclassified
46 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_407284 3300042656 Bacteria 22255
2 Ga0123356_10000240 3300010049 Bacteria 63107
3 Ga0466700_043360 3300042600 Bacteria 4685
4 Ga0466716_207710 3300042605 Bacteria 35454
5 Ga0466720_043219 3300042607 Bacteria 8125
6 Ga0466712_280640 3300042614 Bacteria 2638
7 Ga0466718_070963 3300042617 Bacteria 10432
8 Ga0466702_415365 3300042635 Bacteria 19600
9 Ga0466709_226253 3300042648 Bacteria 24834
10 Ga0466708_335073 3300042652 Bacteria 7083
11 JGI24695J34938_10024042 3300002450 Bacteria 2929
12 Ga0072941_1007974 3300005201 Bacteria 5852
13 Ga0415639_032832 3300038395 Bacteria 7664
14 Ga0415639_154895 3300038395 Bacteria 1998
15 Ga0123356_10424709 3300010049 Bacteria 1472
16 Ga0123356_10612957 3300010049 Bacteria 1254
17 Ga0123353_10460876 3300010167 Bacteria 1868
18 Ga0466712_060044 3300042614 Bacteria 4621
19 Ga0466715_095402 3300042616 Bacteria 8034
20 Ga0466726_451171 3300042619 Bacteria 3725
21 Ga0466731_315775 3300042622 Bacteria 2452
22 Ga0466704_166784 3300042643 Bacteria 45771
23 Ga0072941_1067025 3300005201 Bacteria 7289
24 Ga0264413_110518 3300024493 Bacteria 5632
25 Ga0264413_127073 3300024493 Bacteria 2654
26 Ga0264413_128698 3300024493 Bacteria 3302
27 Ga0264413_131327 3300024493 Bacteria 1786
28 Ga0264413_133425 3300024493 Bacteria 3048
29 Ga0466693_450025 3300042592 Bacteria 2462
30 Ga0466699_152209 3300042597 Bacteria 14022
31 Ga0466733_009483 3300042659 Bacteria 1411
32 Ga0466720_064984 3300042607 Bacteria 5504
33 Ga0466712_002651 3300042614 Bacteria 15034
34 Ga0466712_171176 3300042614 Bacteria 4865
35 Ga0466718_044779 3300042617 Bacteria 7918
36 Ga0466702_057905 3300042635 Bacteria 2686
37 JGI24695J34938_10002368 3300002450 Bacteria 14506
38 Ga0264413_127072 3300024493 Bacteria 2073
39 Ga0415639_199950 3300038395 Bacteria 1232
40 Ga0123356_10000102 3300010049 Bacteria 90045
41 Ga0123356_10000999 3300010049 Bacteria 31384
42 Ga0123356_10013015 3300010049 Unclassified 8048
43 Ga0123356_10024119 3300010049 Bacteria 5725
44 Ga0123356_10206801 3300010049 Bacteria 2007
45 Ga0466721_087343 3300042608 Bacteria 13602
46 Ga0466721_289618 3300042608 Bacteria 2158
47 Ga0466705_439633 3300042612 Bacteria 8761
48 Ga0466712_310455 3300042614 Unclassified 1203
49 Ga0466718_015093 3300042617 Bacteria 5239
50 Ga0466702_126167 3300042635 Bacteria 5276
51 AustNasuHG_c1007144 3300000089 Archaea 3980
52 JGI24698J34947_10009760 3300002449 Bacteria 5263
53 JGI24698J34947_10020474 3300002449 Bacteria 3561
54 JGI24695J34938_10002040 3300002450 Bacteria 15951
55 JGI24695J34938_10002677 3300002450 Bacteria 13274
56 JGI24695J34938_10003919 3300002450 Bacteria 10062
57 JGI24695J34938_10030157 3300002450 Bacteria 2528
58 Ga0072940_1024030 3300005200 Bacteria 10791
59 Ga0466694_045117 3300042594 Bacteria 5596
60 Ga0466694_095661 3300042594 Bacteria 3000
61 Ga0466699_227845 3300042597 Bacteria 18629
62 Ga0123356_10015227 3300010049 Bacteria 7373
63 Ga0123356_10044984 3300010049 Bacteria 4108
64 Ga0123356_10178023 3300010049 Bacteria 2145
65 Ga0123356_10218911 3300010049 Bacteria 1959
66 Ga0123356_10450816 3300010049 Bacteria 1435
67 Ga0123353_10201688 3300010167 Bacteria 3129
68 Ga0466717_296235 3300042604 Bacteria 2179
69 Ga0466719_051990 3300042606 Bacteria 42283
70 Ga0466712_059188 3300042614 Bacteria 5010
71 Ga0466712_119671 3300042614 Bacteria 15965
72 Ga0466715_007374 3300042616 Bacteria 12368
73 Ga0466718_011645 3300042617 Bacteria 3263
74 Ga0466731_170371 3300042622 Bacteria 1329
75 Ga0466731_419892 3300042622 Bacteria 1364
76 Ga0466708_124302 3300042652 Bacteria 47506
77 JGI24695J34938_10010094 3300002450 Bacteria 5203
78 Ga0072940_1418002 3300005200 Bacteria 1679
79 Ga0072941_1008834 3300005201 Bacteria 7753
80 Ga0072941_1016667 3300005201 Bacteria 11107
81 Ga0264413_113074 3300024493 Archaea 7624
82 Ga0264413_120597 3300024493 Bacteria 3792
83 Ga0466733_175355 3300042659 Bacteria 20912
84 Ga0123356_10014570 3300010049 Bacteria 7558
85 Ga0123356_10019178 3300010049 Unclassified 6486
86 Ga0123356_10021193 3300010049 Bacteria 6139
87 Ga0123356_10053373 3300010049 Bacteria 3762
88 Ga0466726_241954 3300042619 Bacteria 2906
89 Ga0466731_437326 3300042622 Bacteria 2388
90 Ga0466702_296588 3300042635 Bacteria 5085
91 Ga0466727_198863 3300042655 Bacteria 8105
92 JGI24698J34947_10000352 3300002449 Bacteria 20514
93 JGI24695J34938_10001098 3300002450 Bacteria 24415
94 JGI24695J34938_10001481 3300002450 Bacteria 19834
95 Ga0072941_1053589 3300005201 Bacteria 3140
96 Ga0415639_061066 3300038395 Bacteria 3393
97 Ga0466733_114657 3300042659 Bacteria 22708
98 Ga0123353_10335111 3300010167 Bacteria 2288
99 Ga0466718_016287 3300042617 Bacteria 3299
100 Ga0466718_110434 3300042617 Bacteria 9377
101 Ga0466718_160492 3300042617 Bacteria 3999
102 Ga0466723_176432 3300042618 Bacteria 37319
103 Ga0466727_274708 3300042655 Bacteria 1903
104 Ga0466727_304150 3300042655 Bacteria 11087
105 JGI24698J34947_10006729 3300002449 Bacteria 6313
106 JGI24698J34947_10024081 3300002449 Bacteria 3252
107 JGI24698J34947_10029337 3300002449 Bacteria 2906
108 JGI24695J34938_10008288 3300002450 Bacteria 5941
109 JGI24695J34938_10018975 3300002450 Bacteria 3420
110 JGI24695J34938_10020249 3300002450 Bacteria 3278
111 Ga0072941_1106600 3300005201 Bacteria 4254
112 Ga0072941_1159448 3300005201 Bacteria 2968
113 Ga0415639_007124 3300038395 Bacteria 6666
114 Ga0415639_034945 3300038395 Bacteria 3743
115 Ga0415639_035777 3300038395 Bacteria 15994
116 Ga0415639_252203 3300038395 Bacteria 1232
117 Ga0466733_104316 3300042659 Bacteria 1498
118 Ga0123356_10005439 3300010049 Bacteria 12958
119 Ga0123356_10026619 3300010049 Bacteria 5426
120 Ga0466720_016728 3300042607 Bacteria 5236
121 Ga0466720_073699 3300042607 Bacteria 3179
122 Ga0466698_462701 3300042610 Bacteria 1408
123 Ga0466712_154730 3300042614 Bacteria 5910
124 Ga0466712_304371 3300042614 Bacteria 12622
125 Ga0466718_042865 3300042617 Bacteria 9261
126 Ga0466731_232196 3300042622 Bacteria 5811
127 Ga0466731_339199 3300042622 Bacteria 43843
128 Ga0466702_258393 3300042635 Bacteria 2717
129 JGI24698J34947_10015969 3300002449 Bacteria 4083
130 JGI24698J34947_10016355 3300002449 Bacteria 4026
131 JGI24698J34947_10021512 3300002449 Bacteria 3468
132 JGI24698J34947_10028758 3300002449 Bacteria 2941
133 JGI24695J34938_10004904 3300002450 Unclassified 8563
134 JGI24695J34938_10012805 3300002450 Bacteria 4431
135 JGI24695J34938_10013475 3300002450 Bacteria 4291
136 Ga0072941_1053590 3300005201 Bacteria 3235
137 Ga0072941_1128782 3300005201 Unclassified 3950
138 Ga0264413_124686 3300024493 Bacteria 14459
139 Ga0264413_155078 3300024493 Bacteria 1810
140 Ga0466699_210705 3300042597 Bacteria 11283

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.