Protein Family IF07784
Metagenome
Isolate
127
Members
34
Samples
126
Scaffolds
237.83
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_404525|Ga0466715_404525_15388_16125
- Length
- 245 aa
- Sequence
- MRRKRTLAIILTVLALTLYALPAAADSLPEWFLPLRDAIYEQNLSADEVAGLYFSAKEKAGSELSGADLLVMISRIEYMMGRAYHYEERKREAIARYEAGMAAAEAALKERDSAEGWQMLAENLSQNCTVHAASYAIAHGLNVEKYAKKALAKDQRNTASLFMLAARWVYAPSPFNNIKRGIQMMKDIITNYESEMPPDDLFNVYSSIGYGYLQQKKKADARVWFQKSLEIYPTNKYIRGLYEKI
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
43.8%
Termitidae
37.5%
Rhinotermitidae
9.4%
Termopsidae
6.2%
Unclassified
3.1%
Taxonomy
Archaea
0
Bacteria
122
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 10 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 11 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 21 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 22 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_100883 | 3300024493 | Bacteria | 42424 |
| 2 | Ga0264413_115353 | 3300024493 | Bacteria | 6815 |
| 3 | Ga0466692_111303 | 3300042591 | Bacteria | 1251 |
| 4 | Ga0466694_219953 | 3300042594 | Bacteria | 2105 |
| 5 | Ga0466694_336800 | 3300042594 | Bacteria | 8829 |
| 6 | AustNasuHG_c1001937 | 3300000089 | Bacteria | 7456 |
| 7 | JGI24698J34947_10104402 | 3300002449 | Bacteria | 1266 |
| 8 | Ga0072941_1040161 | 3300005201 | Bacteria | 8770 |
| 9 | Ga0466702_403087 | 3300042635 | Bacteria | 2931 |
| 10 | Ga0466703_128497 | 3300042636 | Bacteria | 1771 |
| 11 | Ga0466704_223677 | 3300042643 | Bacteria | 60624 |
| 12 | Ga0466712_076054 | 3300042614 | Bacteria | 15237 |
| 13 | Ga0466712_279128 | 3300042614 | Bacteria | 7550 |
| 14 | Ga0466723_097562 | 3300042618 | Bacteria | 6134 |
| 15 | Ga0466723_193953 | 3300042618 | Bacteria | 4702 |
| 16 | Ga0466726_051692 | 3300042619 | Unclassified | 1436 |
| 17 | Ga0466690_431940 | 3300042590 | Bacteria | 4225 |
| 18 | Ga0466692_094408 | 3300042591 | Bacteria | 6328 |
| 19 | Ga0466691_142039 | 3300042593 | Bacteria | 7903 |
| 20 | Ga0466691_188243 | 3300042593 | Bacteria | 2027 |
| 21 | Ga0466691_219934 | 3300042593 | Bacteria | 9518 |
| 22 | Ga0466694_076450 | 3300042594 | Bacteria | 26319 |
| 23 | JGI24698J34947_10001435 | 3300002449 | Bacteria | 12537 |
| 24 | JGI24698J34947_10057402 | 3300002449 | Bacteria | 1931 |
| 25 | Ga0072941_1040268 | 3300005201 | Bacteria | 13976 |
| 26 | Ga0466709_250988 | 3300042648 | Bacteria | 4652 |
| 27 | Ga0466712_051021 | 3300042614 | Bacteria | 19499 |
| 28 | Ga0466715_001364 | 3300042616 | Bacteria | 11977 |
| 29 | Ga0466718_116480 | 3300042617 | Bacteria | 1314 |
| 30 | Ga0466728_190985 | 3300042620 | Bacteria | 1999 |
| 31 | Ga0466700_413577 | 3300042600 | Bacteria | 1188 |
| 32 | Ga0466719_576166 | 3300042606 | Bacteria | 2922 |
| 33 | Ga0466690_311247 | 3300042590 | Bacteria | 8108 |
| 34 | Ga0466690_405156 | 3300042590 | Bacteria | 1737 |
| 35 | Ga0466696_263273 | 3300042596 | Bacteria | 3255 |
| 36 | JGI24698J34947_10001342 | 3300002449 | Bacteria | 12947 |
| 37 | JGI24698J34947_10026637 | 3300002449 | Bacteria | 3071 |
| 38 | JGI24698J34947_10131621 | 3300002449 | Bacteria | 1068 |
| 39 | JGI24695J34938_10000245 | 3300002450 | Bacteria | 52223 |
| 40 | Ga0072941_1018320 | 3300005201 | Bacteria | 6689 |
| 41 | Ga0072941_1101584 | 3300005201 | Bacteria | 2975 |
| 42 | Ga0466705_318573 | 3300042612 | Bacteria | 8813 |
| 43 | Ga0466729_246872 | 3300042621 | Bacteria | 1103 |
| 44 | Ga0466702_464647 | 3300042635 | Bacteria | 7935 |
| 45 | Ga0466704_043646 | 3300042643 | Bacteria | 7206 |
| 46 | Ga0466727_039206 | 3300042655 | Bacteria | 2962 |
| 47 | Ga0466711_206332 | 3300042615 | Bacteria | 3854 |
| 48 | Ga0466723_022703 | 3300042618 | Bacteria | 9894 |
| 49 | Ga0466716_339806 | 3300042605 | Bacteria | 2184 |
| 50 | Ga0466719_063700 | 3300042606 | Bacteria | 1100 |
| 51 | AustNasuHG_c1011658 | 3300000089 | Bacteria | 3044 |
| 52 | JGI24695J34938_10014243 | 3300002450 | Bacteria | 4133 |
| 53 | Ga0072941_1009359 | 3300005201 | Bacteria | 34397 |
| 54 | Ga0072941_1018319 | 3300005201 | Bacteria | 8459 |
| 55 | Ga0072941_1264741 | 3300005201 | Bacteria | 1984 |
| 56 | Ga0466703_066674 | 3300042636 | Bacteria | 13204 |
| 57 | Ga0466704_454845 | 3300042643 | Bacteria | 60212 |
| 58 | Ga0466709_206049 | 3300042648 | Bacteria | 2824 |
| 59 | Ga0466727_339125 | 3300042655 | Bacteria | 1006 |
| 60 | Ga0466712_017336 | 3300042614 | Bacteria | 30893 |
| 61 | Ga0466712_082916 | 3300042614 | Bacteria | 3004 |
| 62 | Ga0466718_072832 | 3300042617 | Bacteria | 7534 |
| 63 | Ga0466723_207332 | 3300042618 | Bacteria | 6867 |
| 64 | Ga0466722_084381 | 3300042609 | Bacteria | 43243 |
| 65 | Ga0466691_201062 | 3300042593 | Bacteria | 4137 |
| 66 | AustNasuHG_c1000597 | 3300000089 | Bacteria | 12761 |
| 67 | JGI24698J34947_10120836 | 3300002449 | Bacteria | 1137 |
| 68 | Ga0466705_231556 | 3300042612 | Bacteria | 2205 |
| 69 | Ga0466704_239055 | 3300042643 | Bacteria | 21412 |
| 70 | Ga0466727_260199 | 3300042655 | Bacteria | 2271 |
| 71 | Ga0466712_095931 | 3300042614 | Bacteria | 14319 |
| 72 | Ga0466718_028272 | 3300042617 | Bacteria | 11992 |
| 73 | Ga0466718_045028 | 3300042617 | Bacteria | 5753 |
| 74 | Ga0466723_013092 | 3300042618 | Unclassified | 2523 |
| 75 | Ga0466690_327377 | 3300042590 | Bacteria | 2624 |
| 76 | Ga0466694_233778 | 3300042594 | Bacteria | 2503 |
| 77 | AustNasuHG_c1022746 | 3300000089 | Bacteria | 2010 |
| 78 | Ga0466702_345410 | 3300042635 | Bacteria | 1920 |
| 79 | Ga0466704_347189 | 3300042643 | Bacteria | 2333 |
| 80 | Ga0466709_054012 | 3300042648 | Bacteria | 6198 |
| 81 | Ga0466708_031299 | 3300042652 | Bacteria | 8597 |
| 82 | Ga0466708_068696 | 3300042652 | Bacteria | 1881 |
| 83 | Ga0466727_295671 | 3300042655 | Bacteria | 4031 |
| 84 | Ga0466718_023747 | 3300042617 | Bacteria | 4288 |
| 85 | Ga0466728_049195 | 3300042620 | Bacteria | 9925 |
| 86 | Ga0466716_332117 | 3300042605 | Bacteria | 1503 |
| 87 | Ga0466722_111218 | 3300042609 | Bacteria | 4177 |
| 88 | Ga0466722_125408 | 3300042609 | Bacteria | 1087 |
| 89 | Ga0466722_159721 | 3300042609 | Bacteria | 4539 |
| 90 | Ga0466693_186633 | 3300042592 | Bacteria | 79738 |
| 91 | AustNasuHG_c1017577 | 3300000089 | Bacteria | 2376 |
| 92 | AustNasuHG_c1021865 | 3300000089 | Bacteria | 2063 |
| 93 | JGI24698J34947_10009653 | 3300002449 | Bacteria | 5289 |
| 94 | JGI24698J34947_10011838 | 3300002449 | Unclassified | 4791 |
| 95 | JGI24698J34947_10064591 | 3300002449 | Bacteria | 1788 |
| 96 | Ga0072941_1152395 | 3300005201 | Bacteria | 2008 |
| 97 | Ga0466705_040997 | 3300042612 | Bacteria | 13230 |
| 98 | Ga0466703_046630 | 3300042636 | Bacteria | 3764 |
| 99 | Ga0466709_308706 | 3300042648 | Bacteria | 9036 |
| 100 | Ga0466708_296757 | 3300042652 | Bacteria | 8156 |
| 101 | Ga0466711_354854 | 3300042615 | Bacteria | 1833 |
| 102 | Ga0466715_404525 | 3300042616 | Bacteria | 27009 |
| 103 | Ga0466732_019937 | 3300042656 | Bacteria | 24454 |
| 104 | Ga0466716_212902 | 3300042605 | Bacteria | 2392 |
| 105 | Ga0466719_162124 | 3300042606 | Bacteria | 9382 |
| 106 | Ga0466722_082880 | 3300042609 | Bacteria | 2736 |
| 107 | Ga0466722_158175 | 3300042609 | Bacteria | 1485 |
| 108 | Ga0123356_10020062 | 3300010049 | Bacteria | 6330 |
| 109 | Ga0466694_008592 | 3300042594 | Bacteria | 11846 |
| 110 | Ga0466694_262738 | 3300042594 | Unclassified | 1907 |
| 111 | Ga0466695_218661 | 3300042595 | Bacteria | 43087 |
| 112 | AustNasuHG_c1028067 | 3300000089 | Bacteria | 1694 |
| 113 | JGI24698J34947_10001772 | 3300002449 | Bacteria | 11509 |
| 114 | JGI24698J34947_10090617 | 3300002449 | Bacteria | 1404 |
| 115 | Ga0072941_1086853 | 3300005201 | Bacteria | 2245 |
| 116 | Ga0072941_1302314 | 3300005201 | Bacteria | 3022 |
| 117 | Ga0466705_249636 | 3300042612 | Bacteria | 42301 |
| 118 | Ga0466703_222945 | 3300042636 | Bacteria | 19313 |
| 119 | Ga0466709_141905 | 3300042648 | Bacteria | 8632 |
| 120 | Ga0466709_395365 | 3300042648 | Bacteria | 14172 |
| 121 | Ga0466708_108893 | 3300042652 | Bacteria | 3427 |
| 122 | Ga0466712_058559 | 3300042614 | Bacteria | 28216 |
| 123 | Ga0466712_077919 | 3300042614 | Bacteria | 28252 |
| 124 | Ga0466718_167542 | 3300042617 | Bacteria | 1142 |
| 125 | Ga0466723_306152 | 3300042618 | Unclassified | 2328 |
| 126 | Ga0466728_137540 | 3300042620 | Bacteria | 3099 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.