Protein Family IF07701
Metagenome
Isolate
117
Members
41
Samples
114
Scaffolds
426.42
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_204293|Ga0466715_204293_36521_37957
- Length
- 478 aa
- Sequence
- MKKMRFQKEYTAHGMILRIEFRVKRFKNSKTQRFSTGALRVLMNRFIPRSVCLARLRTVAAMFCLCVAPVLAQTDFDTYFEAKSLRVDFALSGNTFTQSAALQQLREEPVWGGPVKNLTDTFGYGGYYIRAFDGETGNLIYSRGFNTLFEEWRTTDQAKTETQSWTNSISVPYPKKAIVLELLARDRASNLFSPLMRLDVDPESIYIDRSPLKDLTAEKIHYRGDPAGKVDLVFVPEGYTAAEMDKFGKDAARFARALFETPPYDTRQDDFNIWAVRLPSEESGVDISGKDIFKNTALNAGFYTFGIERYLTTADMKSIRDAVWNVPCDAIFVLVNSEIYGGGGMYNFYAVGTADNPRTIRVFVHELGHSFAGLADEYFQSEVAYNDFYNLELEPWEPNITTLVDFASKWQDMLSPGTPVPTPAEAPYIDGTGVFEGGGYVAKGIYRPVDHCTMRDMAPFCPVCRRAILRMIDFVADK
Sample Types
Isolate
2.6%
Metagenome
97.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
35.0%
Unclassified
12.5%
Termopsidae
10.0%
Rhinotermitidae
5.0%
Blattidae
2.5%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 2820783511 | Unclassified Bacteroidetes Emb289P3bin108 | Isolate | Unclassified |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 23 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 30 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 31 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 32 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 35 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_252899 | 3300042612 | Bacteria | 28436 |
| 2 | Ga0466719_071014 | 3300042606 | Bacteria | 1625 |
| 3 | Ga0466719_287942 | 3300042606 | Bacteria | 8684 |
| 4 | Ga0466721_137594 | 3300042608 | Bacteria | 9641 |
| 5 | Ga0466704_226341 | 3300042643 | Bacteria | 22338 |
| 6 | Ga0466709_005524 | 3300042648 | Bacteria | 140810 |
| 7 | Ga0466709_203956 | 3300042648 | Bacteria | 13286 |
| 8 | Ga0466725_364926 | 3300042654 | Bacteria | 15487 |
| 9 | Ga0466727_168552 | 3300042655 | Bacteria | 7401 |
| 10 | Ga0466723_042738 | 3300042618 | Bacteria | 46355 |
| 11 | Ga0466726_126983 | 3300042619 | Unclassified | 4447 |
| 12 | Ga0123356_10180296 | 3300010049 | Bacteria | 2133 |
| 13 | Ga0123353_10024733 | 3300010167 | Bacteria | 9126 |
| 14 | Ga0123353_10525625 | 3300010167 | Bacteria | 1715 |
| 15 | Ga0466690_064225 | 3300042590 | Bacteria | 9899 |
| 16 | Ga0068305_10035606 | 3300005083 | Bacteria | 5810 |
| 17 | Ga0068305_10046159 | 3300005083 | Unclassified | 8739 |
| 18 | Ga0466705_314339 | 3300042612 | Bacteria | 10220 |
| 19 | Ga0466733_203606 | 3300042659 | Bacteria | 45615 |
| 20 | Ga0466707_241599 | 3300042601 | Bacteria | 7102 |
| 21 | Ga0466703_158975 | 3300042636 | Bacteria | 6080 |
| 22 | Ga0466703_359076 | 3300042636 | Bacteria | 3843 |
| 23 | Ga0466704_360893 | 3300042643 | Bacteria | 8881 |
| 24 | Ga0466704_539994 | 3300042643 | Bacteria | 2638 |
| 25 | Ga0466727_101001 | 3300042655 | Bacteria | 12270 |
| 26 | Ga0466711_271880 | 3300042615 | Bacteria | 44119 |
| 27 | Ga0466726_462438 | 3300042619 | Bacteria | 1952 |
| 28 | Ga0123356_10002201 | 3300010049 | Bacteria | 20980 |
| 29 | Ga0123356_10004762 | 3300010049 | Bacteria | 13963 |
| 30 | Ga0466690_164485 | 3300042590 | Bacteria | 6673 |
| 31 | Ga0466692_203219 | 3300042591 | Bacteria | 12694 |
| 32 | Ga0466691_139689 | 3300042593 | Bacteria | 10329 |
| 33 | Ga0466701_009508 | 3300042598 | Bacteria | 8398 |
| 34 | JGI24702J35022_10001450 | 3300002462 | Bacteria | 14757 |
| 35 | JGI24702J35022_10019421 | 3300002462 | Bacteria | 3695 |
| 36 | JGI24696J40584_12959428 | 3300002834 | Bacteria | 5112 |
| 37 | Ga0068302_10116145 | 3300005071 | Unclassified | 2389 |
| 38 | Ga0072941_1257313 | 3300005201 | Bacteria | 1458 |
| 39 | Ga0466705_024738 | 3300042612 | Bacteria | 3160 |
| 40 | Ga0466716_353124 | 3300042605 | Bacteria | 11196 |
| 41 | Ga0466703_088847 | 3300042636 | Unclassified | 1948 |
| 42 | Ga0466703_355333 | 3300042636 | Bacteria | 21860 |
| 43 | Ga0466715_020762 | 3300042616 | Bacteria | 43125 |
| 44 | Ga0466723_346543 | 3300042618 | Bacteria | 25857 |
| 45 | Ga0466728_033548 | 3300042620 | Bacteria | 22918 |
| 46 | Ga0466690_240583 | 3300042590 | Bacteria | 1732 |
| 47 | Ga0466696_112512 | 3300042596 | Bacteria | 1991 |
| 48 | Ga0466716_444952 | 3300042605 | Bacteria | 2678 |
| 49 | Ga0466722_112533 | 3300042609 | Bacteria | 4391 |
| 50 | Ga0466731_200613 | 3300042622 | Bacteria | 2326 |
| 51 | Ga0466704_447782 | 3300042643 | Bacteria | 55110 |
| 52 | Ga0466709_053672 | 3300042648 | Bacteria | 5586 |
| 53 | Ga0466711_041848 | 3300042615 | Bacteria | 64215 |
| 54 | Ga0466723_053892 | 3300042618 | Bacteria | 17524 |
| 55 | Ga0466726_124574 | 3300042619 | Bacteria | 4365 |
| 56 | Ga0466728_190351 | 3300042620 | Unclassified | 1456 |
| 57 | Ga0466728_262920 | 3300042620 | Bacteria | 3054 |
| 58 | Ga0123353_10012947 | 3300010167 | Bacteria | 11911 |
| 59 | Ga0123353_10532251 | 3300010167 | Bacteria | 1701 |
| 60 | Ga0466690_283372 | 3300042590 | Bacteria | 11763 |
| 61 | Ga0466692_022629 | 3300042591 | Bacteria | 1521 |
| 62 | Ga0466733_018444 | 3300042659 | Bacteria | 3365 |
| 63 | Ga0466713_048475 | 3300042602 | Bacteria | 59892 |
| 64 | Ga0466713_084245 | 3300042602 | Bacteria | 6386 |
| 65 | Ga0466719_295296 | 3300042606 | Bacteria | 15392 |
| 66 | Ga0466704_150481 | 3300042643 | Bacteria | 22214 |
| 67 | Ga0466708_032710 | 3300042652 | Bacteria | 29431 |
| 68 | Ga0466711_165120 | 3300042615 | Bacteria | 29551 |
| 69 | Ga0466715_634006 | 3300042616 | Bacteria | 8502 |
| 70 | Ga0123356_10002017 | 3300010049 | Bacteria | 21929 |
| 71 | Ga0123353_10218915 | 3300010167 | Bacteria | 2979 |
| 72 | Ga0466696_138955 | 3300042596 | Bacteria | 6003 |
| 73 | JGI24705J35276_12231493 | 3300002504 | Bacteria | 3961 |
| 74 | Ga0466705_268544 | 3300042612 | Bacteria | 4986 |
| 75 | Ga0466717_287034 | 3300042604 | Bacteria | 9167 |
| 76 | Ga0466716_206999 | 3300042605 | Bacteria | 3723 |
| 77 | Ga0466703_029336 | 3300042636 | Bacteria | 13623 |
| 78 | Ga0466704_047730 | 3300042643 | Bacteria | 2796 |
| 79 | Ga0466704_407939 | 3300042643 | Bacteria | 23152 |
| 80 | Ga0466727_044570 | 3300042655 | Bacteria | 5949 |
| 81 | Ga0466715_204293 | 3300042616 | Bacteria | 67582 |
| 82 | Ga0466723_074619 | 3300042618 | Bacteria | 22019 |
| 83 | Ga0123353_10001375 | 3300010167 | Bacteria | 29812 |
| 84 | Ga0466696_165558 | 3300042596 | Bacteria | 2389 |
| 85 | Ga0466696_300579 | 3300042596 | Bacteria | 11220 |
| 86 | Ga0466733_103178 | 3300042659 | Bacteria | 47494 |
| 87 | Ga0466719_114910 | 3300042606 | Bacteria | 6897 |
| 88 | Ga0466719_311757 | 3300042606 | Bacteria | 8779 |
| 89 | Ga0466719_459978 | 3300042606 | Bacteria | 14509 |
| 90 | Ga0466722_148571 | 3300042609 | Bacteria | 6571 |
| 91 | Ga0466735_024733 | 3300042624 | Bacteria | 2923 |
| 92 | Ga0466703_115609 | 3300042636 | Bacteria | 6164 |
| 93 | Ga0466703_344027 | 3300042636 | Bacteria | 12646 |
| 94 | Ga0466708_063661 | 3300042652 | Bacteria | 27030 |
| 95 | Ga0466725_072069 | 3300042654 | Bacteria | 9691 |
| 96 | Ga0466727_344797 | 3300042655 | Bacteria | 17390 |
| 97 | Ga0466710_171695 | 3300042613 | Bacteria | 2425 |
| 98 | Ga0466715_131385 | 3300042616 | Bacteria | 16627 |
| 99 | Ga0466723_012980 | 3300042618 | Bacteria | 6563 |
| 100 | Ga0466723_311194 | 3300042618 | Bacteria | 4989 |
| 101 | Ga0466693_291239 | 3300042592 | Bacteria | 1445 |
| 102 | Ga0068305_10067023 | 3300005083 | Bacteria | 9990 |
| 103 | Ga0466705_070881 | 3300042612 | Bacteria | 9514 |
| 104 | Ga0466733_206935 | 3300042659 | Bacteria | 7267 |
| 105 | Ga0466701_102053 | 3300042598 | Bacteria | 13619 |
| 106 | Ga0466716_199526 | 3300042605 | Bacteria | 3089 |
| 107 | Ga0466735_033038 | 3300042624 | Bacteria | 3500 |
| 108 | Ga0466703_008369 | 3300042636 | Bacteria | 8581 |
| 109 | Ga0466703_045360 | 3300042636 | Bacteria | 7673 |
| 110 | Ga0123353_10084233 | 3300010167 | Bacteria | 5118 |
| 111 | Ga0123354_10133336 | 3300010882 | Bacteria | 3123 |
| 112 | JGI24705J35276_12228529 | 3300002504 | Bacteria | 3203 |
| 113 | Ga0068302_10068579 | 3300005071 | Bacteria | 3351 |
| 114 | Ga0068302_10077706 | 3300005071 | Bacteria | 2701 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.