Protein Family IF07603

Metagenome Isolate
109 Members
31 Samples
107 Scaffolds
188.87 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_013332|Ga0466715_013332_2347_3039
Length
230 aa
Sequence
MKRTFGAPPAVQAAEAGKESQSVTRAGSRPFARGSNLFLTGRMRLTVFISMILFSFMAGTVLAAETREDKSDMLVVYFSWSGNTRGIAKEIHQKVGGDIVEIELVKPYSSNYNTCLDEAKRDQEIQARPALKNHIADMGKYDVIFLGYPNWWASIPMPIASFLEKYDLSGKTIIPFCSHGGGRLGQSVSAIAKLSPRSKILEALSIHYSGGSSLRNDISAWLRKVGIEEK

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 45.2%
Termitidae 22.6%
Unclassified 16.1%
Rhinotermitidae 9.7%
Termopsidae 6.5%

🌳 Taxonomy

Archaea 2
Bacteria 95
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 2778260940 Unclassified Fibrobacteres Mp193P3bin36 Isolate Unclassified
10 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
11 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
14 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
18 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
27 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466734_001673 3300042623 Bacteria 1003
2 Ga0466703_153851 3300042636 Bacteria 6342
3 Ga0466704_072182 3300042643 Bacteria 5034
4 Ga0466727_104013 3300042655 Bacteria 2447
5 Ga0466707_304359 3300042601 Bacteria 1657
6 Ga0466719_151859 3300042606 Bacteria 4701
7 Ga0466715_389672 3300042616 Bacteria 1471
8 Ga0466726_079336 3300042619 Bacteria 3089
9 Ga0466726_128613 3300042619 Bacteria 4263
10 Ga0466728_040018 3300042620 Unclassified 3668
11 JGI24698J34947_10156135 3300002449 Bacteria 941
12 JGI24699J35502_10810331 3300002509 Bacteria 893
13 JGI24699J35502_11036430 3300002509 Unclassified 1544
14 Ga0466705_180006 3300042612 Bacteria 14139
15 Ga0466704_250391 3300042643 Unclassified 1346
16 Ga0466719_181010 3300042606 Bacteria 14792
17 Ga0466712_052492 3300042614 Bacteria 3792
18 Ga0466715_013332 3300042616 Bacteria 3353
19 Ga0466715_327506 3300042616 Bacteria 1015
20 Ga0466723_194322 3300042618 Bacteria 8112
21 Ga0466726_027505 3300042619 Bacteria 1511
22 Ga0466690_108394 3300042590 Bacteria 2058
23 Ga0466696_239211 3300042596 Bacteria 5455
24 JGI24699J35502_10866751 3300002509 Bacteria 982
25 Ga0466702_405472 3300042635 Unclassified 1855
26 Ga0466704_015084 3300042643 Bacteria 1005
27 Ga0466709_214076 3300042648 Bacteria 1325
28 Ga0466707_023635 3300042601 Bacteria 2941
29 Ga0466713_056591 3300042602 Bacteria 24570
30 Ga0466719_103894 3300042606 Unclassified 1044
31 Ga0466715_207235 3300042616 Bacteria 1444
32 Ga0466715_261338 3300042616 Unclassified 1547
33 Ga0466715_275550 3300042616 Bacteria 1392
34 Ga0466723_050188 3300042618 Bacteria 10753
35 Ga0466723_147133 3300042618 Bacteria 2315
36 Ga0466726_020528 3300042619 Bacteria 5855
37 Ga0466726_063690 3300042619 Bacteria 2953
38 Ga0466726_433005 3300042619 Bacteria 3894
39 Ga0466705_327501 3300042612 Bacteria 3286
40 Ga0466709_268346 3300042648 Bacteria 3006
41 Ga0466727_209894 3300042655 Bacteria 1100
42 Ga0466707_024193 3300042601 Bacteria 2196
43 Ga0466707_371838 3300042601 Bacteria 1829
44 Ga0466711_277003 3300042615 Bacteria 1522
45 Ga0466715_313234 3300042616 Bacteria 5306
46 Ga0466715_588110 3300042616 Bacteria 16163
47 Ga0466723_004586 3300042618 Bacteria 72614
48 Ga0466723_035407 3300042618 Bacteria 3347
49 Ga0466728_178999 3300042620 Bacteria 5641
50 Ga0466729_150966 3300042621 Bacteria 3976
51 Ga0466692_001349 3300042591 Unclassified 17229
52 Ga0466691_177844 3300042593 Bacteria 8097
53 Ga0466704_104121 3300042643 Archaea 1459
54 Ga0466709_003678 3300042648 Bacteria 12521
55 Ga0466709_103948 3300042648 Bacteria 1823
56 Ga0466712_113651 3300042614 Bacteria 1919
57 Ga0466711_161966 3300042615 Bacteria 6259
58 JGI24698J34947_10004291 3300002449 Unclassified 7758
59 JGI24698J34947_10082969 3300002449 Unclassified 1497
60 JGI24698J34947_10113620 3300002449 Bacteria 1190
61 JGI24702J35022_10107981 3300002462 Bacteria 1529
62 Ga0466705_358487 3300042612 Bacteria 1148
63 Ga0466703_183633 3300042636 Bacteria 9339
64 Ga0466709_324462 3300042648 Bacteria 2930
65 Ga0466727_178909 3300042655 Bacteria 2258
66 Ga0466722_119114 3300042609 Bacteria 1688
67 Ga0466705_424430 3300042612 Unclassified 1468
68 Ga0466715_330349 3300042616 Bacteria 1192
69 Ga0466715_361880 3300042616 Bacteria 6710
70 Ga0466728_029885 3300042620 Bacteria 2242
71 Ga0466728_083463 3300042620 Bacteria 1629
72 Ga0466728_179973 3300042620 Bacteria 5672
73 Ga0466728_327666 3300042620 Bacteria 2660
74 Ga0466728_355066 3300042620 Bacteria 6492
75 Ga0466691_080750 3300042593 Bacteria 1452
76 JGI24698J34947_10154116 3300002449 Unclassified 950
77 JGI24702J35022_10009138 3300002462 Bacteria 5579
78 Ga0466729_239241 3300042621 Bacteria 1967
79 Ga0466704_494350 3300042643 Bacteria 3603
80 Ga0466708_367907 3300042652 Bacteria 1204
81 Ga0466727_018809 3300042655 Bacteria 3983
82 Ga0466727_172020 3300042655 Bacteria 2852
83 Ga0466713_127166 3300042602 Bacteria 3321
84 Ga0466716_183019 3300042605 Archaea 1895
85 Ga0466712_088820 3300042614 Bacteria 2932
86 Ga0466711_448853 3300042615 Bacteria 3003
87 Ga0466715_503867 3300042616 Bacteria 1160
88 Ga0466723_179250 3300042618 Bacteria 11620
89 Ga0466726_008970 3300042619 Bacteria 2350
90 Ga0466690_336160 3300042590 Bacteria 1218
91 Ga0466691_031131 3300042593 Bacteria 14718
92 Ga0466691_101000 3300042593 Bacteria 16184
93 JGI24698J34947_10020660 3300002449 Unclassified 3544
94 Ga0466708_124717 3300042652 Bacteria 8055
95 Ga0466719_152734 3300042606 Bacteria 4800
96 Ga0466722_168594 3300042609 Bacteria 2212
97 Ga0466711_141081 3300042615 Bacteria 14492
98 Ga0466715_029050 3300042616 Bacteria 1063
99 Ga0466715_040587 3300042616 Bacteria 1350
100 Ga0466723_094133 3300042618 Bacteria 3327
101 Ga0466723_186007 3300042618 Bacteria 2607
102 Ga0466728_036315 3300042620 Bacteria 1150
103 Ga0466729_165676 3300042621 Bacteria 3381
104 Ga0466691_065156 3300042593 Bacteria 3478
105 Ga0466691_217802 3300042593 Bacteria 1316
106 JGI24697J35500_11274490 3300002507 Bacteria 7480
107 Ga0068305_10214534 3300005083 Bacteria 5040

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12682 Flavodoxin_4 Flavodoxin 73 224 0.88

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF12682 GO:0010181 FMN binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.