Protein Family IF07578

Metagenome
110 Members
20 Samples
110 Scaffolds
274.47 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_472287|Ga0466711_472287_6519_7388
Length
289 aa
Sequence
MSTFHPSYDKEFFMNGFRIALFFGLLSLAPLFAGGSKDAAAAAGEPYTVTVAGSTSVNPLMELLVADYAKVRGNVKFSISATGSGDGIKAVPSETAEIGMSSRELTPAELGTGIDVHLIAIDGIAVIVNKNNPVSDLTIDQIRDIYTGTAAAWNQVGGGSNGRIAVVSREPGSGTRGAFEEIVKFQDKLVRGAIEFDGTGAVKAEVSRNVDAIGYISLGSVDDSVKTLNVGGVAATTANVVNNSYKIARPFLLLTKQGKALHAETRQFLDWIVSPAGQNIVKTSWISVN

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 70.0%
Termitidae 30.0%

🌳 Taxonomy

Archaea 0
Bacteria 107
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
2 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
5 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
19 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
20 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_039333 3300042643 Bacteria 1405
2 Ga0466704_294600 3300042643 Bacteria 58418
3 Ga0466704_477329 3300042643 Bacteria 7960
4 Ga0466709_169431 3300042648 Bacteria 7517
5 Ga0466709_251626 3300042648 Bacteria 7786
6 Ga0466709_264700 3300042648 Bacteria 3949
7 Ga0466708_146826 3300042652 Bacteria 14862
8 Ga0466691_171877 3300042593 Bacteria 1150
9 Ga0466696_186899 3300042596 Bacteria 28959
10 Ga0466723_128269 3300042618 Bacteria 4156
11 Ga0466716_164334 3300042605 Bacteria 1370
12 Ga0466719_210765 3300042606 Bacteria 2122
13 Ga0466719_377405 3300042606 Bacteria 15588
14 Ga0466705_315412 3300042612 Bacteria 4454
15 Ga0466732_393270 3300042656 Bacteria 2620
16 Ga0466704_197206 3300042643 Bacteria 6992
17 Ga0466708_051045 3300042652 Bacteria 14594
18 Ga0466711_103257 3300042615 Bacteria 20144
19 Ga0466711_357550 3300042615 Bacteria 1838
20 Ga0466715_027130 3300042616 Bacteria 8746
21 Ga0466715_049227 3300042616 Bacteria 2631
22 Ga0466715_080388 3300042616 Bacteria 3423
23 Ga0466719_205537 3300042606 Bacteria 15096
24 Ga0466720_026808 3300042607 Bacteria 11297
25 Ga0466720_059050 3300042607 Bacteria 4179
26 Ga0466720_234004 3300042607 Bacteria 4779
27 Ga0466704_610778 3300042643 Bacteria 20198
28 Ga0466709_402809 3300042648 Bacteria 12806
29 Ga0466708_029978 3300042652 Bacteria 4574
30 Ga0466708_047752 3300042652 Bacteria 21129
31 Ga0466708_102890 3300042652 Bacteria 21227
32 Ga0466690_297112 3300042590 Bacteria 14826
33 Ga0466691_106902 3300042593 Bacteria 15921
34 Ga0466691_121218 3300042593 Bacteria 5140
35 Ga0466723_114181 3300042618 Bacteria 4072
36 Ga0466719_051990 3300042606 Bacteria 42283
37 Ga0466705_154636 3300042612 Bacteria 11383
38 Ga0466703_110457 3300042636 Bacteria 13852
39 Ga0466703_222906 3300042636 Bacteria 3581
40 Ga0466708_293230 3300042652 Bacteria 1920
41 JGI24702J35022_10003178 3300002462 Bacteria 9939
42 Ga0123353_11301932 3300010167 Bacteria 943
43 Ga0466691_127613 3300042593 Bacteria 9083
44 Ga0466696_099849 3300042596 Bacteria 1305
45 Ga0466705_505728 3300042612 Bacteria 8691
46 Ga0466711_392918 3300042615 Bacteria 6325
47 Ga0466715_601209 3300042616 Bacteria 3874
48 Ga0466723_091950 3300042618 Bacteria 3142
49 Ga0466723_097547 3300042618 Bacteria 11320
50 Ga0466723_243195 3300042618 Bacteria 87629
51 Ga0466728_120170 3300042620 Bacteria 2359
52 Ga0466719_073418 3300042606 Bacteria 18332
53 Ga0466719_155656 3300042606 Bacteria 23528
54 Ga0466719_241378 3300042606 Bacteria 18710
55 Ga0466705_013108 3300042612 Unclassified 6007
56 Ga0466732_152703 3300042656 Bacteria 7013
57 Ga0466703_085854 3300042636 Bacteria 15833
58 Ga0466703_228744 3300042636 Bacteria 2866
59 Ga0466704_166784 3300042643 Bacteria 45771
60 Ga0466704_233633 3300042643 Bacteria 14067
61 Ga0466704_417160 3300042643 Bacteria 44433
62 Ga0466709_218821 3300042648 Bacteria 2910
63 Ga0466709_265628 3300042648 Unclassified 2712
64 Ga0466708_408137 3300042652 Bacteria 19449
65 Ga0072940_1066677 3300005200 Bacteria 1157
66 Ga0123353_10742409 3300010167 Bacteria 1368
67 Ga0466690_134496 3300042590 Bacteria 1217
68 Ga0466691_137009 3300042593 Bacteria 1407
69 Ga0466696_007293 3300042596 Bacteria 16680
70 Ga0466696_209483 3300042596 Bacteria 5965
71 Ga0466696_381627 3300042596 Bacteria 2770
72 Ga0466711_020763 3300042615 Bacteria 11996
73 Ga0466715_305337 3300042616 Bacteria 16941
74 Ga0466728_232497 3300042620 Bacteria 2589
75 Ga0466728_266784 3300042620 Bacteria 3666
76 Ga0466728_422857 3300042620 Bacteria 1866
77 Ga0466705_069526 3300042612 Unclassified 4923
78 Ga0466732_372703 3300042656 Bacteria 2107
79 Ga0466703_125253 3300042636 Bacteria 15188
80 Ga0466703_182211 3300042636 Bacteria 6135
81 Ga0466709_294883 3300042648 Bacteria 25216
82 Ga0466709_399576 3300042648 Bacteria 2598
83 Ga0466708_147245 3300042652 Bacteria 5519
84 Ga0466690_297123 3300042590 Bacteria 2167
85 Ga0466711_016357 3300042615 Bacteria 16773
86 Ga0466715_031484 3300042616 Bacteria 30461
87 Ga0466715_107619 3300042616 Bacteria 4553
88 Ga0466715_120858 3300042616 Bacteria 7356
89 Ga0466715_199098 3300042616 Bacteria 46326
90 Ga0466715_387403 3300042616 Bacteria 4015
91 Ga0466715_389584 3300042616 Bacteria 3715
92 Ga0466723_311500 3300042618 Bacteria 1666
93 Ga0466728_148113 3300042620 Bacteria 8996
94 Ga0466709_358624 3300042648 Bacteria 17606
95 Ga0466708_017794 3300042652 Bacteria 11629
96 Ga0466708_114331 3300042652 Bacteria 7788
97 Ga0466690_208317 3300042590 Bacteria 1069
98 Ga0466690_328716 3300042590 Bacteria 2943
99 Ga0466699_294462 3300042597 Bacteria 2757
100 Ga0466711_472287 3300042615 Bacteria 15796
101 Ga0466715_088707 3300042616 Bacteria 3025
102 Ga0466723_046643 3300042618 Bacteria 8763
103 Ga0466723_156051 3300042618 Bacteria 7975
104 Ga0466716_181172 3300042605 Bacteria 2124
105 Ga0466705_094242 3300042612 Bacteria 12722
106 Ga0466703_135325 3300042636 Bacteria 34761
107 Ga0466704_583036 3300042643 Bacteria 6428
108 Ga0466709_159082 3300042648 Bacteria 13509
109 Ga0466691_067234 3300042593 Bacteria 1509
110 Ga0466728_025076 3300042620 Bacteria 15424

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF12849 PBP_like_2 PBP superfamily domain 42 275 0.91
PF12727 PBP_like PBP superfamily domain 70 228 0.85
PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein 49 282 0.72

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.