Protein Family IF07482

Metagenome Isolate
140 Members
25 Samples
138 Scaffolds
404.19 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_109380|Ga0466711_109380_15613_16968
Length
451 aa
Sequence
MFFAWGWLQEKYGSCSEKNRIGGKLPFIWYGEIRRDGLPLGQFKKCGMMSHTIDFQKVGEQTKAVHAGESPDPATQASAPNIVMSTTYVTGADTSFSVEGLDDKDPWIYTRWGNPTIHQLEEKLAALEEAETAVAFASGMSAITALLLHLLKAGDHAIVSDVAYAALSEITNEMIPALNIEITKVDTSDLEAVRKALKTNTKLIYIETPCNPLLRLTDIAEAAAIAHSRGARLAVDSTFATPLATKPLLLGADFVIHSLTKYLGGHGDALGGVVLGSKADLTPLRKKTAIRLGGSLSPFNAWLIMRGIATFPLRMRVHQENALEVAAYLERHPKVKRVIYPGLPSHPQYELAKRQMRNFSGMLTFQVEDGPAVARQVAERLRIIHYAVSLGHHRSLIFYLNSKELLQSSFHFSTEEQLASWKRFAGEGIFRLSIGLENASDLMADLEQALA

📊 Sample Types

Isolate 1.4%
Metagenome 98.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 56.0%
Unclassified 20.0%
Termopsidae 16.0%
Rhinotermitidae 8.0%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2967483437 Candidatus Ordinivivax streblomastigis St1 Isolate Unclassified
2 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
9 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
10 2695420314 Dysgonomonas sp. BGC7 Isolate Unclassified
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
13 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
14 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
15 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
16 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
17 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
18 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
19 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
20 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
21 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
22 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
23 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
24 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
25 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_343740 3300042590 Bacteria 1367
2 Ga0466691_063579 3300042593 Bacteria 12437
3 Ga0466707_218234 3300042601 Bacteria 13908
4 Ga0466716_216659 3300042605 Unclassified 3199
5 Ga0466716_414725 3300042605 Bacteria 14520
6 Ga0466719_021974 3300042606 Bacteria 12602
7 Ga0466719_092939 3300042606 Bacteria 3590
8 Ga0466719_336077 3300042606 Bacteria 16863
9 Ga0466722_161616 3300042609 Bacteria 10116
10 Ga0068302_10111289 3300005071 Bacteria 4700
11 Ga0068305_10019570 3300005083 Unclassified 8671
12 Ga0466735_028110 3300042624 Bacteria 2458
13 Ga0466735_081401 3300042624 Bacteria 1563
14 Ga0466703_062585 3300042636 Bacteria 3942
15 Ga0466703_121029 3300042636 Bacteria 8303
16 Ga0466703_125787 3300042636 Bacteria 10076
17 Ga0466703_367238 3300042636 Bacteria 2290
18 Ga0466704_379368 3300042643 Bacteria 15366
19 Ga0466709_008441 3300042648 Bacteria 7920
20 Ga0466711_511555 3300042615 Bacteria 26685
21 Ga0466715_230808 3300042616 Bacteria 7861
22 Ga0466715_352475 3300042616 Bacteria 2400
23 Ga0466715_613585 3300042616 Bacteria 24795
24 Ga0466723_197828 3300042618 Bacteria 1822
25 Ga0466723_273277 3300042618 Bacteria 7460
26 Ga0466726_212501 3300042619 Bacteria 2840
27 Ga0466726_390789 3300042619 Bacteria 4683
28 Ga0466728_029262 3300042620 Bacteria 6121
29 Ga0466728_244250 3300042620 Bacteria 26346
30 Ga0466705_302460 3300042612 Bacteria 17135
31 Ga0466713_104393 3300042602 Bacteria 13296
32 Ga0466719_344761 3300042606 Bacteria 8775
33 Ga0466722_007010 3300042609 Bacteria 11860
34 Ga0466722_019562 3300042609 Bacteria 3235
35 Ga0466722_099155 3300042609 Bacteria 9739
36 Ga0466722_133602 3300042609 Bacteria 28547
37 Ga0068305_10013580 3300005083 Bacteria 22922
38 Ga0466704_093900 3300042643 Bacteria 6692
39 Ga0466708_380321 3300042652 Bacteria 30943
40 Ga0466711_109380 3300042615 Bacteria 31839
41 Ga0466715_230818 3300042616 Bacteria 2144
42 Ga0466715_378282 3300042616 Bacteria 1945
43 Ga0466715_414776 3300042616 Bacteria 4729
44 Ga0466690_061152 3300042590 Bacteria 16956
45 Ga0466692_134007 3300042591 Bacteria 44957
46 Ga0466691_018038 3300042593 Bacteria 3326
47 Ga0466691_058842 3300042593 Bacteria 20577
48 Ga0466696_248140 3300042596 Bacteria 16110
49 Ga0466713_046709 3300042602 Bacteria 16791
50 Ga0466713_134411 3300042602 Bacteria 55260
51 Ga0466716_359977 3300042605 Bacteria 15823
52 Ga0466716_538741 3300042605 Bacteria 2141
53 Ga0466735_048140 3300042624 Bacteria 19884
54 Ga0466704_106212 3300042643 Bacteria 5372
55 Ga0466709_076964 3300042648 Bacteria 1437
56 Ga0466727_278967 3300042655 Bacteria 19997
57 Ga0466711_169718 3300042615 Bacteria 15322
58 Ga0466723_095121 3300042618 Bacteria 177949
59 Ga0466728_151249 3300042620 Bacteria 2167
60 Ga0466690_147945 3300042590 Bacteria 12336
61 Ga0466691_124020 3300042593 Bacteria 6235
62 Ga0466713_021284 3300042602 Bacteria 4532
63 Ga0466722_220474 3300042609 Bacteria 2171
64 Ga0068305_10243896 3300005083 Unclassified 4842
65 Ga0466735_020598 3300042624 Bacteria 7328
66 Ga0466703_391743 3300042636 Bacteria 10391
67 Ga0466708_040540 3300042652 Bacteria 6044
68 Ga0466727_105224 3300042655 Bacteria 3211
69 Ga0466727_116304 3300042655 Bacteria 13284
70 Ga0466711_175173 3300042615 Bacteria 2755
71 Ga0466715_018394 3300042616 Bacteria 12588
72 Ga0466715_028222 3300042616 Bacteria 5755
73 Ga0466715_032997 3300042616 Bacteria 17847
74 Ga0466715_302684 3300042616 Bacteria 1665
75 Ga0466726_074485 3300042619 Bacteria 3910
76 Ga0466728_011534 3300042620 Bacteria 28821
77 Ga0466728_422350 3300042620 Bacteria 7650
78 Ga0466690_325412 3300042590 Bacteria 27630
79 Ga0466713_071982 3300042602 Bacteria 4999
80 Ga0466713_072628 3300042602 Bacteria 9409
81 Ga0466713_115178 3300042602 Bacteria 2247
82 Ga0466716_317358 3300042605 Bacteria 5305
83 Ga0466719_019792 3300042606 Bacteria 1605
84 Ga0466722_038326 3300042609 Bacteria 14213
85 Ga0466722_129883 3300042609 Bacteria 2794
86 Ga0466735_061618 3300042624 Unclassified 10080
87 Ga0466735_104862 3300042624 Bacteria 5240
88 Ga0466735_108380 3300042624 Bacteria 3390
89 Ga0466727_053484 3300042655 Bacteria 8711
90 Ga0466727_131064 3300042655 Bacteria 28730
91 Ga0466711_298234 3300042615 Bacteria 16638
92 Ga0466715_112489 3300042616 Bacteria 27810
93 Ga0466715_231236 3300042616 Bacteria 2128
94 Ga0466715_243503 3300042616 Bacteria 31828
95 Ga0466715_436775 3300042616 Bacteria 9452
96 Ga0466723_279589 3300042618 Bacteria 1436
97 Ga0466728_115747 3300042620 Bacteria 7333
98 Ga0466728_437956 3300042620 Bacteria 21766
99 Ga0466705_177266 3300042612 Bacteria 6303
100 Ga0466691_023536 3300042593 Bacteria 7643
101 Ga0466713_039322 3300042602 Bacteria 5984
102 Ga0466719_497667 3300042606 Unclassified 3892
103 Ga0466703_228165 3300042636 Bacteria 7943
104 Ga0466704_009916 3300042643 Bacteria 12917
105 Ga0466704_068446 3300042643 Bacteria 36408
106 Ga0466709_247736 3300042648 Bacteria 5423
107 Ga0466709_248516 3300042648 Bacteria 8535
108 Ga0466708_080487 3300042652 Bacteria 11184
109 Ga0466708_224135 3300042652 Bacteria 28615
110 Ga0466727_271206 3300042655 Bacteria 3034
111 Ga0466711_186024 3300042615 Bacteria 17708
112 Ga0466711_465261 3300042615 Bacteria 22661
113 Ga0466715_081312 3300042616 Bacteria 2056
114 Ga0466715_476209 3300042616 Bacteria 12373
115 Ga0466726_079053 3300042619 Bacteria 14556
116 Ga0466690_264520 3300042590 Bacteria 31137
117 Ga0466707_401395 3300042601 Unclassified 3225
118 Ga0068302_10016178 3300005071 Unclassified 1775
119 Ga0068302_10016179 3300005071 Unclassified 2264
120 Ga0466704_048580 3300042643 Bacteria 7747
121 Ga0466704_054609 3300042643 Bacteria 4597
122 Ga0466715_624163 3300042616 Bacteria 5293
123 Ga0466723_054091 3300042618 Bacteria 7419
124 Ga0466705_183059 3300042612 Bacteria 1412
125 Ga0466707_354057 3300042601 Bacteria 1799
126 Ga0466713_151969 3300042602 Bacteria 9571
127 Ga0466716_421721 3300042605 Bacteria 3999
128 Ga0466719_188232 3300042606 Bacteria 6695
129 Ga0466719_238848 3300042606 Bacteria 13045
130 Ga0466722_098502 3300042609 Bacteria 31381
131 Ga0466722_118000 3300042609 Bacteria 5423
132 Ga0466704_080580 3300042643 Bacteria 3661
133 Ga0466704_236833 3300042643 Bacteria 2127
134 Ga0466709_065966 3300042648 Bacteria 5004
135 Ga0466709_102890 3300042648 Bacteria 3512
136 Ga0466709_163313 3300042648 Bacteria 13768
137 Ga0466715_121152 3300042616 Bacteria 1837
138 Ga0466715_276082 3300042616 Bacteria 11278

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme 61 450 0.92
PF00266 Aminotran_5 Aminotransferase class-V 118 281 0.8
PF01212 Beta_elim_lyase Beta-eliminating lyase 113 332 0.79
PF00155 Aminotran_1_2 Aminotransferase class I and II 116 267 0.77

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.