Protein Family IF07422

Metagenome Isolate
122 Members
37 Samples
115 Scaffolds
313.66 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_271720|Ga0466712_271720_603_1694
Length
363 aa
Sequence
VEVLDDKTFTFNDNQVILQLMKVSIIVPALNEEKLLPRLLKSIKVQDFDDYEVIVADAHSTDRTREVAGEYGCRVVDGGLPAAGRNTGAAAARGDFFFFLDADSMLPQGFIRNVYNEMQDRYIDLATCGIRPLSNYKLDRILHRAINLAVLLNLKIDPKAFGSCIFVTGRLFRRVGGFDETIYVAEDNDFVKRASVFSSLHFLNSVYVMVSIRRFEKEGRFAYMNKGIKLNLHRTFRGEIRNDGVVKYEFDAYNKQGEPEDRDFLDWLERRMLMLEENPRRSNKKWSGSRKAEIKHIQPQFDDFSHLVKDLDIYLDKKERQIRRLLKLKNFFKRRHIRKSKVCAIVTAQTTPIDEIKTPSISH

📊 Sample Types

Isolate 4.9%
Metagenome 95.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 47.2%
Kalotermitidae 25.0%
Unclassified 19.4%
Rhinotermitidae 5.6%
Termopsidae 2.8%

🌳 Taxonomy

Archaea 1
Bacteria 117
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
2 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
3 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
4 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
5 2781125685 Treponema sp. Lab288P1bin13 Isolate Unclassified
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
15 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
16 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
17 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
22 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
23 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2781125682 Treponema sp. Lab288P1bin107 Isolate Unclassified
27 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
34 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
35 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
36 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
37 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466699_016793 3300042597 Bacteria 1759
2 JGI24698J34947_10031887 3300002449 Bacteria 2769
3 JGI24698J34947_10032904 3300002449 Bacteria 2721
4 Ga0072941_1182316 3300005201 Bacteria 1146
5 Ga0072941_1193415 3300005201 Bacteria 3851
6 Ga0123356_10056010 3300010049 Bacteria 3672
7 Ga0466712_059970 3300042614 Bacteria 17474
8 Ga0466711_001289 3300042615 Bacteria 6958
9 Ga0466716_391403 3300042605 Bacteria 2095
10 Ga0466719_109571 3300042606 Bacteria 2105
11 Ga0466698_004445 3300042610 Bacteria 1933
12 Ga0466703_073711 3300042636 Bacteria 9670
13 Ga0466732_268078 3300042656 Bacteria 7106
14 Ga0466733_007173 3300042659 Bacteria 67598
15 Ga0466690_335178 3300042590 Bacteria 2874
16 Ga0466692_123467 3300042591 Bacteria 4672
17 Ga0466699_021802 3300042597 Bacteria 7243
18 Ga0466699_099040 3300042597 Bacteria 17566
19 AustNasuHG_c1010398 3300000089 Bacteria 3243
20 JGI24695J34938_10007398 3300002450 Bacteria 6434
21 JGI24702J35022_10018286 3300002462 Bacteria 3824
22 Ga0072941_1015615 3300005201 Bacteria 9980
23 Ga0466712_085549 3300042614 Bacteria 13086
24 Ga0466712_108423 3300042614 Bacteria 28842
25 Ga0466712_178379 3300042614 Unclassified 2620
26 Ga0466711_216294 3300042615 Bacteria 31475
27 Ga0466718_166264 3300042617 Bacteria 1258
28 Ga0466723_099153 3300042618 Bacteria 10115
29 Ga0466728_042688 3300042620 Bacteria 5137
30 Ga0466707_418498 3300042601 Bacteria 1228
31 Ga0466720_057406 3300042607 Bacteria 28295
32 Ga0466732_033852 3300042656 Unclassified 1514
33 Ga0466690_222460 3300042590 Bacteria 3291
34 Ga0466693_049712 3300042592 Bacteria 2603
35 Ga0466694_193230 3300042594 Bacteria 22493
36 Ga0466699_288541 3300042597 Bacteria 1230
37 AustNasuHG_c1004770 3300000089 Bacteria 4853
38 JGI24698J34947_10001594 3300002449 Bacteria 12043
39 JGI24698J34947_10087603 3300002449 Bacteria 1439
40 Ga0072941_1105684 3300005201 Bacteria 5069
41 Ga0466712_063005 3300042614 Bacteria 15781
42 Ga0466712_314881 3300042614 Bacteria 28566
43 Ga0466707_205504 3300042601 Bacteria 2619
44 Ga0466720_052864 3300042607 Bacteria 5977
45 Ga0466698_136936 3300042610 Bacteria 2456
46 Ga0466732_425734 3300042656 Bacteria 9801
47 Ga0466690_142909 3300042590 Bacteria 5580
48 Ga0466699_130936 3300042597 Bacteria 13849
49 Ga0466699_294712 3300042597 Bacteria 2098
50 Ga0466699_358098 3300042597 Bacteria 4119
51 JGI24698J34947_10010882 3300002449 Bacteria 4991
52 JGI24695J34938_10023587 3300002450 Bacteria 2965
53 Ga0072941_1000118 3300005201 Bacteria 19734
54 Ga0072941_1017016 3300005201 Bacteria 14806
55 Ga0072941_1044773 3300005201 Bacteria 4767
56 Ga0466712_034326 3300042614 Bacteria 1556
57 Ga0466723_066018 3300042618 Bacteria 34484
58 Ga0466707_028473 3300042601 Bacteria 3258
59 Ga0466720_042143 3300042607 Unclassified 2844
60 Ga0466703_034841 3300042636 Bacteria 9901
61 Ga0466692_162870 3300042591 Bacteria 1916
62 Ga0466699_155446 3300042597 Bacteria 9660
63 Ga0466699_163572 3300042597 Bacteria 5053
64 JGI24698J34947_10012428 3300002449 Bacteria 4666
65 JGI24698J34947_10018781 3300002449 Bacteria 3733
66 JGI24698J34947_10076243 3300002449 Bacteria 1590
67 JGI24698J34947_10083449 3300002449 Bacteria 1491
68 Ga0466712_271720 3300042614 Bacteria 2104
69 Ga0466711_160235 3300042615 Archaea 2792
70 Ga0466718_000914 3300042617 Bacteria 10508
71 Ga0466720_099645 3300042607 Bacteria 3138
72 Ga0466732_379259 3300042656 Bacteria 1720
73 Ga0466733_070707 3300042659 Bacteria 23395
74 Ga0466691_182946 3300042593 Bacteria 2009
75 JGI24698J34947_10000521 3300002449 Bacteria 18150
76 JGI24698J34947_10014341 3300002449 Unclassified 4316
77 JGI24698J34947_10026806 3300002449 Bacteria 3060
78 Ga0072940_1085921 3300005200 Bacteria 3609
79 Ga0123356_10006227 3300010049 Bacteria 12060
80 Ga0466711_287285 3300042615 Bacteria 5733
81 Ga0466718_084149 3300042617 Bacteria 9125
82 Ga0466700_015783 3300042600 Bacteria 1258
83 Ga0466700_450048 3300042600 Bacteria 3061
84 Ga0466707_150851 3300042601 Bacteria 3414
85 Ga0466720_053804 3300042607 Bacteria 29860
86 Ga0466720_229897 3300042607 Bacteria 16703
87 Ga0466722_093765 3300042609 Bacteria 5483
88 Ga0466694_025701 3300042594 Bacteria 12708
89 Ga0466699_044144 3300042597 Bacteria 8466
90 Ga0466699_062500 3300042597 Bacteria 15424
91 AustNasuHG_c1012161 3300000089 Bacteria 2975
92 JGI24698J34947_10040852 3300002449 Bacteria 2393
93 JGI24695J34938_10052460 3300002450 Bacteria 1779
94 Ga0072941_1001887 3300005201 Bacteria 25060
95 Ga0072941_1055446 3300005201 Bacteria 11027
96 Ga0466712_057623 3300042614 Bacteria 7762
97 Ga0466712_063446 3300042614 Bacteria 19601
98 Ga0466712_133281 3300042614 Bacteria 11397
99 Ga0466712_178665 3300042614 Bacteria 1723
100 Ga0466712_189475 3300042614 Bacteria 1118
101 Ga0466732_172971 3300042656 Bacteria 2849
102 Ga0466732_342105 3300042656 Bacteria 24480
103 Ga0466699_061297 3300042597 Bacteria 1554
104 JGI24698J34947_10025430 3300002449 Bacteria 3151
105 JGI24695J34938_10006785 3300002450 Bacteria 6802
106 JGI24695J34938_10054941 3300002450 Bacteria 1724
107 JGI24699J35502_11014338 3300002509 Bacteria 1416
108 Ga0072941_1078981 3300005201 Bacteria 5027
109 Ga0466726_386523 3300042619 Bacteria 1988
110 Ga0466720_031040 3300042607 Bacteria 19260
111 Ga0466720_054711 3300042607 Bacteria 8605
112 Ga0466720_059245 3300042607 Bacteria 14738
113 Ga0466722_086541 3300042609 Bacteria 17160
114 Ga0466722_226500 3300042609 Bacteria 7213
115 Ga0466708_009706 3300042652 Bacteria 37452

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042597 Ga0466699_288541 Ga0466699_288541_31_894 287
2 3300042597 Ga0466699_061297 Ga0466699_061297_602_1519 288
3 3300002449 JGI24698J34947_10000521 JGI24698J34947_1000052116 292
4 3300005201 Ga0072941_1193415 Ga0072941_11934155 292
5 3300002450 JGI24695J34938_10023587 JGI24695J34938_100235872 293
6 3300005201 Ga0072941_1017016 Ga0072941_101701618 294
7 3300005201 Ga0072941_1105684 Ga0072941_11056846 295
8 3300042619 Ga0466726_386523 Ga0466726_386523_766_1722 295
9 3300005201 Ga0072941_1000118 Ga0072941_100011819 296
10 3300002449 JGI24698J34947_10010882 JGI24698J34947_100108822 297
11 3300005201 Ga0072941_1055446 Ga0072941_10554466 297
12 3300042597 Ga0466699_099040 Ga0466699_099040_5901_6794 297
13 3300042614 Ga0466712_108423 Ga0466712_108423_5878_6795 297
14 3300042617 Ga0466718_166264 Ga0466718_166264_188_1084 298
15 3300042656 Ga0466732_172971 Ga0466732_172971_666_1562 298
16 3300000089 AustNasuHG_c1004770 AustNasuHG_10047703 299
17 3300042594 Ga0466694_025701 Ga0466694_025701_7877_8788 303
18 3300042600 Ga0466700_450048 Ga0466700_450048_104_1075 304
19 3300002449 JGI24698J34947_10040852 JGI24698J34947_100408522 305
20 3300010049 Ga0123356_10006227 Ga0123356_100062274 305
21 3300042614 Ga0466712_178665 Ga0466712_178665_69_986 305
22 3300002509 JGI24699J35502_11014338 JGI24699J35502_110143382 306
23 3300005201 Ga0072941_1015615 Ga0072941_10156159 306
24 3300042597 Ga0466699_021802 Ga0466699_021802_2852_3772 306
25 3300042597 Ga0466699_130936 Ga0466699_130936_5895_6815 306
26 3300042597 Ga0466699_155446 Ga0466699_155446_7755_8675 306
27 3300042597 Ga0466699_294712 Ga0466699_294712_985_1905 306
28 3300042601 Ga0466707_418498 Ga0466707_418498_234_1154 306
29 3300042614 Ga0466712_034326 Ga0466712_034326_315_1235 306
30 3300042614 Ga0466712_178379 Ga0466712_178379_760_1680 306
31 iso_pr_bacteria 2781125640 2781288656 306
32 3300042597 Ga0466699_016793 Ga0466699_016793_352_1308 307
33 3300042601 Ga0466707_205504 Ga0466707_205504_518_1441 307
34 3300042614 Ga0466712_133281 Ga0466712_133281_3082_4056 307
35 3300042607 Ga0466720_031040 Ga0466720_031040_14082_15023 308
36 3300002449 JGI24698J34947_10025430 JGI24698J34947_100254302 309
37 3300002449 JGI24698J34947_10032904 JGI24698J34947_100329042 309
38 3300002449 JGI24698J34947_10083449 JGI24698J34947_100834491 309
39 3300002449 JGI24698J34947_10087603 JGI24698J34947_100876031 309
40 3300042592 Ga0466693_049712 Ga0466693_049712_1417_2385 309
41 3300042614 Ga0466712_085549 Ga0466712_085549_8792_9721 309
42 3300042659 Ga0466733_007173 Ga0466733_007173_61384_62349 309
43 3300000089 AustNasuHG_c1012161 AustNasuHG_10121613 310
44 3300002450 JGI24695J34938_10054941 JGI24695J34938_100549412 310
45 3300005201 Ga0072941_1182316 Ga0072941_11823161 310
46 3300042597 Ga0466699_163572 Ga0466699_163572_3466_4398 310
47 3300042614 Ga0466712_189475 Ga0466712_189475_136_1068 310
48 3300042614 Ga0466712_314881 Ga0466712_314881_8789_9739 310
49 3300042636 Ga0466703_034841 Ga0466703_034841_5908_6873 310
50 3300000089 AustNasuHG_c1010398 AustNasuHG_10103982 311
51 3300002449 JGI24698J34947_10001594 JGI24698J34947_1000159410 311
52 3300042593 Ga0466691_182946 Ga0466691_182946_295_1260 311
53 3300042597 Ga0466699_044144 Ga0466699_044144_1613_2548 311
54 3300042601 Ga0466707_028473 Ga0466707_028473_739_1674 311
55 3300042607 Ga0466720_053804 Ga0466720_053804_26074_27039 311
56 3300042614 Ga0466712_057623 Ga0466712_057623_3849_4784 311
57 3300042614 Ga0466712_133281 Ga0466712_133281_1861_2796 311
58 3300002449 JGI24698J34947_10012428 JGI24698J34947_100124282 312
59 3300042618 Ga0466723_066018 Ga0466723_066018_29449_30423 312
60 3300042597 Ga0466699_358098 Ga0466699_358098_111_1052 313
61 3300042656 Ga0466732_425734 Ga0466732_425734_5579_6553 313
62 3300002449 JGI24698J34947_10026806 JGI24698J34947_100268062 314
63 3300002449 JGI24698J34947_10076243 JGI24698J34947_100762432 314
64 3300005200 Ga0072940_1085921 Ga0072940_10859215 314
65 3300005201 Ga0072941_1078981 Ga0072941_10789815 314
66 3300042597 Ga0466699_062500 Ga0466699_062500_6635_7579 314
67 iso_pr_bacteria 2781125685 2781416501 314
68 3300042607 Ga0466720_042143 Ga0466720_042143_1090_2064 315
69 3300042607 Ga0466720_059245 Ga0466720_059245_10772_11746 316
70 3300042656 Ga0466732_342105 Ga0466732_342105_10419_11372 317
71 iso_pr_bacteria 2781125682 2781408796 317
72 3300042609 Ga0466722_226500 Ga0466722_226500_4906_5862 318
73 3300042656 Ga0466732_268078 Ga0466732_268078_1339_2295 318
74 3300042607 Ga0466720_052864 Ga0466720_052864_2083_3057 319
75 3300002449 JGI24698J34947_10014341 JGI24698J34947_100143413 320
76 3300002449 JGI24698J34947_10031887 JGI24698J34947_100318873 320
77 3300042594 Ga0466694_193230 Ga0466694_193230_5590_6552 320
78 3300042607 Ga0466720_099645 Ga0466720_099645_68_1030 320
79 3300042609 Ga0466722_086541 Ga0466722_086541_13070_14032 320
80 3300042610 Ga0466698_004445 Ga0466698_004445_942_1904 320
81 3300042615 Ga0466711_160235 Ga0466711_160235_1242_2204 320
82 3300042659 Ga0466733_070707 Ga0466733_070707_15602_16564 320
83 3300042600 Ga0466700_015783 Ga0466700_015783_10_975 321
84 3300042605 Ga0466716_391403 Ga0466716_391403_78_1043 321
85 3300042607 Ga0466720_054711 Ga0466720_054711_3203_4168 321
86 3300042607 Ga0466720_057406 Ga0466720_057406_10102_11067 321
87 3300042607 Ga0466720_229897 Ga0466720_229897_8825_9817 321
88 3300042609 Ga0466722_093765 Ga0466722_093765_3301_4266 321
89 3300042610 Ga0466698_136936 Ga0466698_136936_1400_2365 321
90 3300042615 Ga0466711_287285 Ga0466711_287285_4260_5225 321
91 3300042620 Ga0466728_042688 Ga0466728_042688_523_1488 321
92 3300042652 Ga0466708_009706 Ga0466708_009706_9156_10121 321
93 3300042656 Ga0466732_033852 Ga0466732_033852_460_1425 321
94 3300042656 Ga0466732_379259 Ga0466732_379259_666_1631 321
95 iso_pr_bacteria 2781125696 2781441498 321
96 3300002462 JGI24702J35022_10018286 JGI24702J35022_100182861 322
97 3300042591 Ga0466692_123467 Ga0466692_123467_240_1208 322
98 3300042591 Ga0466692_162870 Ga0466692_162870_641_1609 322
99 3300042618 Ga0466723_099153 Ga0466723_099153_2351_3319 322
100 3300002450 JGI24695J34938_10052460 JGI24695J34938_100524602 323
101 3300042590 Ga0466690_142909 Ga0466690_142909_3255_4226 323
102 3300042590 Ga0466690_335178 Ga0466690_335178_1433_2404 323
103 3300042606 Ga0466719_109571 Ga0466719_109571_224_1195 323
104 3300042615 Ga0466711_001289 Ga0466711_001289_5685_6656 323
105 3300042636 Ga0466703_073711 Ga0466703_073711_6638_7609 323
106 3300002450 JGI24695J34938_10006785 JGI24695J34938_100067854 324
107 3300005201 Ga0072941_1001887 Ga0072941_100188714 324
108 3300010049 Ga0123356_10056010 Ga0123356_100560104 324
109 3300042614 Ga0466712_063446 Ga0466712_063446_3240_4214 324
110 3300042617 Ga0466718_084149 Ga0466718_084149_3816_4790 324
111 iso_pr_bacteria 2781125693 2781434070 324
112 3300002449 JGI24698J34947_10018781 JGI24698J34947_100187812 325
113 3300002450 JGI24695J34938_10007398 JGI24695J34938_100073986 325
114 3300042614 Ga0466712_063005 Ga0466712_063005_13351_14328 325
115 3300042617 Ga0466718_000914 Ga0466718_000914_4787_5764 325
116 3300005201 Ga0072941_1044773 Ga0072941_10447732 326
117 3300042590 Ga0466690_222460 Ga0466690_222460_1078_2058 326
118 3300042601 Ga0466707_150851 Ga0466707_150851_861_1841 326
119 3300042614 Ga0466712_059970 Ga0466712_059970_16097_17107 336
120 3300042615 Ga0466711_216294 Ga0466711_216294_23945_24973 342
121 iso_pr_bacteria 2781125631 2781267928 343
122 3300042614 Ga0466712_271720 Ga0466712_271720_603_1694 363

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00535 Glycos_transf_2 Glycosyl transferase family 2 24 131 0.86
PF13632 Glyco_trans_2_3 Glycosyl transferase family group 2 98 194 0.84
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 23 129 0.84

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.79 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.