Protein Family IF07414
Metagenome
Isolate
182
Members
52
Samples
174
Scaffolds
410.88
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_243120|Ga0466712_243120_873_2231
- Length
- 452 aa
- Sequence
- MNSIRGPDCFPKMRNVRGTVCVKCGAEFEAGNETYTCVNEAGGAKCGGILEIVYDYDYIKTRISRGKFTAGKDFSMWRYLDFLPIEEGSMPGPLRVGWSPLYKTGALGSALGLENLYVKDDGINPTSSLKDRASAIAAARALHAGKDTVACSSTGNAASSLAGAAASMGLKSVIFVPERAPQGKLTQLLIFGATVVSVKGDYGATFRLSAQAIEKYGWYNRNAAVNPYLSEGKKTVAMEIAEQLGLAANGHAAGAFMAPDYVAVSVGDGCTIAGIWKGFKALYAVGLIDRLPRLVSVQAEGCCPVNRAFERNAPIEPMEENTLADSIAVGLPRDGDKALAAIRESGGITVNVSDDEILAAMRLLGKTAGVFGEPAGAAGTAGLAKAAGRGLIPRNSLVVSIVTGNGLKDVASAQRAAGIGGGAIPDSNSESKLLRIEPDIDLLTRELAKLGI
Sample Types
Isolate
4.4%
Metagenome
95.6%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.2%
Kalotermitidae
27.5%
Unclassified
17.6%
Rhinotermitidae
7.8%
Termopsidae
5.9%
Taxonomy
Archaea
0
Bacteria
169
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820457604 | Unclassified Firmicutes Lab288P3bin15 | Isolate | Unclassified |
| 2 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 8 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 12 | 2820539610 | Unclassified Firmicutes Lab288P1bin136 | Isolate | Unclassified |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 24 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 25 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 26 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 34 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 35 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 36 | 2508501043 | Desulfovibrio termitidis HI1 | Isolate | Rhinotermitidae |
| 37 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 38 | 2989309576 | Sporomusa termitida DSM 4440 | Isolate | Unclassified |
| 39 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 40 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 41 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 42 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 43 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 44 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 45 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 46 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 47 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 48 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10010880 | 3300002449 | Bacteria | 4992 |
| 2 | Ga0466732_017777 | 3300042656 | Bacteria | 3228 |
| 3 | Ga0123353_10017783 | 3300010167 | Unclassified | 10475 |
| 4 | Ga0466700_331081 | 3300042600 | Unclassified | 1608 |
| 5 | Ga0466716_396596 | 3300042605 | Bacteria | 4517 |
| 6 | Ga0466716_424141 | 3300042605 | Bacteria | 3857 |
| 7 | Ga0466719_020532 | 3300042606 | Bacteria | 3803 |
| 8 | Ga0466720_052430 | 3300042607 | Bacteria | 2355 |
| 9 | Ga0415639_119341 | 3300038395 | Bacteria | 2080 |
| 10 | Ga0466690_286953 | 3300042590 | Unclassified | 8298 |
| 11 | Ga0466690_378795 | 3300042590 | Unclassified | 1354 |
| 12 | Ga0466693_247521 | 3300042592 | Bacteria | 3085 |
| 13 | Ga0466699_179119 | 3300042597 | Bacteria | 1793 |
| 14 | Ga0466715_166601 | 3300042616 | Bacteria | 13126 |
| 15 | Ga0466723_088682 | 3300042618 | Bacteria | 13386 |
| 16 | Ga0466723_319968 | 3300042618 | Bacteria | 6091 |
| 17 | Ga0466726_025403 | 3300042619 | Bacteria | 17152 |
| 18 | Ga0466726_444148 | 3300042619 | Bacteria | 3219 |
| 19 | Ga0466728_081288 | 3300042620 | Bacteria | 2826 |
| 20 | Ga0466703_070050 | 3300042636 | Bacteria | 14980 |
| 21 | Ga0466703_222543 | 3300042636 | Bacteria | 14737 |
| 22 | Ga0466708_070372 | 3300042652 | Bacteria | 12027 |
| 23 | Ga0466708_095088 | 3300042652 | Bacteria | 1800 |
| 24 | Ga0466727_037338 | 3300042655 | Bacteria | 3864 |
| 25 | JGI24698J34947_10010847 | 3300002449 | Bacteria | 4999 |
| 26 | JGI24702J35022_10078653 | 3300002462 | Bacteria | 1785 |
| 27 | Ga0466705_044863 | 3300042612 | Bacteria | 4323 |
| 28 | Ga0466707_206182 | 3300042601 | Bacteria | 5512 |
| 29 | Ga0466707_317717 | 3300042601 | Bacteria | 48916 |
| 30 | Ga0466720_049532 | 3300042607 | Bacteria | 16419 |
| 31 | Ga0466690_113881 | 3300042590 | Bacteria | 15072 |
| 32 | Ga0466690_195000 | 3300042590 | Bacteria | 11182 |
| 33 | Ga0466692_000184 | 3300042591 | Unclassified | 1669 |
| 34 | Ga0466692_094700 | 3300042591 | Bacteria | 5008 |
| 35 | Ga0466692_142815 | 3300042591 | Bacteria | 3615 |
| 36 | Ga0466692_196409 | 3300042591 | Bacteria | 2369 |
| 37 | Ga0466695_095830 | 3300042595 | Bacteria | 5834 |
| 38 | Ga0466699_155630 | 3300042597 | Bacteria | 2070 |
| 39 | Ga0466699_164390 | 3300042597 | Bacteria | 14924 |
| 40 | Ga0466699_398284 | 3300042597 | Bacteria | 4830 |
| 41 | Ga0466712_243120 | 3300042614 | Bacteria | 4717 |
| 42 | Ga0466711_041452 | 3300042615 | Bacteria | 22315 |
| 43 | Ga0466711_219283 | 3300042615 | Bacteria | 20243 |
| 44 | Ga0466715_321699 | 3300042616 | Bacteria | 15126 |
| 45 | Ga0466723_107886 | 3300042618 | Bacteria | 18885 |
| 46 | Ga0466723_159151 | 3300042618 | Bacteria | 13980 |
| 47 | Ga0466723_276999 | 3300042618 | Bacteria | 14136 |
| 48 | Ga0466703_028670 | 3300042636 | Bacteria | 14961 |
| 49 | JGI24698J34947_10000076 | 3300002449 | Bacteria | 31759 |
| 50 | JGI24698J34947_10002790 | 3300002449 | Bacteria | 9460 |
| 51 | Ga0072940_1047982 | 3300005200 | Bacteria | 3499 |
| 52 | Ga0466705_210081 | 3300042612 | Bacteria | 20349 |
| 53 | Ga0466732_015049 | 3300042656 | Bacteria | 8476 |
| 54 | Ga0466732_427730 | 3300042656 | Bacteria | 10803 |
| 55 | Ga0123353_10088335 | 3300010167 | Bacteria | 4992 |
| 56 | Ga0466713_098869 | 3300042602 | Bacteria | 1146 |
| 57 | Ga0466719_007979 | 3300042606 | Bacteria | 14174 |
| 58 | Ga0466719_120385 | 3300042606 | Bacteria | 4252 |
| 59 | Ga0466720_008850 | 3300042607 | Bacteria | 13895 |
| 60 | Ga0466720_047977 | 3300042607 | Bacteria | 1808 |
| 61 | Ga0466690_428176 | 3300042590 | Bacteria | 1812 |
| 62 | Ga0466692_109815 | 3300042591 | Bacteria | 1642 |
| 63 | Ga0466691_224021 | 3300042593 | Bacteria | 6496 |
| 64 | Ga0466695_040993 | 3300042595 | Bacteria | 7954 |
| 65 | Ga0466696_457311 | 3300042596 | Bacteria | 3171 |
| 66 | Ga0466699_413294 | 3300042597 | Bacteria | 25958 |
| 67 | Ga0466712_284256 | 3300042614 | Bacteria | 29285 |
| 68 | Ga0466715_559471 | 3300042616 | Bacteria | 1652 |
| 69 | Ga0466718_100759 | 3300042617 | Bacteria | 9859 |
| 70 | Ga0466723_051952 | 3300042618 | Bacteria | 20182 |
| 71 | Ga0466728_150536 | 3300042620 | Bacteria | 4582 |
| 72 | Ga0466728_464178 | 3300042620 | Bacteria | 4032 |
| 73 | Ga0466704_191460 | 3300042643 | Bacteria | 34072 |
| 74 | Ga0466709_039529 | 3300042648 | Bacteria | 1741 |
| 75 | Ga0466727_294921 | 3300042655 | Bacteria | 3915 |
| 76 | AustNasuHG_c1002404 | 3300000089 | Bacteria | 6759 |
| 77 | Ga0466705_084452 | 3300042612 | Bacteria | 9931 |
| 78 | Ga0123353_10328110 | 3300010167 | Unclassified | 2318 |
| 79 | Ga0466713_016528 | 3300042602 | Bacteria | 1529 |
| 80 | Ga0466720_019530 | 3300042607 | Bacteria | 2638 |
| 81 | Ga0466720_089305 | 3300042607 | Bacteria | 26279 |
| 82 | Ga0466692_016073 | 3300042591 | Bacteria | 3257 |
| 83 | Ga0466694_163913 | 3300042594 | Unclassified | 2758 |
| 84 | Ga0466699_147765 | 3300042597 | Bacteria | 14099 |
| 85 | Ga0466699_443303 | 3300042597 | Bacteria | 1944 |
| 86 | Ga0466712_202481 | 3300042614 | Bacteria | 11457 |
| 87 | Ga0466711_047694 | 3300042615 | Bacteria | 1677 |
| 88 | Ga0466723_159385 | 3300042618 | Bacteria | 4957 |
| 89 | Ga0466723_295199 | 3300042618 | Bacteria | 3586 |
| 90 | Ga0466723_356130 | 3300042618 | Bacteria | 2860 |
| 91 | Ga0466726_301741 | 3300042619 | Bacteria | 15887 |
| 92 | Ga0466728_239971 | 3300042620 | Bacteria | 4204 |
| 93 | Ga0466703_039800 | 3300042636 | Bacteria | 4165 |
| 94 | Ga0466708_445358 | 3300042652 | Bacteria | 8585 |
| 95 | Ga0466727_156089 | 3300042655 | Bacteria | 13935 |
| 96 | JGI24698J34947_10000603 | 3300002449 | Bacteria | 17214 |
| 97 | Ga0466705_071877 | 3300042612 | Bacteria | 11450 |
| 98 | Ga0466705_152584 | 3300042612 | Bacteria | 12577 |
| 99 | Ga0123357_10003785 | 3300009784 | Bacteria | 17504 |
| 100 | Ga0123354_10164009 | 3300010882 | Unclassified | 2622 |
| 101 | Ga0466716_063392 | 3300042605 | Bacteria | 1590 |
| 102 | Ga0466719_213626 | 3300042606 | Bacteria | 1824 |
| 103 | Ga0466719_328459 | 3300042606 | Bacteria | 19533 |
| 104 | Ga0466720_047098 | 3300042607 | Bacteria | 19090 |
| 105 | Ga0466690_141078 | 3300042590 | Bacteria | 12491 |
| 106 | Ga0466691_045640 | 3300042593 | Bacteria | 12384 |
| 107 | Ga0466694_069539 | 3300042594 | Bacteria | 3169 |
| 108 | Ga0466696_093318 | 3300042596 | Bacteria | 14554 |
| 109 | Ga0466699_195527 | 3300042597 | Bacteria | 1649 |
| 110 | Ga0466723_210369 | 3300042618 | Bacteria | 1570 |
| 111 | Ga0466703_092583 | 3300042636 | Bacteria | 10247 |
| 112 | Ga0466703_420165 | 3300042636 | Bacteria | 9754 |
| 113 | Ga0466704_422870 | 3300042643 | Bacteria | 5440 |
| 114 | JGI24698J34947_10000833 | 3300002449 | Bacteria | 15450 |
| 115 | Ga0068302_10002708 | 3300005071 | Bacteria | 8857 |
| 116 | Ga0466732_411204 | 3300042656 | Bacteria | 3042 |
| 117 | Ga0466716_015282 | 3300042605 | Bacteria | 25597 |
| 118 | Ga0466722_044108 | 3300042609 | Bacteria | 5874 |
| 119 | Ga0466698_026835 | 3300042610 | Bacteria | 11996 |
| 120 | Ga0264413_116939 | 3300024493 | Unclassified | 2052 |
| 121 | Ga0466699_008737 | 3300042597 | Bacteria | 5287 |
| 122 | Ga0466712_031862 | 3300042614 | Bacteria | 21250 |
| 123 | Ga0466715_108686 | 3300042616 | Bacteria | 11634 |
| 124 | Ga0466718_103167 | 3300042617 | Bacteria | 3678 |
| 125 | Ga0466728_099334 | 3300042620 | Bacteria | 5135 |
| 126 | Ga0466728_354354 | 3300042620 | Bacteria | 1567 |
| 127 | Ga0466704_334572 | 3300042643 | Bacteria | 24393 |
| 128 | Ga0466709_228776 | 3300042648 | Bacteria | 16366 |
| 129 | Ga0466709_305691 | 3300042648 | Bacteria | 3243 |
| 130 | Ga0466709_384634 | 3300042648 | Unclassified | 2816 |
| 131 | AustNasuHG_c1015385 | 3300000089 | Bacteria | 2581 |
| 132 | Ga0466732_039298 | 3300042656 | Bacteria | 1545 |
| 133 | Ga0466720_043305 | 3300042607 | Bacteria | 11476 |
| 134 | Ga0466720_179504 | 3300042607 | Bacteria | 13268 |
| 135 | Ga0264413_123934 | 3300024493 | Bacteria | 16438 |
| 136 | Ga0466691_119225 | 3300042593 | Bacteria | 2030 |
| 137 | Ga0466696_211180 | 3300042596 | Unclassified | 3935 |
| 138 | Ga0466712_021806 | 3300042614 | Bacteria | 7507 |
| 139 | Ga0466711_090458 | 3300042615 | Bacteria | 2201 |
| 140 | Ga0466711_510118 | 3300042615 | Bacteria | 3897 |
| 141 | Ga0466715_575004 | 3300042616 | Bacteria | 3026 |
| 142 | Ga0466718_076685 | 3300042617 | Bacteria | 2970 |
| 143 | Ga0466718_129875 | 3300042617 | Bacteria | 2696 |
| 144 | Ga0466726_215024 | 3300042619 | Bacteria | 3728 |
| 145 | Ga0466703_212245 | 3300042636 | Bacteria | 15087 |
| 146 | Ga0466708_075252 | 3300042652 | Bacteria | 11056 |
| 147 | Ga0466727_252663 | 3300042655 | Bacteria | 4375 |
| 148 | JGI24698J34947_10000106 | 3300002449 | Bacteria | 28864 |
| 149 | JGI24698J34947_10005000 | 3300002449 | Bacteria | 7266 |
| 150 | JGI24695J34938_10003954 | 3300002450 | Bacteria | 9997 |
| 151 | JGI24702J35022_10012434 | 3300002462 | Bacteria | 4734 |
| 152 | JGI24700J35501_10930847 | 3300002508 | Bacteria | 27907 |
| 153 | Ga0123354_10212369 | 3300010882 | Bacteria | 2086 |
| 154 | Ga0466720_082573 | 3300042607 | Unclassified | 8384 |
| 155 | Ga0466720_192283 | 3300042607 | Bacteria | 8530 |
| 156 | Ga0466722_039499 | 3300042609 | Bacteria | 2396 |
| 157 | Ga0466690_002907 | 3300042590 | Unclassified | 1982 |
| 158 | Ga0466692_200914 | 3300042591 | Bacteria | 9007 |
| 159 | Ga0466710_106534 | 3300042613 | Bacteria | 1953 |
| 160 | Ga0466712_075804 | 3300042614 | Bacteria | 38150 |
| 161 | Ga0466711_457952 | 3300042615 | Bacteria | 3612 |
| 162 | Ga0466715_076702 | 3300042616 | Bacteria | 6532 |
| 163 | Ga0466718_069594 | 3300042617 | Bacteria | 2943 |
| 164 | Ga0466718_069806 | 3300042617 | Bacteria | 6186 |
| 165 | Ga0466718_084915 | 3300042617 | Bacteria | 13702 |
| 166 | Ga0466723_079153 | 3300042618 | Bacteria | 2335 |
| 167 | Ga0466723_186396 | 3300042618 | Bacteria | 4055 |
| 168 | Ga0466726_004934 | 3300042619 | Bacteria | 1480 |
| 169 | Ga0466726_449292 | 3300042619 | Bacteria | 9398 |
| 170 | Ga0466728_150093 | 3300042620 | Bacteria | 8526 |
| 171 | Ga0466729_281765 | 3300042621 | Bacteria | 1683 |
| 172 | Ga0466704_574677 | 3300042643 | Bacteria | 6735 |
| 173 | Ga0466727_211017 | 3300042655 | Bacteria | 3027 |
| 174 | Ga0466727_312903 | 3300042655 | Bacteria | 3907 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00291 | PALP | Pyridoxal-phosphate dependent enzyme | 96 | 404 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.