Protein Family IF07365

Metagenome Isolate
127 Members
22 Samples
121 Scaffolds
244.76 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_096948|Ga0466712_096948_2381_3202
Length
273 aa
Sequence
LRRKIMKNEITILISSRHDEDSKCILDILSEQNDFRIVGVEKEEAGTIIKSDRLKPDVLVLDLPPPGISGEELAPIIHRRSPQTAIVMLCDRDEENYAGLALRSGIAGFLLKGKDTDKLAPVIRIVYNGGYYISASILIRVINAMTFTNSFSEHITEQENSRQILSPTEHSIITGIAQGLSDEEIAARLHFSAGTVKNYMSAIKRKTRLKNRVQIVICSLVYGLISFEQLGFGAKAPWIDAQEEKETVRRVKKRDRKKLKAGREISQDALSFS

📊 Sample Types

Isolate 4.7%
Metagenome 95.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 70.0%
Unclassified 30.0%

🌳 Taxonomy

Archaea 0
Bacteria 115
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
2 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
3 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
4 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
5 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
6 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
7 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
11 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
12 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
13 2781125640 Treponema sp. Co191P1bin37 Isolate Unclassified
14 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
15 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
16 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
17 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
18 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
21 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
22 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10196185 3300010049 Bacteria 2054
2 Ga0466712_049537 3300042614 Bacteria 5546
3 Ga0466712_069499 3300042614 Bacteria 9654
4 Ga0466712_109439 3300042614 Bacteria 27739
5 Ga0264413_137892 3300024493 Bacteria 1164
6 Ga0466694_123082 3300042594 Bacteria 1978
7 Ga0466694_270159 3300042594 Bacteria 3362
8 Ga0466720_035187 3300042607 Bacteria 9845
9 Ga0466731_275990 3300042622 Bacteria 1343
10 JGI24698J34947_10000251 3300002449 Bacteria 22586
11 JGI24698J34947_10014717 3300002449 Bacteria 4261
12 JGI24698J34947_10017542 3300002449 Bacteria 3878
13 JGI24695J34938_10003783 3300002450 Bacteria 10307
14 JGI24695J34938_10005709 3300002450 Bacteria 7680
15 JGI24695J34938_10025206 3300002450 Bacteria 2846
16 Ga0072941_1017274 3300005201 Bacteria 1212
17 Ga0072941_1017885 3300005201 Bacteria 2815
18 Ga0072941_1039823 3300005201 Bacteria 4107
19 Ga0123353_10306585 3300010167 Bacteria 2420
20 Ga0466694_023366 3300042594 Bacteria 3875
21 Ga0466720_071116 3300042607 Bacteria 2534
22 JGI24698J34947_10014524 3300002449 Bacteria 4288
23 Ga0072941_1002306 3300005201 Bacteria 1792
24 Ga0072941_1033015 3300005201 Bacteria 4896
25 Ga0072941_1038588 3300005201 Bacteria 2138
26 Ga0072941_1073603 3300005201 Bacteria 3604
27 Ga0123356_10049628 3300010049 Unclassified 3906
28 Ga0123353_10077290 3300010167 Bacteria 5349
29 Ga0466712_069703 3300042614 Bacteria 18452
30 Ga0466712_096948 3300042614 Bacteria 13734
31 Ga0466712_217011 3300042614 Bacteria 7780
32 Ga0466717_087285 3300042604 Bacteria 2283
33 Ga0466720_015233 3300042607 Bacteria 2361
34 JGI24698J34947_10056579 3300002449 Bacteria 1949
35 JGI24698J34947_10083877 3300002449 Bacteria 1485
36 JGI24695J34938_10003896 3300002450 Bacteria 10105
37 Ga0072941_1002929 3300005201 Bacteria 20203
38 Ga0072941_1028924 3300005201 Bacteria 22610
39 Ga0072941_1029537 3300005201 Bacteria 5959
40 Ga0072941_1040731 3300005201 Bacteria 1442
41 Ga0072941_1073394 3300005201 Bacteria 2332
42 Ga0072941_1124811 3300005201 Bacteria 1008
43 Ga0466712_056182 3300042614 Bacteria 5408
44 Ga0466712_085409 3300042614 Bacteria 4297
45 JGI24698J34947_10005604 3300002449 Bacteria 6886
46 JGI24698J34947_10010506 3300002449 Bacteria 5081
47 JGI24698J34947_10029620 3300002449 Bacteria 2891
48 JGI24698J34947_10034101 3300002449 Bacteria 2666
49 JGI24698J34947_10035565 3300002449 Bacteria 2599
50 JGI24698J34947_10057293 3300002449 Bacteria 1934
51 JGI24698J34947_10083284 3300002449 Bacteria 1493
52 JGI24695J34938_10019870 3300002450 Bacteria 3317
53 JGI24695J34938_10065953 3300002450 Bacteria 1527
54 JGI24695J34938_10066075 3300002450 Bacteria 1525
55 Ga0072941_1046951 3300005201 Bacteria 999
56 Ga0466712_000935 3300042614 Bacteria 58223
57 Ga0466712_059900 3300042614 Bacteria 16710
58 Ga0466712_232172 3300042614 Bacteria 6796
59 Ga0466712_304572 3300042614 Bacteria 4080
60 Ga0466718_103070 3300042617 Bacteria 3431
61 Ga0466718_158019 3300042617 Bacteria 1232
62 JGI24698J34947_10004299 3300002449 Bacteria 7753
63 JGI24698J34947_10021264 3300002449 Bacteria 3492
64 JGI24698J34947_10033148 3300002449 Unclassified 2711
65 JGI24698J34947_10073503 3300002449 Unclassified 1631
66 JGI24695J34938_10017831 3300002450 Bacteria 3566
67 JGI24695J34938_10024990 3300002450 Bacteria 2862
68 JGI24695J34938_10033745 3300002450 Bacteria 2352
69 Ga0072941_1002297 3300005201 Bacteria 13332
70 Ga0072941_1033032 3300005201 Bacteria 2793
71 Ga0072941_1099627 3300005201 Bacteria 2888
72 Ga0123356_10015045 3300010049 Bacteria 7424
73 Ga0466712_016428 3300042614 Bacteria 1748
74 Ga0466712_099166 3300042614 Bacteria 2091
75 Ga0466712_117775 3300042614 Bacteria 9897
76 Ga0466712_134277 3300042614 Unclassified 3452
77 Ga0466731_012920 3300042622 Bacteria 154202
78 JGI24698J34947_10000297 3300002449 Bacteria 21642
79 JGI24698J34947_10001601 3300002449 Bacteria 12030
80 JGI24698J34947_10006209 3300002449 Bacteria 6566
81 JGI24698J34947_10039490 3300002449 Bacteria 2443
82 JGI24698J34947_10053705 3300002449 Bacteria 2015
83 JGI24698J34947_10062708 3300002449 Unclassified 1824
84 JGI24698J34947_10067216 3300002449 Unclassified 1740
85 JGI24698J34947_10070386 3300002449 Bacteria 1684
86 JGI24698J34947_10093766 3300002449 Bacteria 1370
87 JGI24698J34947_10109896 3300002449 Bacteria 1219
88 JGI24698J34947_10113252 3300002449 Unclassified 1193
89 JGI24695J34938_10042689 3300002450 Bacteria 2027
90 Ga0072941_1015627 3300005201 Bacteria 8765
91 Ga0072941_1029535 3300005201 Bacteria 3609
92 Ga0072941_1099636 3300005201 Bacteria 2848
93 Ga0466732_439655 3300042656 Bacteria 12918
94 Ga0123356_10040105 3300010049 Bacteria 4362
95 Ga0123356_10837556 3300010049 Bacteria 1091
96 Ga0466712_088678 3300042614 Bacteria 9635
97 Ga0466712_098031 3300042614 Bacteria 43056
98 Ga0466712_110687 3300042614 Bacteria 1668
99 Ga0466712_224239 3300042614 Unclassified 3922
100 Ga0264413_108509 3300024493 Bacteria 4654
101 Ga0415639_021210 3300038395 Bacteria 16679
102 Ga0466694_004766 3300042594 Unclassified 7815
103 Ga0466694_129923 3300042594 Bacteria 5812
104 Ga0466702_442973 3300042635 Bacteria 2463
105 JGI24698J34947_10093182 3300002449 Bacteria 1376
106 JGI24698J34947_10132166 3300002449 Bacteria 1065
107 JGI24695J34938_10000673 3300002450 Bacteria 32282
108 JGI24697J35500_11271188 3300002507 Bacteria 4431
109 Ga0072941_1008420 3300005201 Bacteria 21514
110 Ga0072941_1009209 3300005201 Bacteria 4943
111 Ga0072941_1065876 3300005201 Bacteria 1282
112 Ga0123356_10010171 3300010049 Bacteria 9252
113 Ga0466712_233237 3300042614 Bacteria 4500
114 Ga0466720_000962 3300042607 Bacteria 4576
115 JGI24698J34947_10024264 3300002449 Unclassified 3240
116 JGI24698J34947_10033093 3300002449 Unclassified 2712
117 JGI24698J34947_10033922 3300002449 Bacteria 2674
118 JGI24698J34947_10109513 3300002449 Unclassified 1222
119 JGI24695J34938_10000137 3300002450 Bacteria 66242
120 JGI24697J35500_10992464 3300002507 Bacteria 931
121 Ga0072941_1029525 3300005201 Bacteria 1561

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00196 GerE Bacterial regulatory proteins, luxR family 164 217 0.97
PF00072 Response_reg Response regulator receiver domain 29 121 0.84

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00196 GO:0006355 regulation of DNA-templated transcription BP
PF00072 GO:0000160 phosphorelay signal transduction system BP

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.