Protein Family IF07363

Metagenome Isolate
212 Members
64 Samples
189 Scaffolds
403.95 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_088828|Ga0466712_088828_14832_16187
Length
451 aa
Sequence
MRANLKYYALYKYIKIFGKYLKNHVAFFFPVCYILSYRTVVNMTKTEIVEAAFRVWGRNFYQKTSLSQLAAELGVSKPALYRHFENKQALTAAMTERFLDDFASSIRADIEQTLQTGDADEGIHTIIKSISGHFARDVYALIFSLINIYERNLDGPTISQSLKLRGVDMGAVKSIVGKKYSSDTAVIHLLFATLSFFMSYFHKVMDSIKKPPSGEEIQKIIADINRVIECGLGYSAEKVAAMEYDKLEKKVEELSIDAEPEPLFRAVAEAVAEAGPWNASMDMVAKRLGLSKSSLYGHFKNKKDMLRRLFITEFGRIIEFARRGIKLSAMPEEQLYLGIYSIAVYFRLRPDILIAIGWIRTRKLDLGKPEKKKREIFRLFEDVDIETIRKGTEGEKQRISNWILFLLINVLTRPSMTENETQADCPLKSVQNNDIRVLFKFITLGLGGFKR

📊 Sample Types

Isolate 10.8%
Metagenome 89.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Unclassified 38.7%
Termitidae 35.5%
Kalotermitidae 21.0%
Termopsidae 3.2%
Rhinotermitidae 1.6%

🌳 Taxonomy

Archaea 1
Bacteria 198
Eukaryota 0
Viruses 0
Unclassified 13

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
3 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
4 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
8 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
13 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
14 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
15 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
16 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
17 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
18 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
19 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
20 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
24 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
25 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
26 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
27 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
28 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
29 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
30 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
31 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
32 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
33 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
34 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
35 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
36 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
37 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
38 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
39 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
40 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
41 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
42 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
43 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
44 650716102 Treponema primitia ZAS-2 Isolate Unclassified
45 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
46 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
47 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
48 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
51 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
52 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
53 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
54 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
55 2228664003 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA Metagenome Termitidae
56 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
57 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
58 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
59 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
60 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
61 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
62 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
63 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
64 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_107400 3300024493 Bacteria 71506
2 Ga0415639_008412 3300038395 Bacteria 8241
3 Ga0466693_096271 3300042592 Bacteria 19508
4 Ga0466691_218867 3300042593 Bacteria 5468
5 Ga0466723_189571 3300042618 Bacteria 2355
6 Ga0123356_10001228 3300010049 Bacteria 28467
7 Ga0123356_10018131 3300010049 Bacteria 6686
8 2230969619 2228664004 Bacteria 9983
9 JGI24695J34938_10000038 3300002450 Bacteria 98134
10 JGI24695J34938_10000752 3300002450 Bacteria 30427
11 JGI24695J34938_10005321 3300002450 Bacteria 8068
12 Ga0072941_1013544 3300005201 Bacteria 3147
13 Ga0072941_1083822 3300005201 Bacteria 6087
14 Ga0466703_004181 3300042636 Bacteria 1997
15 Ga0466698_182086 3300042610 Bacteria 27947
16 Ga0415639_085677 3300038395 Bacteria 4745
17 Ga0466690_092564 3300042590 Bacteria 5725
18 Ga0466694_014011 3300042594 Unclassified 18338
19 Ga0466694_028741 3300042594 Bacteria 6785
20 Ga0466694_175733 3300042594 Bacteria 14522
21 Ga0466712_058956 3300042614 Bacteria 1905
22 Ga0466723_016938 3300042618 Bacteria 8772
23 Ga0466728_283469 3300042620 Bacteria 1229
24 JGI24698J34947_10001974 3300002449 Bacteria 10950
25 JGI24698J34947_10003829 3300002449 Bacteria 8192
26 JGI24695J34938_10000732 3300002450 Bacteria 30912
27 JGI24695J34938_10013751 3300002450 Bacteria 4236
28 JGI24695J34938_10057034 3300002450 Bacteria 1681
29 JGI24697J35500_11272933 3300002507 Bacteria 5255
30 Ga0072941_1003915 3300005201 Bacteria 19537
31 Ga0072941_1007748 3300005201 Bacteria 28364
32 Ga0072941_1036386 3300005201 Bacteria 6834
33 Ga0466732_069128 3300042656 Bacteria 3796
34 Ga0466732_108585 3300042656 Bacteria 12023
35 Ga0264413_111864 3300024493 Bacteria 8243
36 Ga0415639_056308 3300038395 Bacteria 4071
37 Ga0466691_180374 3300042593 Bacteria 2759
38 Ga0466694_029784 3300042594 Bacteria 2475
39 Ga0466712_020064 3300042614 Unclassified 20440
40 Ga0466712_059885 3300042614 Bacteria 3546
41 Ga0466712_193225 3300042614 Bacteria 5236
42 Ga0466712_312922 3300042614 Bacteria 7621
43 Ga0466711_269329 3300042615 Bacteria 6769
44 Ga0466715_124455 3300042616 Bacteria 8153
45 Ga0466718_015585 3300042617 Bacteria 1897
46 Ga0466726_380820 3300042619 Bacteria 1775
47 Ga0123356_10030065 3300010049 Bacteria 5085
48 Ga0123356_10144830 3300010049 Bacteria 2349
49 AustNasuHG_c1000340 3300000089 Bacteria 16229
50 JGI24698J34947_10030221 3300002449 Bacteria 2858
51 JGI24698J34947_10081190 3300002449 Bacteria 1521
52 JGI24695J34938_10002360 3300002450 Bacteria 14530
53 JGI24695J34938_10005307 3300002450 Bacteria 8085
54 JGI24695J34938_10061200 3300002450 Bacteria 1603
55 Ga0072941_1011840 3300005201 Bacteria 5439
56 Ga0072941_1013543 3300005201 Bacteria 7299
57 Ga0466731_413704 3300042622 Bacteria 40616
58 Ga0466702_281727 3300042635 Bacteria 3918
59 Ga0466720_100686 3300042607 Bacteria 3093
60 Ga0466705_200116 3300042612 Bacteria 20846
61 Ga0466732_057397 3300042656 Bacteria 1902
62 Ga0264413_101280 3300024493 Bacteria 7567
63 Ga0264413_106471 3300024493 Unclassified 4237
64 Ga0466694_234487 3300042594 Bacteria 1602
65 Ga0466699_019090 3300042597 Bacteria 12661
66 Ga0466712_186219 3300042614 Bacteria 28603
67 Ga0466712_196978 3300042614 Bacteria 28864
68 Ga0466712_280515 3300042614 Bacteria 15183
69 Ga0123356_10000195 3300010049 Bacteria 69819
70 Ga0072940_1072591 3300005200 Bacteria 2446
71 Ga0072941_1011838 3300005201 Bacteria 6909
72 Ga0072941_1056191 3300005201 Bacteria 3967
73 Ga0466703_139884 3300042636 Bacteria 5887
74 Ga0466704_146920 3300042643 Bacteria 28455
75 Ga0466720_025122 3300042607 Bacteria 3102
76 Ga0466705_135381 3300042612 Bacteria 11645
77 Ga0415639_001985 3300038395 Bacteria 11669
78 Ga0466693_023928 3300042592 Bacteria 24055
79 Ga0466712_037334 3300042614 Bacteria 17662
80 Ga0466712_042735 3300042614 Bacteria 35616
81 Ga0466712_059886 3300042614 Bacteria 32530
82 Ga0466712_096568 3300042614 Unclassified 3659
83 Ga0466712_231847 3300042614 Bacteria 8253
84 Ga0466718_004538 3300042617 Bacteria 1743
85 Ga0466726_117772 3300042619 Bacteria 2548
86 Ga0466728_017046 3300042620 Bacteria 3100
87 Ga0123356_10000330 3300010049 Bacteria 54557
88 Ga0123356_10005129 3300010049 Bacteria 13420
89 Ga0123356_10006937 3300010049 Bacteria 11373
90 2230954233 2228664003 Unclassified 8412
91 JGI24698J34947_10000102 3300002449 Bacteria 29250
92 JGI24698J34947_10008893 3300002449 Bacteria 5511
93 JGI24698J34947_10046354 3300002449 Bacteria 2211
94 JGI24695J34938_10001061 3300002450 Bacteria 24936
95 JGI24695J34938_10001092 3300002450 Bacteria 24527
96 JGI24695J34938_10008843 3300002450 Bacteria 5696
97 JGI24695J34938_10010495 3300002450 Bacteria 5063
98 JGI24695J34938_10015502 3300002450 Bacteria 3909
99 Ga0072941_1038112 3300005201 Bacteria 6688
100 Ga0466731_280767 3300042622 Bacteria 3079
101 Ga0466702_274024 3300042635 Bacteria 1308
102 Ga0466727_296132 3300042655 Bacteria 3259
103 Ga0466716_353853 3300042605 Bacteria 2510
104 Ga0466720_092569 3300042607 Bacteria 5004
105 Ga0466720_115322 3300042607 Bacteria 42347
106 Ga0466705_011076 3300042612 Bacteria 1445
107 Ga0264413_124981 3300024493 Bacteria 2611
108 Ga0415639_006056 3300038395 Bacteria 6031
109 Ga0466694_051046 3300042594 Bacteria 57740
110 Ga0466694_062999 3300042594 Bacteria 5124
111 Ga0466695_319488 3300042595 Bacteria 4981
112 Ga0466699_033582 3300042597 Bacteria 2574
113 Ga0466699_066604 3300042597 Bacteria 19853
114 Ga0466699_195765 3300042597 Bacteria 3094
115 Ga0466712_029039 3300042614 Bacteria 2102
116 Ga0466712_065522 3300042614 Bacteria 16335
117 Ga0466712_088828 3300042614 Bacteria 30875
118 Ga0123356_10000738 3300010049 Bacteria 36054
119 Ga0123356_10020959 3300010049 Bacteria 6183
120 Ga0123353_10047532 3300010167 Bacteria 6826
121 Ga0123353_10087850 3300010167 Bacteria 5007
122 AustNasuHG_c1004912 3300000089 Bacteria 4787
123 JGI24695J34938_10001169 3300002450 Bacteria 23327
124 JGI24695J34938_10027037 3300002450 Bacteria 2717
125 JGI24695J34938_10077401 3300002450 Bacteria 1380
126 Ga0072940_1048224 3300005200 Bacteria 9143
127 Ga0072941_1105601 3300005201 Bacteria 1337
128 Ga0466702_450268 3300042635 Bacteria 2126
129 Ga0466709_018394 3300042648 Bacteria 10178
130 Ga0466727_238769 3300042655 Bacteria 1804
131 Ga0466722_119626 3300042609 Bacteria 7418
132 Ga0466705_027954 3300042612 Unclassified 2309
133 Ga0466693_204345 3300042592 Bacteria 6462
134 Ga0466705_447332 3300042612 Unclassified 3305
135 Ga0466712_134823 3300042614 Bacteria 4382
136 Ga0466712_144126 3300042614 Bacteria 6791
137 Ga0466712_262439 3300042614 Bacteria 14129
138 Ga0466718_013309 3300042617 Bacteria 4776
139 Ga0123356_10000104 3300010049 Bacteria 89487
140 Ga0123356_10007682 3300010049 Bacteria 10743
141 Ga0123356_10018500 3300010049 Unclassified 6614
142 Ga0123353_10239944 3300010167 Bacteria 2817
143 AustNasuHG_c1001466 3300000089 Bacteria 8469
144 JGI24698J34947_10000010 3300002449 Bacteria 46965
145 JGI24698J34947_10039511 3300002449 Bacteria 2442
146 JGI24695J34938_10000085 3300002450 Bacteria 80617
147 JGI24695J34938_10000668 3300002450 Bacteria 32394
148 JGI24695J34938_10001076 3300002450 Bacteria 24648
149 JGI24695J34938_10001214 3300002450 Bacteria 22845
150 JGI24695J34938_10001819 3300002450 Bacteria 17419
151 JGI24695J34938_10009441 3300002450 Bacteria 5424
152 JGI24695J34938_10020660 3300002450 Bacteria 3236
153 Ga0072941_1007039 3300005201 Bacteria 11655
154 Ga0072941_1011839 3300005201 Bacteria 5988
155 Ga0072941_1067331 3300005201 Bacteria 1874
156 Ga0466731_365675 3300042622 Bacteria 1946
157 Ga0466702_262916 3300042635 Bacteria 2710
158 Ga0466702_352249 3300042635 Bacteria 13235
159 Ga0466709_179272 3300042648 Bacteria 8966
160 Ga0466719_188098 3300042606 Bacteria 2346
161 Ga0466721_404203 3300042608 Bacteria 3965
162 Ga0466705_275903 3300042612 Bacteria 5767
163 Ga0466732_057698 3300042656 Bacteria 1628
164 Ga0415639_020013 3300038395 Bacteria 20089
165 Ga0466691_217782 3300042593 Bacteria 4952
166 Ga0466694_040623 3300042594 Bacteria 15871
167 Ga0466696_255166 3300042596 Bacteria 2660
168 Ga0466715_115568 3300042616 Bacteria 10394
169 Ga0123356_10119957 3300010049 Bacteria 2556
170 AustNasuHG_c1007418 3300000089 Bacteria 3908
171 JGI24698J34947_10005747 3300002449 Bacteria 6802
172 JGI24698J34947_10013237 3300002449 Unclassified 4507
173 JGI24698J34947_10015621 3300002449 Unclassified 4131
174 JGI24698J34947_10021871 3300002449 Archaea 3435
175 JGI24695J34938_10000053 3300002450 Bacteria 90544
176 JGI24695J34938_10000222 3300002450 Bacteria 54147
177 JGI24695J34938_10001019 3300002450 Bacteria 25330
178 JGI24695J34938_10001915 3300002450 Bacteria 16800
179 JGI24695J34938_10008082 3300002450 Unclassified 6056
180 JGI24695J34938_10031016 3300002450 Bacteria 2485
181 Ga0072941_1015254 3300005201 Unclassified 6374
182 Ga0072941_1029779 3300005201 Bacteria 15298
183 Ga0466731_034545 3300042622 Bacteria 11337
184 Ga0466702_003459 3300042635 Bacteria 14020
185 Ga0466707_315275 3300042601 Unclassified 2321
186 Ga0466720_032562 3300042607 Bacteria 37928
187 Ga0466721_039002 3300042608 Bacteria 9991
188 Ga0466722_089853 3300042609 Bacteria 12694
189 Ga0466722_119239 3300042609 Bacteria 9093

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00440 TetR_N Bacterial regulatory proteins, tetR family 48 94 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00440 GO:0003677 DNA binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.